HHsearch alignment for GI: 255764460 and conserved domain: pfam02283

>pfam02283 CobU Cobinamide kinase / cobinamide phosphate guanyltransferase. This family is composed of a group of bifunctional cobalamin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity. The crystal structure of the enzyme reveals the molecule to be a trimer with a propeller-like shape.
Probab=98.00  E-value=2.6e-05  Score=53.15  Aligned_cols=119  Identities=19%  Similarity=0.329  Sum_probs=72.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCC----HHHEEEEECCCHHHHHHHHHHHHHCCC
Q ss_conf             9997068723789999998752008987999973885566889981988----334489725848999999999974489
Q gi|255764460|r   70 VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVD----LKNLLISQPDTGEQALEITDMLVRSGA  145 (363)
Q Consensus        70 ~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~~~a~~~Gvd----~~~l~~~~~~~~E~~~~i~~~li~~~~  145 (363)
T Consensus         1 iLVtGG~rSGKS~~AE~la~~~---~~~~~YiAT~~~~D~Em~~RI~~Hr~~R~~~w~-----tiE~~~~l~~~l~~~~~   72 (166)
T pfam02283         1 ILVTGGARSGKSRFAERLALAS---GGPVVYIATAQAFDDEMAERIARHRARRPAGWT-----TIEEPLDLAEALARLPG   72 (166)
T ss_pred             CEEECCCCCCHHHHHHHHHHHC---CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCE-----EEECCCCHHHHHHHCCC
T ss_conf             9886887733899999999855---998199976988888999999999971899967-----99774459999984698


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCC-CCCEEEEEECCC
Q ss_conf             76899814333220265543455530224788876776777764201-781899986341
Q gi|255764460|r  146 VDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR-SKCILVFINQMR  204 (363)
Q Consensus       146 ~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k-~~~~~i~iNQ~r  204 (363)
T Consensus        73 ~~~vLiDclt~wl~N~l~~~~~-~-------~~~~~~~~~ll~~l~~~~~~~ViVsnEvG  124 (166)
T pfam02283        73 GDVVLVDCLTLWLTNLLFAGDD-E-------EDIEAEVDELLAALKARPAPVVLVSNEVG  124 (166)
T ss_pred             CCEEEEECHHHHHHHHHHCCCC-H-------HHHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             9869997177899998762374-7-------78999999999999748997999976767