HHsearch alignment for GI: 255764460 and conserved domain: pfam00931

>pfam00931 NB-ARC NB-ARC domain.
Probab=96.70  E-value=0.027  Score=34.13  Aligned_cols=85  Identities=20%  Similarity=0.157  Sum_probs=51.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHH--HHHCCCEEEEEECCCCCCHH-----HHHHHCCCHHHEEEEECCCHHHHHHHHHH
Q ss_conf             807999706872378999999875--20089879999738855668-----89981988334489725848999999999
Q gi|255764460|r   67 GRIVEIYGPESSGKTTLALHTIAQ--SQKTGGTCAFVDAEHALDSI-----YARKLGVDLKNLLISQPDTGEQALEITDM  139 (363)
Q Consensus        67 Gri~ei~G~~~sGKTtlal~~~a~--~qk~g~~~~~iD~E~~~~~~-----~a~~~Gvd~~~l~~~~~~~~E~~~~i~~~  139 (363)
T Consensus        19 ~~vI~I~G~gGiGKTtLA~~v~~~~~i~~~F~~~~wv~vs~~~~~~~i~~~i~~~l~~~~~~---~~~~~~~~l~~~l~~   95 (285)
T pfam00931        19 LGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDSD---WVEKNESELAVKIKE   95 (285)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCCHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCCC---CCCCCHHHHHHHHHH
T ss_conf             53999889995639999999971655650598389999797666899999999985666545---555789999999999


Q ss_pred             HHHCCCCCEEEEECCC
Q ss_conf             9744897689981433
Q gi|255764460|r  140 LVRSGAVDIIVIDSVA  155 (363)
Q Consensus       140 li~~~~~~liViDSi~  155 (363)
T Consensus        96 ~L~-~kr~LiVLDDVw  110 (285)
T pfam00931        96 ALL-RKRFLLVLDDVW  110 (285)
T ss_pred             HHC-CCCEEEEECCCC
T ss_conf             972-796699963888