BLAST/PSIBLAST alignment of GI: 255764460 and GI: 86357938 at iteration 1
>gi|86357938|ref|YP_469830.1| recombinase A [Rhizobium etli CFN 42] Length = 362
>gi|123751994|sp|Q2K7T3|RECA_RHIEC RecName: Full=Protein RecA; AltName: Full=Recombinase A Length = 362
>gi|86282040|gb|ABC91103.1| recombinase A protein [Rhizobium etli CFN 42] Length = 362
 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/335 (80%), Positives = 306/335 (91%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE VS+GSLGLDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-IETVSTGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA+SQK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ
Sbjct: 313 RENAKTFLRDNPDLAREIELALRQNAGLIADRFLQ 347