HHsearch alignment for GI: 255764460 and conserved domain: pfam08423

>pfam08423 Rad51 Rad51. Rad51 is a DNA repair and recombination protein and is a homologue of the bacterial ATPase RecA protein.
Probab=100.00  E-value=0  Score=309.81  Aligned_cols=226  Identities=23%  Similarity=0.367  Sum_probs=188.5

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHH------HCCCEEEEEECCCCCCHH
Q ss_conf             66553346550147727899972389726880799970687237899999987520------089879999738855668
Q gi|255764460|r   37 SQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQ------KTGGTCAFVDAEHALDSI  110 (363)
Q Consensus        37 ~~~~~~~~~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~q------k~g~~~~~iD~E~~~~~~  110 (363)
T Consensus        14 ~~~~~r~~~~~isTg~~~LD~lLg-GGi~~g~ITEi~G~~gsGKTQlc~qlav~~qlp~~~gg~~g~vvyIDTEg~f~~e   92 (261)
T pfam08423        14 ELHQRRSEVIRITTGSKELDKLLG-GGIETGSITEVFGEFRTGKTQLCHTLCVTCQLPLEMGGGEGKALYIDTEGTFRPE   92 (261)
T ss_pred             HHHHHHCCCCEECCCCHHHHHHHC-CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCHHHHCCCCCEEEEEECCCCCCHH
T ss_conf             999975487357789878998737-9866772999989988878999999999940709656999728999368886989


Q ss_pred             H----HHHHCCC----HHHEEEEECCCHHHHHHHHH---HHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHH
Q ss_conf             8----9981988----33448972584899999999---99744897689981433322026554345553022478887
Q gi|255764460|r  111 Y----ARKLGVD----LKNLLISQPDTGEQALEITD---MLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLM  179 (363)
Q Consensus       111 ~----a~~~Gvd----~~~l~~~~~~~~E~~~~i~~---~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~m  179 (363)
T Consensus        93 Rl~qia~~~~~~~~~~L~~I~v~r~~~~~~~~~~l~~~~~~~~~~~v~LvVvDSiaalf-R~e~~g~---~~l~~R~~~L  168 (261)
T pfam08423        93 RIVAIAERFGLDPEEVLDNIAYARAYNTEHQMQLLLQAAAMMSESRFALLIVDSATALY-RTDFSGR---GELAERQQHL  168 (261)
T ss_pred             HHHHHHHHHCCCHHHHHHHCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEE-EECCCCC---CCHHHHHHHH
T ss_conf             99999998299978987533141689989999999999998731783499983240023-3300367---5289999999


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCCC---CCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEE
Q ss_conf             677677776420178189998634114566---54665125655311111124897504553445772476799987740
Q gi|255764460|r  180 SQALRKLTSSISRSKCILVFINQMRMKIGV---MFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK  256 (363)
Q Consensus       180 s~~lrkl~~~~~k~~~~~i~iNQ~r~~ig~---m~g~p~~~~GG~al~~~aS~rl~i~k~~~ik~~~~~iG~~v~~kv~K  256 (363)
T Consensus       169 ~~~l~~L~~lA~~~~~aVvvTNQV~~~~~~~~~f~~~~~~PagG~~~~h~~~~Rl~L~k~~---------g~~R~~~l~k  239 (261)
T pfam08423       169 AKFLRSLQRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGHIMAHASTTRLYLRKGR---------GEQRVCKIYD  239 (261)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCEECCCCCCCCCHHHHHHHCEEEEEEEECC---------CCEEEEEEEE
T ss_conf             9999999999998095899960479852886301378775750577773420899999669---------9847999987


Q ss_pred             CCCCCCCCEEEEEEECCCCCCC
Q ss_conf             5778985158999861874231
Q gi|255764460|r  257 NKMASPFKQVEFDIMYGEGISF  278 (363)
Q Consensus       257 nk~~~P~~~a~~~i~fg~GI~~  278 (363)
T Consensus       240 sp~~pe-~~~~F~It-~~GI~D  259 (261)
T pfam08423       240 SPCLPE-SEAVFAIS-EGGIGD  259 (261)
T ss_pred             CCCCCC-CEEEEEEE-CCCCCC
T ss_conf             899998-64899993-897126