HHsearch alignment for GI: 255764460 and conserved domain: cd03286

>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=95.54  E-value=0.043  Score=32.77  Aligned_cols=187  Identities=18%  Similarity=0.262  Sum_probs=86.4

Q ss_pred             HHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHH--HHCCCEEEEEECCC-CCCHH--HHHHHCCCHHHEEEEEC
Q ss_conf             789997238972688079997068723789999998752--00898799997388-55668--89981988334489725
Q gi|255764460|r   53 LGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQS--QKTGGTCAFVDAEH-ALDSI--YARKLGVDLKNLLISQP  127 (363)
Q Consensus        53 ~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~--qk~g~~~~~iD~E~-~~~~~--~a~~~Gvd~~~l~~~~~  127 (363)
T Consensus        19 VpNdi~l~-~--~~~~~~iiTGpN~sGKSt~lk~i~l~~ilaq~G~---~vpA~~~~~~~~d~i~~~i~-~~d~~~~~~S   91 (218)
T cd03286          19 VPNDVDLG-A--TSPRILVLTGPNMGGKSTLLRTVCLAVIMAQMGM---DVPAKSMRLSLVDRIFTRIG-ARDDIMKGES   91 (218)
T ss_pred             ECCEEEEC-C--CCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCC---CEECCCCEEECCCEEEEEEC-CCCCHHHHHH
T ss_conf             87568867-9--9740899989998873899999999999998288---43014647734664899745-8661431150


Q ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             84899999999997448976899814333220265543455530224788876776777764201781899986341145
Q gi|255764460|r  128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI  207 (363)
Q Consensus       128 ~~~E~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r~~i  207 (363)
T Consensus        92 tF~~e~~~~~~il~~~~~~sLvllDE~~~GT~~~--eg----------~ala~ai---le~L~~~~~~~~i~tTH~~el~  156 (218)
T cd03286          92 TFMVELSETANILRHATPDSLVILDELGRGTSTH--DG----------YAIAHAV---LEYLVKKVKCLTLFSTHYHSLC  156 (218)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEECCCCCCCCCCH--HH----------HHHHHHH---HHHHHHCCCCEEEEECCCHHHH
T ss_conf             6999999999999867998501025546899811--67----------9999999---9999863797699976728999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEECCCCCCCCEEEEEEECCCCCCCCCHHHHHHH
Q ss_conf             66546651256553111111248975045534457724767999877405778985158999861874231115999997
Q gi|255764460|r  208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGV  287 (363)
Q Consensus       208 g~m~g~p~~~~GG~al~~~aS~rl~i~k~~~ik~~~~~iG~~v~~kv~Knk~~~P~~~a~~~i~fg~GI~~~~~lldla~  287 (363)
T Consensus       157 ~~~~~~~~v-------~~----------------------~~m~~~-~~~~~~~~~~~l~f~YkL~~G~~~~s~ai~iA~  206 (218)
T cd03286         157 DEFHEHGGV-------RL----------------------GHMACA-VKNESDPTIRDITFLYKLVAGICPKSYGLYVAL  206 (218)
T ss_pred             HHHHHCCCC-------EE----------------------EEEEEE-EECCCCCCCCEEEEEEEECCCCCCCCHHHHHHH
T ss_conf             988648891-------89----------------------889999-963677878713288698879998719999999


Q ss_pred             HCCC
Q ss_conf             3286
Q gi|255764460|r  288 KASI  291 (363)
Q Consensus       288 ~~gi  291 (363)
T Consensus       207 ~~G~  210 (218)
T cd03286         207 MAGI  210 (218)
T ss_pred             HHCC
T ss_conf             9590