HHsearch alignment for GI: 255764460 and conserved domain: pfam06068

>pfam06068 TIP49 TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear
Probab=95.94  E-value=0.011  Score=36.65  Aligned_cols=99  Identities=26%  Similarity=0.367  Sum_probs=62.3

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC---------CCCHHHHHHHCCCHHHE--------EE
Q ss_conf             97268807999706872378999999875200898799997388---------55668899819883344--------89
Q gi|255764460|r   62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH---------ALDSIYARKLGVDLKNL--------LI  124 (363)
Q Consensus        62 GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~---------~~~~~~a~~~Gvd~~~l--------~~  124 (363)
T Consensus        45 ~~K~aGraiLlaGppGTGKTAlA~aiakeLG~~vPF~~i~gSEvyS~E~kKTE~L~qafRrsIGvrIkE~~eVyEGEV~e  124 (395)
T pfam06068        45 EGKIAGRAVLIAGPPGTGKTALAIAISKELGEDTPFCPISGSEVYSLEMKKTEALTQAFRKAIGVRIKEEKEVYEGEVVE  124 (395)
T ss_pred             HCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEHHEEECCCCCHHHHHHHHHHHHHCEEEEEEEEEEEEEEEE
T ss_conf             27757738998779998889999999997487997345001112125654889999999887556867888999999999


Q ss_pred             EEC---C--------------------CHHHH----HHHHHHHHHCCC--CCEEEEECCCCCCCH
Q ss_conf             725---8--------------------48999----999999974489--768998143332202
Q gi|255764460|r  125 SQP---D--------------------TGEQA----LEITDMLVRSGA--VDIIVIDSVAALTPR  160 (363)
Q Consensus       125 ~~~---~--------------------~~E~~----~~i~~~li~~~~--~~liViDSi~al~p~  160 (363)
T Consensus       125 i~~~~~~~p~~~~~k~~~~~~itLkT~~~~~~l~l~~~i~e~l~kekV~~GDVI~Id~~sG~V~k  189 (395)
T pfam06068       125 LEIEEAENPLSGYGKTIKHGKITLKTTKMEKTLKLGPKIYEQLQKEKVQAGDVIYIDKNTGKVKK  189 (395)
T ss_pred             EEEEECCCCCCCCCCCCEEEEEEEEECCCCEEEECCHHHHHHHHHCCCCCCCEEEEECCCCEEEE
T ss_conf             99741468889876540379999997588178725889999999749866878999858715999