HHsearch alignment for GI: 255764460 and conserved domain: cd03292

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=96.99  E-value=0.0098  Score=36.86  Aligned_cols=43  Identities=23%  Similarity=0.335  Sum_probs=29.9

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             97268807999706872378999999875200898799997388
Q gi|255764460|r   62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        62 GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        22 l~i~~Ge~v~i~GpSGsGKSTLl-~~i~gl~~p~sG~i~i~g~~   64 (214)
T cd03292          22 ISISAGEFVFLVGPSGAGKSTLL-KLIYKEELPTSGTIRVNGQD   64 (214)
T ss_pred             EEECCCCEEEEECCCCCHHHHHH-HHHHCCCCCCCEEEEECCEE
T ss_conf             79859989999979995399999-99962989886499999999