HHsearch alignment for GI: 255764460 and conserved domain: pfam03029

>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Probab=96.78  E-value=0.0063  Score=38.06  Aligned_cols=33  Identities=24%  Similarity=0.242  Sum_probs=25.0

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             970687237899999987520089879999738
Q gi|255764460|r   72 IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE  104 (363)
Q Consensus        72 i~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E  104 (363)
T Consensus         1 ViGpaGSGKTT~~~~l~~~l~~~~r~~~vvNLD   33 (234)
T pfam03029         1 VVGGAGSGKTTFVGALSEILPLRGRSVYVVNLD   33 (234)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             989898988999999999999779975999789