HHsearch alignment for GI: 255764460 and conserved domain: pfam03266

>pfam03266 DUF265 Protein of unknown function, DUF265.
Probab=96.96  E-value=0.018  Score=35.25  Aligned_cols=113  Identities=24%  Similarity=0.322  Sum_probs=57.1

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHCCCE-EEEEECCCCCCHHHHHHHCCCH------HHEEEEECC------------CHH
Q ss_conf             997068723789999998752008987-9999738855668899819883------344897258------------489
Q gi|255764460|r   71 EIYGPESSGKTTLALHTIAQSQKTGGT-CAFVDAEHALDSIYARKLGVDL------KNLLISQPD------------TGE  131 (363)
Q Consensus        71 ei~G~~~sGKTtlal~~~a~~qk~g~~-~~~iD~E~~~~~~~a~~~Gvd~------~~l~~~~~~------------~~E  131 (363)
T Consensus         3 ~ITG~pGvGKTTli~kv~~~l~~~~~~v~GF~T~evre~---g~R~GF~iv~l~~g~~~~la~~~~~~~~~vGky~v~~~   79 (168)
T pfam03266         3 FITGPPGVGKTTLVKKVIELLKSEGVKVGGFYTPEVREG---GRRIGFDIVDLASGERGPLARVGGVSGPRVGKYVVNLE   79 (168)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCEECC---CCEEEEEEEECCCCCEEEEEEECCCCCCCCCCCEECHH
T ss_conf             997899988999999999999867970748993021258---93789999990478267744406887754577166689


Q ss_pred             HHHHHHHHHHHC--CCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             999999999744--89768998143332202655434555302247888767767777642017818999863411
Q gi|255764460|r  132 QALEITDMLVRS--GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRM  205 (363)
Q Consensus       132 ~~~~i~~~li~~--~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r~  205 (363)
T Consensus        80 ~fe~~~~~~L~~a~~~~dlivIDEIG~m----El~-----------s---~~F~~~v~~~l~-~~~~vl~ti~~~~  136 (168)
T pfam03266        80 EFEEIALPALRRALEEADLIIIDEIGPM----ELK-----------S---PKFREAIEEVLS-SNKPVLAVVHRRS  136 (168)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCCHH----HHH-----------H---HHHHHHHHHHHC-CCCCEEEEEEECC
T ss_conf             9999999999840668989999763145----331-----------4---999999999966-9997999997258