HHsearch alignment for GI: 255764460 and conserved domain: cd03250

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=97.23  E-value=0.008  Score=37.41  Aligned_cols=43  Identities=37%  Similarity=0.616  Sum_probs=30.5

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHH------CCCEEEEEECCC
Q ss_conf             7268807999706872378999999875200------898799997388
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQK------TGGTCAFVDAEH  105 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk------~g~~~~~iD~E~  105 (363)
T Consensus        27 ~i~~Ge~~~IvG~sGsGKSTLl~~i~G~~~~~~G~I~~~g~i~~v~Q~~   75 (204)
T cd03250          27 EVPKGELVAIVGPVGSGKSSLLSALLGELEKLSGSVSVPGSIAYVSQEP   75 (204)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             9769989999999998589999998189525689522589889995877