BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus
Liberibacter asiaticus str. psy62]
         (363 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62]
 gi|254547811|gb|ACT56665.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62]
          Length = 363

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/363 (100%), Positives = 363/363 (100%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG
Sbjct: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK
Sbjct: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
           NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS
Sbjct: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK
Sbjct: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS
Sbjct: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360
           FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD
Sbjct: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360

Query: 361 NVE 363
           NVE
Sbjct: 361 NVE 363


>gi|315122763|ref|YP_004063252.1| recombinase A [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496165|gb|ADR52764.1| recombinase A [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 348

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/346 (88%), Positives = 335/346 (96%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL+AALSQI+R+YGKG+IMQLGSQ SI EG+EVVSSGSLGLDIALGIGGFPKGRI
Sbjct: 1   MDKSKALDAALSQIERLYGKGSIMQLGSQSSISEGVEVVSSGSLGLDIALGIGGFPKGRI 60

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IAQSQK GGTCAFVDAEHALDS+YARKLGVDLKNLLISQPDT
Sbjct: 61  VEIYGPESSGKTTLALHAIAQSQKAGGTCAFVDAEHALDSVYARKLGVDLKNLLISQPDT 120

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITDMLVRSGAVDIIV+DSVAALTPRAEIEGDMGESLPG+QARLMSQALRKLT S
Sbjct: 121 GEQALEITDMLVRSGAVDIIVVDSVAALTPRAEIEGDMGESLPGLQARLMSQALRKLTGS 180

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS CIL+FINQ+RMKIGVMFGSPETTTGGNALKFY+S+RLDIRR+G+IK+KD+I GNQ
Sbjct: 181 ISRSNCILIFINQIRMKIGVMFGSPETTTGGNALKFYASIRLDIRRIGAIKEKDAIVGNQ 240

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMASPFKQVEFDIMYGEGIS  GELIDLGVKASIVDKSGAWFS+KGQRLGQG
Sbjct: 241 TRVKVVKNKMASPFKQVEFDIMYGEGISRVGELIDLGVKASIVDKSGAWFSYKGQRLGQG 300

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           REN+K+FLR+N+E+A +I++LLRQNAGLV+D LLQEPAINT+DDA+
Sbjct: 301 RENAKVFLRDNVEVASDIDNLLRQNAGLVSDILLQEPAINTRDDAN 346


>gi|163759602|ref|ZP_02166687.1| recombinase A [Hoeflea phototrophica DFL-43]
 gi|162283199|gb|EDQ33485.1| recombinase A [Hoeflea phototrophica DFL-43]
          Length = 360

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 269/345 (77%), Positives = 312/345 (90%), Gaps = 1/345 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKAL+AALSQI+R +GKG+IM+LG+  S+ E IE + +GSLGLDIALG+GG PKGRI
Sbjct: 14  VDKSKALDAALSQIERSFGKGSIMKLGANESVVE-IETIPTGSLGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG C F+DAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAEAQKKGGICGFIDAEHALDPVYARKLGVDLENLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+D++VIDSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGALDVLVIDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K++D +TGNQ
Sbjct: 193 ISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKERDEVTGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           RENSK FLR+N  +AE IE LLRQNAGL+A+  L+E   + +DDA
Sbjct: 313 RENSKQFLRDNPAVAEEIELLLRQNAGLIAEKFLEEDRSSGEDDA 357


>gi|90420927|ref|ZP_01228832.1| RecA [Aurantimonas manganoxydans SI85-9A1]
 gi|90334902|gb|EAS48674.1| RecA [Aurantimonas manganoxydans SI85-9A1]
          Length = 357

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/349 (76%), Positives = 313/349 (89%), Gaps = 1/349 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N +DK+KAL+AALSQI+R +GKG+IM+LG    I E IE VS+GSLGLDIALGIGG P
Sbjct: 10  EDNSLDKNKALDAALSQIERAFGKGSIMRLGENEKIVE-IETVSTGSLGLDIALGIGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGR+VE+YGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRVVEVYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPGMQARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGMQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRSKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D +
Sbjct: 189 LTGSISRSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
           TGNQT+VKVVKNK+A PFKQVEFDIMYGEG+S  GEL+DLGVK+ IV+KSGAWFS+  QR
Sbjct: 249 TGNQTKVKVVKNKLAPPFKQVEFDIMYGEGVSKTGELVDLGVKSGIVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           LGQGREN+K FLR+N  +A+ IE+L+RQNAGL+A+ LL +       DA
Sbjct: 309 LGQGRENAKSFLRDNPAVADEIETLIRQNAGLLAEQLLDDTGPGDDSDA 357


>gi|86357938|ref|YP_469830.1| recombinase A [Rhizobium etli CFN 42]
 gi|123751994|sp|Q2K7T3|RECA_RHIEC RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|86282040|gb|ABC91103.1| recombinase A protein [Rhizobium etli CFN 42]
          Length = 362

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/335 (80%), Positives = 306/335 (91%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE VS+GSLGLDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-IETVSTGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA+SQK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ
Sbjct: 313 RENAKTFLRDNPDLAREIELALRQNAGLIADRFLQ 347


>gi|114707287|ref|ZP_01440184.1| recombinase A [Fulvimarina pelagi HTCC2506]
 gi|114537168|gb|EAU40295.1| recombinase A [Fulvimarina pelagi HTCC2506]
          Length = 357

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 266/342 (77%), Positives = 310/342 (90%), Gaps = 1/342 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG      E +E VS+GSLGLDIALGIGG P
Sbjct: 10  EDNSVDKTKALDAALSQIERAFGKGSIMKLGQNNQSVE-VETVSTGSLGLDIALGIGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGR++EIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD IYARKLGVDL+NLL+S
Sbjct: 69  KGRVIEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPIYARKLGVDLENLLVS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPGMQARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGMQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRSKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKD+D +
Sbjct: 189 LTGSISRSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
           TGNQT+VKVVKNK+A PFKQVEFDIMYGEG+S  GELIDLGVK+ IV+KSGAWFS+  QR
Sbjct: 249 TGNQTKVKVVKNKLAPPFKQVEFDIMYGEGVSKMGELIDLGVKSGIVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPA 347
           LGQGREN+K FLR+N + A+ IE  +RQNAG++A+ LL++ A
Sbjct: 309 LGQGRENAKQFLRDNPDAAQEIEQSIRQNAGILAEKLLEDGA 350


>gi|90818648|emb|CAJ32629.1| recombinase A [Ochrobactrum anthropi]
          Length = 355

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/340 (77%), Positives = 309/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDKVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K++L+EN E+A  IE+ LRQNAGL+A+ LL++
Sbjct: 309 LGQGRENAKLYLKENPEVAREIETTLRQNAGLIAEQLLED 348


>gi|222148885|ref|YP_002549842.1| recombinase A [Agrobacterium vitis S4]
 gi|254790418|sp|B9JX56|RECA_AGRVS RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|221735871|gb|ACM36834.1| RecA protein [Agrobacterium vitis S4]
          Length = 362

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 310/353 (87%), Gaps = 1/353 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E   VDKSKALEAALSQI+R +GKG+IM+LG+   I E +E VS+GSL LDIALGIGG P
Sbjct: 10  EDKTVDKSKALEAALSQIERSFGKGSIMKLGANEKIVE-VETVSTGSLSLDIALGIGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRI+EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIIEIYGPESSGKTTLALQTIAEAQKKGGVCAFVDAEHALDPVYARKLGVDLQNLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++VIDSVAALTP+AEIEG+MG+SLPGMQARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVIDSVAALTPKAEIEGEMGDSLPGMQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C++VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++KD++ I
Sbjct: 189 LTGSISRSNCMVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKDREEI 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+K+GAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKAGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           LGQGREN+KIFLR+N  +A+ IE+ LRQNAGL+A+  L+    +  D    DD
Sbjct: 309 LGQGRENAKIFLRDNPAVADEIETALRQNAGLIAERFLENGGPDANDSVGLDD 361


>gi|195970165|ref|NP_385905.2| recombinase A [Sinorhizobium meliloti 1021]
 gi|307302672|ref|ZP_07582428.1| recA protein [Sinorhizobium meliloti BL225C]
 gi|307318520|ref|ZP_07597954.1| recA protein [Sinorhizobium meliloti AK83]
 gi|187904183|emb|CAC46378.2| DNA strand exchange and recombination protein [Sinorhizobium
           meliloti 1021]
 gi|306895860|gb|EFN26612.1| recA protein [Sinorhizobium meliloti AK83]
 gi|306903036|gb|EFN33627.1| recA protein [Sinorhizobium meliloti BL225C]
          Length = 361

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/349 (77%), Positives = 312/349 (89%), Gaps = 5/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LG++ S+ E IE VS+GSLGLDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGAKDSVVE-IETVSTGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG C FVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPVYARKLGVDLENLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+DI+VIDSVAAL PRAEIEG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAIDILVIDSVAALVPRAEIEGEMGDSLPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K+FLREN E+   IE+ LRQNAGL+AD  L+    N   ++D D+
Sbjct: 313 RENAKLFLRENPELLREIETALRQNAGLIADRFLE----NGGPESDGDE 357


>gi|150396733|ref|YP_001327200.1| recombinase A [Sinorhizobium medicae WSM419]
 gi|166220683|sp|A6U9N5|RECA_SINMW RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|150028248|gb|ABR60365.1| recA protein [Sinorhizobium medicae WSM419]
          Length = 361

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/348 (77%), Positives = 310/348 (89%), Gaps = 1/348 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LG++ S+ E IE VS+GSLGLDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERAFGKGSIMKLGAKDSVVE-IETVSTGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG C FVDAEHALD IYARKLGVDL+NLLISQPDT
Sbjct: 73  VEIYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPIYARKLGVDLENLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+D++V+DSVAAL PRAEIEG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAIDVLVVDSVAALVPRAEIEGEMGDSLPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           REN+K+FLR+N E+   IE+ LRQNAGL+AD  L+     ++ D   D
Sbjct: 313 RENAKLFLRDNPELLREIETALRQNAGLIADRFLENGGPESEGDEAAD 360


>gi|325293276|ref|YP_004279140.1| recombinase A [Agrobacterium sp. H13-3]
 gi|325061129|gb|ADY64820.1| recombinase A [Agrobacterium sp. H13-3]
          Length = 363

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/346 (77%), Positives = 309/346 (89%), Gaps = 3/346 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E +S+GSL LDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETISTGSLSLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVDI+V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDILVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 193 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE--PAINTKDD 353
           REN+K FLR+N E+A  IE  LRQNAGL+AD  LQ   P     DD
Sbjct: 313 RENAKTFLRDNPEMASEIELALRQNAGLIADRFLQNGGPEAGESDD 358


>gi|132237|sp|P27865|RECA_RHIME RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|581521|emb|CAA42580.1| RecA protein [Sinorhizobium meliloti]
          Length = 348

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 314/353 (88%), Gaps = 5/353 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALEAALSQI+R +GKG+IM+LG++ S+ E IE VS+GSLGLDIALGIGG PKGRI
Sbjct: 1   MDKSKALEAALSQIERSFGKGSIMKLGAKDSVVE-IETVSTGSLGLDIALGIGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG C FVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 60  IEIYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPVYARKLGVDLENLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+DI+VIDSVAAL PRAEIEG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 120 GEQALEITDTLVRSGAIDILVIDSVAALVPRAEIEGEMGDSLPGMQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 180 ISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNV 362
           REN+K+FLREN E+   IE+ LRQNAGL+AD  L+    N   ++D D+  ++
Sbjct: 300 RENAKLFLRENPELLREIETALRQNAGLIADRFLE----NGGPESDGDEAADM 348


>gi|110633616|ref|YP_673824.1| recombinase A [Mesorhizobium sp. BNC1]
 gi|123058023|sp|Q11IW6|RECA_MESSB RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|110284600|gb|ABG62659.1| RecA protein [Chelativorans sp. BNC1]
          Length = 360

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 264/349 (75%), Positives = 309/349 (88%), Gaps = 1/349 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDKSKAL+AALSQI+R +GKG+IM+LG+   + E IE +S+GSLGLDIALG+GG P
Sbjct: 10  EENGVDKSKALDAALSQIERAFGKGSIMRLGANDKVVE-IETISTGSLGLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           +GRI+EIYGPESSGKTTLALHT+A++QK GG C F+DAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  RGRIIEIYGPESSGKTTLALHTVAEAQKKGGICGFIDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEI D LVRSGAVD+IV+DSVAALTPRAEIEG+MGESLPGMQARLMSQALRK
Sbjct: 129 QPDTGEQALEICDTLVRSGAVDVIVVDSVAALTPRAEIEGEMGESLPGMQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD++  
Sbjct: 189 LTASISRSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDREET 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA +V+K+GAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGVVEKAGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           LGQGREN+K+FLR+N E+A  IE  LRQNAGL+A+  L+     + DDA
Sbjct: 309 LGQGRENAKLFLRDNPEVAREIELALRQNAGLIAERFLEADKDGSLDDA 357


>gi|227822194|ref|YP_002826165.1| recombinase A [Sinorhizobium fredii NGR234]
 gi|254790442|sp|C3MD93|RECA_RHISN RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|227341194|gb|ACP25412.1| RecA protein [Sinorhizobium fredii NGR234]
          Length = 361

 Score =  555 bits (1429), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/348 (76%), Positives = 309/348 (88%), Gaps = 1/348 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS+ S+ E IE VS+GSLGLDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSKDSVIE-IETVSTGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG C FVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPVYARKLGVDLENLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+D++V+DSVAAL PRAEIEG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAIDVLVVDSVAALVPRAEIEGEMGDSLPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELIDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           REN+K+FLR+N ++   IE  LRQNAGL+AD  L+     ++ D   D
Sbjct: 313 RENAKLFLRDNPDLLREIEMALRQNAGLIADKFLENGGPESEGDEAAD 360


>gi|218463763|ref|ZP_03503854.1| recombinase A [Rhizobium etli Kim 5]
          Length = 362

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/350 (76%), Positives = 311/350 (88%), Gaps = 5/350 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVIE-IETISTGSLGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDT 359
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ    N   DAD  D+
Sbjct: 313 RENAKTFLRDNPDLAREIELALRQNAGLIADRFLQ----NGGPDADDGDS 358


>gi|90818644|emb|CAJ32627.1| recombinase A [Ochrobactrum anthropi]
 gi|90818646|emb|CAJ32628.1| recombinase A [Ochrobactrum anthropi]
          Length = 355

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 307/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EENSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L++
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLED 348


>gi|89473577|emb|CAJ34601.1| recombinase A [Ochrobactrum lupini]
 gi|89473579|emb|CAJ34602.1| recombinase A [Ochrobactrum anthropi]
 gi|90818638|emb|CAJ32624.1| recombinase A [Ochrobactrum anthropi ATCC 49188]
 gi|90818640|emb|CAJ32625.1| recombinase A [Ochrobactrum anthropi]
 gi|90818642|emb|CAJ32626.1| recombinase A [Ochrobactrum tritici]
 gi|90818654|emb|CAJ32632.1| recombinase A [Ochrobactrum anthropi]
 gi|90818660|emb|CAJ32635.1| recombinase A [Ochrobactrum anthropi]
 gi|90818662|emb|CAJ32636.1| recombinase A [Ochrobactrum anthropi]
 gi|90818674|emb|CAJ43897.1| recombinase A [Ochrobactrum anthropi]
          Length = 355

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 260/340 (76%), Positives = 306/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG P
Sbjct: 10  EENSVDKTKALDAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L++
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLED 348


>gi|190892009|ref|YP_001978551.1| recombinase A protein [Rhizobium etli CIAT 652]
 gi|238692491|sp|B3PPU4|RECA_RHIE6 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|190697288|gb|ACE91373.1| recombinase A protein [Rhizobium etli CIAT 652]
 gi|327190520|gb|EGE57614.1| recombinase A protein [Rhizobium etli CNPAF512]
          Length = 362

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/335 (78%), Positives = 305/335 (91%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVIE-IETISTGSLGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA+SQK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ
Sbjct: 313 RENAKTFLRDNPDLAREIELALRQNAGLIADRFLQ 347


>gi|90818668|emb|CAJ32639.1| recombinase A [Ochrobactrum tritici]
          Length = 355

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 260/340 (76%), Positives = 306/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG P
Sbjct: 10  EENSVDKTKALDAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L++
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLED 348


>gi|90818656|emb|CAJ32633.1| recombinase A [Ochrobactrum anthropi]
          Length = 355

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 260/340 (76%), Positives = 306/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG P
Sbjct: 10  EENSVDKTKALDAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSSCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L++
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLED 348


>gi|256369626|ref|YP_003107136.1| recombinase A [Brucella microti CCM 4915]
 gi|255999788|gb|ACU48187.1| recombinase A [Brucella microti CCM 4915]
          Length = 361

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 306/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE++LRQNAGL+A+  L +
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETMLRQNAGLIAEQFLDD 348


>gi|153009316|ref|YP_001370531.1| recombinase A [Ochrobactrum anthropi ATCC 49188]
 gi|166220662|sp|A6X0E8|RECA_OCHA4 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|151561204|gb|ABS14702.1| recA protein [Ochrobactrum anthropi ATCC 49188]
          Length = 361

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 260/340 (76%), Positives = 306/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG P
Sbjct: 10  EENSVDKTKALDAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L++
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLED 348


>gi|90818650|emb|CAJ32630.1| recombinase A [Ochrobactrum anthropi]
 gi|90818652|emb|CAJ32631.1| recombinase A [Ochrobactrum anthropi]
 gi|90818666|emb|CAJ32638.1| recombinase A [Ochrobactrum intermedium]
          Length = 355

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 306/340 (90%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EENSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 348


>gi|218675164|ref|ZP_03524833.1| recombinase A [Rhizobium etli GR56]
          Length = 349

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/335 (78%), Positives = 305/335 (91%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG PKGRI
Sbjct: 1   MDKSKALEAALSQIERSFGKGSIMKLGSNENVIE-IETISTGSLGLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA+SQK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 60  IEIYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 180 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ
Sbjct: 300 RENAKTFLRDNPDLAREIELALRQNAGLIADRFLQ 334


>gi|159184959|ref|NP_354855.2| recombinase A [Agrobacterium tumefaciens str. C58]
 gi|417633|sp|P33156|RECA_AGRT5 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|159140237|gb|AAK87640.2| RecA protein [Agrobacterium tumefaciens str. C58]
          Length = 363

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 266/349 (76%), Positives = 309/349 (88%), Gaps = 1/349 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL++LLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQSLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++VIDSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVIDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 193 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FLR+N + A  IE  LRQNAGL+AD  LQ    +  +  D  D
Sbjct: 313 RENAKTFLRDNPDTANEIELALRQNAGLIADRFLQNGGPDAGEGDDGSD 361


>gi|306840332|ref|ZP_07473104.1| recA protein [Brucella sp. BO2]
 gi|306289731|gb|EFM60920.1| recA protein [Brucella sp. BO2]
          Length = 389

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 38  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 96

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 97  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 156

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 157 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 216

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 217 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 276

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 277 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 336

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 337 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 376


>gi|23502079|ref|NP_698206.1| recombinase A [Brucella suis 1330]
 gi|62290113|ref|YP_221906.1| recombinase A [Brucella abortus bv. 1 str. 9-941]
 gi|82700036|ref|YP_414610.1| recombinase A [Brucella melitensis biovar Abortus 2308]
 gi|161619157|ref|YP_001593044.1| recombinase A [Brucella canis ATCC 23365]
 gi|189024351|ref|YP_001935119.1| RecA bacterial DNA recombination protein [Brucella abortus S19]
 gi|225852698|ref|YP_002732931.1| recombinase A [Brucella melitensis ATCC 23457]
 gi|229220681|ref|NP_539704.2| recombinase A [Brucella melitensis bv. 1 str. 16M]
 gi|260546662|ref|ZP_05822401.1| recombinase A [Brucella abortus NCTC 8038]
 gi|260565545|ref|ZP_05836029.1| recombinase A [Brucella melitensis bv. 1 str. 16M]
 gi|260566268|ref|ZP_05836738.1| recombinase A [Brucella suis bv. 4 str. 40]
 gi|260754946|ref|ZP_05867294.1| recombinase A [Brucella abortus bv. 6 str. 870]
 gi|261214198|ref|ZP_05928479.1| recombinase A [Brucella abortus bv. 3 str. Tulya]
 gi|261219550|ref|ZP_05933831.1| recombinase A [Brucella ceti M13/05/1]
 gi|261314076|ref|ZP_05953273.1| recombinase [Brucella pinnipedialis M163/99/10]
 gi|261317836|ref|ZP_05957033.1| recombinase A [Brucella pinnipedialis B2/94]
 gi|261322045|ref|ZP_05961242.1| recombinase A [Brucella ceti M644/93/1]
 gi|261752510|ref|ZP_05996219.1| recombinase A [Brucella suis bv. 5 str. 513]
 gi|261755169|ref|ZP_05998878.1| recombinase A [Brucella suis bv. 3 str. 686]
 gi|261758393|ref|ZP_06002102.1| recombinase A [Brucella sp. F5/99]
 gi|265984260|ref|ZP_06096995.1| recombinase A [Brucella sp. 83/13]
 gi|265999433|ref|ZP_05466343.2| recombinase A [Brucella melitensis bv. 2 str. 63/9]
 gi|306838011|ref|ZP_07470869.1| recA protein [Brucella sp. NF 2653]
 gi|306844103|ref|ZP_07476697.1| recA protein [Brucella sp. BO1]
 gi|54039031|sp|P65976|RECA_BRUSU RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|54041791|sp|P65975|RECA_BRUME RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|68067733|sp|Q04761|RECA_BRUAB RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|123768490|sp|Q2YRU7|RECA_BRUA2 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|189039591|sp|A9M5L8|RECA_BRUC2 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|238689380|sp|B2S648|RECA_BRUA1 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|254790424|sp|C0RJG9|RECA_BRUMB RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|23348037|gb|AAN30121.1| recA protein [Brucella suis 1330]
 gi|62196245|gb|AAX74545.1| RecA, recA protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616137|emb|CAJ11180.1| RecA bacterial DNA recombination protein:ATP/GTP-binding site motif
           A (P-loop):AAA ATPase [Brucella melitensis biovar
           Abortus 2308]
 gi|161335968|gb|ABX62273.1| recA protein [Brucella canis ATCC 23365]
 gi|189019923|gb|ACD72645.1| RecA bacterial DNA recombination protein [Brucella abortus S19]
 gi|225641063|gb|ACO00977.1| recA protein [Brucella melitensis ATCC 23457]
 gi|260095712|gb|EEW79589.1| recombinase A [Brucella abortus NCTC 8038]
 gi|260151613|gb|EEW86707.1| recombinase A [Brucella melitensis bv. 1 str. 16M]
 gi|260155786|gb|EEW90866.1| recombinase A [Brucella suis bv. 4 str. 40]
 gi|260675054|gb|EEX61875.1| recombinase A [Brucella abortus bv. 6 str. 870]
 gi|260915805|gb|EEX82666.1| recombinase A [Brucella abortus bv. 3 str. Tulya]
 gi|260924639|gb|EEX91207.1| recombinase A [Brucella ceti M13/05/1]
 gi|261294735|gb|EEX98231.1| recombinase A [Brucella ceti M644/93/1]
 gi|261297059|gb|EEY00556.1| recombinase A [Brucella pinnipedialis B2/94]
 gi|261303102|gb|EEY06599.1| recombinase [Brucella pinnipedialis M163/99/10]
 gi|261738377|gb|EEY26373.1| recombinase A [Brucella sp. F5/99]
 gi|261742263|gb|EEY30189.1| recombinase A [Brucella suis bv. 5 str. 513]
 gi|261744922|gb|EEY32848.1| recombinase A [Brucella suis bv. 3 str. 686]
 gi|263093939|gb|EEZ17873.1| recombinase A [Brucella melitensis bv. 2 str. 63/9]
 gi|264662852|gb|EEZ33113.1| recombinase A [Brucella sp. 83/13]
 gi|306275546|gb|EFM57278.1| recA protein [Brucella sp. BO1]
 gi|306406935|gb|EFM63156.1| recA protein [Brucella sp. NF 2653]
          Length = 361

 Score =  551 bits (1420), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 348


>gi|89473563|emb|CAJ34594.1| recombinase A [Brucella abortus]
 gi|89473565|emb|CAJ34595.1| recombinase A [Brucella canis]
 gi|89473567|emb|CAJ34596.1| recombinase A [Brucella neotomae]
 gi|89473569|emb|CAJ34597.1| recombinase A [Brucella ovis]
 gi|89473571|emb|CAJ34598.1| recombinase A [Brucella suis 1330]
 gi|89473573|emb|CAJ34599.1| recombinase A [Brucella pinnipedialis]
 gi|89473575|emb|CAJ34600.1| recombinase A [Brucella ceti]
 gi|90818664|emb|CAJ32637.1| recombinase A [Brucella melitensis]
          Length = 355

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 348


>gi|254502491|ref|ZP_05114642.1| protein RecA [Labrenzia alexandrii DFL-11]
 gi|222438562|gb|EEE45241.1| protein RecA [Labrenzia alexandrii DFL-11]
          Length = 355

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/348 (76%), Positives = 315/348 (90%), Gaps = 3/348 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E + +DK+KAL+AALSQI+R +GKG+IM++G QG + E ++ VS+GSLGLDIALGIGG P
Sbjct: 10  ESSQMDKTKALDAALSQIERAFGKGSIMRMG-QGQVVE-VQSVSTGSLGLDIALGIGGLP 67

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHT+A++QKTGG CAF+DAEHALD IYARKLGVD+ NLLIS
Sbjct: 68  KGRIVEIYGPESSGKTTLALHTVAEAQKTGGICAFIDAEHALDPIYARKLGVDIDNLLIS 127

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPD GEQALEI D LVRSGA+D++VIDSVAALTP+AE+EG+MG+SLPGMQARLMSQALRK
Sbjct: 128 QPDAGEQALEIADTLVRSGAIDVLVIDSVAALTPKAELEGEMGDSLPGMQARLMSQALRK 187

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SIS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKDKD +
Sbjct: 188 LTASISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDKDEV 247

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PF+QVEFDI+YGEG+S  GELIDLGVK  IV+KSGAWFS+  QR
Sbjct: 248 VGNQTRVKVVKNKLAPPFRQVEFDIIYGEGVSKMGELIDLGVKGGIVEKSGAWFSYNSQR 307

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           LGQGRENSK FLREN EIA+ IE  +RQNAGL+A++++ +PA   +DD
Sbjct: 308 LGQGRENSKQFLRENKEIADEIELSIRQNAGLIAEAII-DPAGGEEDD 354


>gi|163843467|ref|YP_001627871.1| recombinase A [Brucella suis ATCC 23445]
 gi|189039592|sp|B0CH00|RECA_BRUSI RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|163674190|gb|ABY38301.1| recA protein [Brucella suis ATCC 23445]
          Length = 361

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 MGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 348


>gi|260758162|ref|ZP_05870510.1| recombinase A [Brucella abortus bv. 4 str. 292]
 gi|260761988|ref|ZP_05874331.1| recombinase A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260668480|gb|EEX55420.1| recombinase A [Brucella abortus bv. 4 str. 292]
 gi|260672420|gb|EEX59241.1| recombinase A [Brucella abortus bv. 2 str. 86/8/59]
          Length = 420

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 69  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 127

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 128 KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 187

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 188 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 247

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 248 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 307

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 308 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 367

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 368 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 407


>gi|225627673|ref|ZP_03785710.1| recA protein [Brucella ceti str. Cudo]
 gi|225617678|gb|EEH14723.1| recA protein [Brucella ceti str. Cudo]
          Length = 424

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 73  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 131

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 132 KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 191

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 192 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 251

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 252 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 311

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 312 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 371

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 372 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 411


>gi|222086163|ref|YP_002544695.1| recombinase A protein [Agrobacterium radiobacter K84]
 gi|254790417|sp|B9JFS7|RECA_AGRRK RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|221723611|gb|ACM26767.1| recombinase A protein [Agrobacterium radiobacter K84]
          Length = 361

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/346 (77%), Positives = 309/346 (89%), Gaps = 5/346 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE VS+GSL LDIALGIGG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-IETVSTGSLSLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           REN+K+FLR+N ++A  IE  LRQNAGL+AD  LQ    N   DAD
Sbjct: 313 RENAKLFLRDNPDLAREIELSLRQNAGLIADRFLQ----NGGPDAD 354


>gi|237815621|ref|ZP_04594618.1| recA protein [Brucella abortus str. 2308 A]
 gi|237788919|gb|EEP63130.1| recA protein [Brucella abortus str. 2308 A]
          Length = 424

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 73  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 131

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 132 KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 191

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 192 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 251

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 252 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 311

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 312 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 371

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 372 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 411


>gi|297248509|ref|ZP_06932227.1| recombinase A [Brucella abortus bv. 5 str. B3196]
 gi|17982728|gb|AAL51968.1| reca protein [Brucella melitensis bv. 1 str. 16M]
 gi|297175678|gb|EFH35025.1| recombinase A [Brucella abortus bv. 5 str. B3196]
          Length = 378

 Score =  550 bits (1418), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 27  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 85

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 86  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 145

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 146 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 205

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 206 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 265

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 266 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 325

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 326 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 365


>gi|241204889|ref|YP_002975985.1| recombinase A [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858779|gb|ACS56446.1| recA protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 364

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 268/352 (76%), Positives = 311/352 (88%), Gaps = 10/352 (2%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG P+GRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-IETISTGSLGLDIALGVGGLPRGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ----EPAINTKDDADKD 357
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ    EP     DD D D
Sbjct: 313 RENAKTFLRDNPDLAREIELSLRQNAGLIADRFLQNGGPEP-----DDGDGD 359


>gi|148559731|ref|YP_001259122.1| recombinase A [Brucella ovis ATCC 25840]
 gi|148370988|gb|ABQ60967.1| protein RecA [Brucella ovis ATCC 25840]
          Length = 424

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 73  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 131

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 132 KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 191

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 192 QPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 251

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 252 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 311

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 312 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 371

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 372 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 411


>gi|90818658|emb|CAJ32634.1| recombinase A [Ochrobactrum anthropi]
          Length = 355

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/340 (76%), Positives = 305/340 (89%), Gaps = 1/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG P
Sbjct: 10  EENSVDKTKALDAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRK
Sbjct: 129 QPDTGEQALEITDALVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 189 LTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 249 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+ +  L++
Sbjct: 309 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLMPEQFLED 348


>gi|116252383|ref|YP_768221.1| recombinase A [Rhizobium leguminosarum bv. viciae 3841]
 gi|122988509|sp|Q1MFZ8|RECA_RHIL3 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|115257031|emb|CAK08125.1| putative recombinase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 364

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/335 (77%), Positives = 305/335 (91%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG P+GRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-IETISTGSLGLDIALGVGGLPRGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ
Sbjct: 313 RENAKTFLRDNPDLAREIELSLRQNAGLIADRFLQ 347


>gi|209549552|ref|YP_002281469.1| recombinase A [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|226723636|sp|B5ZRG2|RECA_RHILW RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|209535308|gb|ACI55243.1| recA protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 362

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 265/349 (75%), Positives = 309/349 (88%), Gaps = 5/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG P+GRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-IETISTGSLGLDIALGVGGLPRGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ    N   D D  D
Sbjct: 313 RENAKTFLRDNPDLAREIELSLRQNAGLIADRFLQ----NGGPDPDDGD 357


>gi|256061282|ref|ZP_05451432.1| recombinase A [Brucella neotomae 5K33]
 gi|261325290|ref|ZP_05964487.1| recombinase A [Brucella neotomae 5K33]
 gi|261301270|gb|EEY04767.1| recombinase A [Brucella neotomae 5K33]
          Length = 348

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/345 (75%), Positives = 308/345 (89%), Gaps = 3/345 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRI
Sbjct: 1   MDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 60  VEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT S
Sbjct: 120 GEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQ
Sbjct: 180 ISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           REN+K +L++N E+A  IE+ LRQNAGL+A+  L +    T++DA
Sbjct: 300 RENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDDGG--TEEDA 342


>gi|1172888|sp|P24543|RECA_RHIET RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|683661|emb|CAA44346.1| RecA [Rhizobium phaseoli]
          Length = 361

 Score =  548 bits (1411), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 304/335 (90%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG PKGRI
Sbjct: 14  VDKSKALEAALSQIERSFGKGSIMKLGSNENVIE-IETISTGSLGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA+SQK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
            EN+K FLR+N ++A  IE  LR+NAGL+AD  LQ
Sbjct: 313 GENAKTFLRDNPDLAREIELALRENAGLIADRFLQ 347


>gi|254689422|ref|ZP_05152676.1| recombinase A [Brucella abortus bv. 6 str. 870]
 gi|254693907|ref|ZP_05155735.1| recombinase A [Brucella abortus bv. 3 str. Tulya]
 gi|254697557|ref|ZP_05159385.1| recombinase A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701942|ref|ZP_05163770.1| recombinase A [Brucella suis bv. 5 str. 513]
 gi|254704487|ref|ZP_05166315.1| recombinase A [Brucella suis bv. 3 str. 686]
 gi|254706617|ref|ZP_05168445.1| recombinase A [Brucella pinnipedialis M163/99/10]
 gi|254710273|ref|ZP_05172084.1| recombinase A [Brucella pinnipedialis B2/94]
 gi|254714270|ref|ZP_05176081.1| recombinase A [Brucella ceti M644/93/1]
 gi|254717707|ref|ZP_05179518.1| recombinase A [Brucella ceti M13/05/1]
 gi|254719260|ref|ZP_05181071.1| recombinase A [Brucella sp. 83/13]
 gi|254730451|ref|ZP_05189029.1| recombinase A [Brucella abortus bv. 4 str. 292]
 gi|256031767|ref|ZP_05445381.1| recombinase A [Brucella pinnipedialis M292/94/1]
 gi|256044852|ref|ZP_05447756.1| recombinase A [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113756|ref|ZP_05454560.1| recombinase A [Brucella melitensis bv. 3 str. Ether]
 gi|256159937|ref|ZP_05457655.1| recombinase A [Brucella ceti M490/95/1]
 gi|256255168|ref|ZP_05460704.1| recombinase A [Brucella ceti B1/94]
 gi|256257668|ref|ZP_05463204.1| recombinase A [Brucella abortus bv. 9 str. C68]
 gi|260168901|ref|ZP_05755712.1| recombinase A [Brucella sp. F5/99]
 gi|260883955|ref|ZP_05895569.1| recombinase A [Brucella abortus bv. 9 str. C68]
 gi|261222365|ref|ZP_05936646.1| recombinase A [Brucella ceti B1/94]
 gi|265988866|ref|ZP_06101423.1| recombinase A [Brucella pinnipedialis M292/94/1]
 gi|265991280|ref|ZP_06103837.1| recombinase A [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995117|ref|ZP_06107674.1| recombinase A [Brucella melitensis bv. 3 str. Ether]
 gi|265998330|ref|ZP_06110887.1| recombinase A [Brucella ceti M490/95/1]
 gi|294852537|ref|ZP_06793210.1| RecA protein [Brucella sp. NVSL 07-0026]
 gi|260873483|gb|EEX80552.1| recombinase A [Brucella abortus bv. 9 str. C68]
 gi|260920949|gb|EEX87602.1| recombinase A [Brucella ceti B1/94]
 gi|262552798|gb|EEZ08788.1| recombinase A [Brucella ceti M490/95/1]
 gi|262766230|gb|EEZ12019.1| recombinase A [Brucella melitensis bv. 3 str. Ether]
 gi|263002064|gb|EEZ14639.1| recombinase A [Brucella melitensis bv. 1 str. Rev.1]
 gi|264661063|gb|EEZ31324.1| recombinase A [Brucella pinnipedialis M292/94/1]
 gi|294821126|gb|EFG38125.1| RecA protein [Brucella sp. NVSL 07-0026]
 gi|326409222|gb|ADZ66287.1| RecA bacterial DNA recombination protein [Brucella melitensis M28]
 gi|326538931|gb|ADZ87146.1| recA protein [Brucella melitensis M5-90]
          Length = 348

 Score =  547 bits (1410), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 258/336 (76%), Positives = 303/336 (90%), Gaps = 1/336 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRI
Sbjct: 1   MDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 60  VEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT S
Sbjct: 120 GEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQ
Sbjct: 180 ISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           REN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 300 RENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 335


>gi|13470353|ref|NP_101919.1| recombinase A [Mesorhizobium loti MAFF303099]
 gi|20178054|sp|Q98NQ6|RECA_RHILO RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|14021092|dbj|BAB47705.1| recombination protein; RecA [Mesorhizobium loti MAFF303099]
          Length = 365

 Score =  545 bits (1403), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 259/349 (74%), Positives = 307/349 (87%), Gaps = 1/349 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKAL+AALSQI+R +GKG+IM+LG+   + E IE V +GSLGLDIALG+GG P+GRI
Sbjct: 14  VDKSKALDAALSQIERAFGKGSIMRLGANEQVVE-IETVPTGSLGLDIALGVGGLPRGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALHT+A++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALHTVAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEICDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD+D + GNQ
Sbjct: 193 ISRSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDRDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFK VEFDIMYGEG+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKVVEFDIMYGEGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K+FLR+N + A  IE  LRQNAGL+A+  L+       DD  +D+
Sbjct: 313 RENAKLFLRDNPDTAREIELALRQNAGLIAEKFLENGGSEGGDDGFEDE 361


>gi|319405870|emb|CBI79502.1| RecA protein [Bartonella sp. AR 15-3]
          Length = 347

 Score =  544 bits (1402), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 258/344 (75%), Positives = 308/344 (89%), Gaps = 1/344 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALE+ALSQI+R +GKG+IM+LG +  + E IE VS+GSL LDIALGIGG PKGRI
Sbjct: 1   MDKTKALESALSQIERSFGKGSIMRLGQKEQVVE-IETVSTGSLSLDIALGIGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH+IA++QK GG CAF+DAEHALD IYARKLGVDL+NL ISQPDT
Sbjct: 60  IEIYGPESSGKTTLALHSIAEAQKNGGICAFIDAEHALDPIYARKLGVDLENLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDSLPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D+I G+Q
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDTIIGSQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GEL+DLGVK  +V+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKLGELVDLGVKVGLVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           REN+K FLRE+ EIA  IE+ LRQNAGL+A  LL+   + + +D
Sbjct: 300 RENAKQFLREHTEIASEIETALRQNAGLIAIELLENSGLESTED 343


>gi|319784063|ref|YP_004143539.1| recA protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169951|gb|ADV13489.1| recA protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 365

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/350 (73%), Positives = 308/350 (88%), Gaps = 1/350 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKAL+AALSQI+R +GKG+IM+LG+   + E IE V +GSLGLDIALG+GG P+GRI
Sbjct: 14  VDKSKALDAALSQIERAFGKGSIMRLGANEQVVE-IETVPTGSLGLDIALGVGGLPRGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALHT+A++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALHTVAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEICDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD+D + GNQ
Sbjct: 193 ISRSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDRDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFK VEFDIMYGEG+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKVVEFDIMYGEGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDT 359
           REN+K+FLR+N + A  IE  LRQNAGL+A+  L+       DD  ++++
Sbjct: 313 RENAKLFLRDNPDTAREIELALRQNAGLIAEKFLENGGSEGGDDGFEEES 362


>gi|132236|sp|P24074|RECA_RHILV RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|581514|emb|CAA42578.1| RecA protein [Rhizobium leguminosarum]
          Length = 351

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 257/335 (76%), Positives = 304/335 (90%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG P+GRI
Sbjct: 1   MDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-IETISTGSLGLDIALGVGGLPRGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 60  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSG VD++V+DSVAALTPRAEIEG+MG+++PG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITDTLVRSGRVDVLVVDSVAALTPRAEIEGEMGDTVPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 180 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVIGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLR+N ++A  IE  LRQNAGL+AD  LQ
Sbjct: 300 RENAKTFLRDNPDLAREIELSLRQNAGLIADRFLQ 334


>gi|304391434|ref|ZP_07373376.1| protein RecA [Ahrensia sp. R2A130]
 gi|303295663|gb|EFL90021.1| protein RecA [Ahrensia sp. R2A130]
          Length = 368

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/348 (74%), Positives = 303/348 (87%), Gaps = 1/348 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALEAAL QI+R +GKG+IM+LG+     E IE +S+G +GLDIALG+GG PKGRI
Sbjct: 14  LDKSKALEAALGQIERAFGKGSIMRLGANEQAVE-IETISTGCIGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTT+ALHT+A++QK GG CAFVDAEHALD +YA+KLGV+L+NLLISQPDT
Sbjct: 73  VEIYGPESSGKTTMALHTVAEAQKEGGICAFVDAEHALDPVYAKKLGVNLENLLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA DI+VIDSVAALTPRAEIEG+MG SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGACDILVIDSVAALTPRAEIEGEMGASLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D I GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEIVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TR+KVVKNK+A PFKQVEFDIMYGEG+S  GELIDLGV A IV+KSG+WFS+  QRLGQG
Sbjct: 253 TRIKVVKNKLAPPFKQVEFDIMYGEGVSKMGELIDLGVTAGIVEKSGSWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           REN+K FLR+N E+AE IE  +R NAGL+ + LL EP    +D  D +
Sbjct: 313 RENAKQFLRDNPEVAETIEKAIRTNAGLIGEKLLDEPTGKDEDGTDPE 360


>gi|296448224|ref|ZP_06890120.1| recA protein [Methylosinus trichosporium OB3b]
 gi|296254264|gb|EFH01395.1| recA protein [Methylosinus trichosporium OB3b]
          Length = 358

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 256/334 (76%), Positives = 300/334 (89%), Gaps = 1/334 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDK+KAL+AALSQI+R +GKG+IM+LG      E IE +S+GSLGLDIALG+GG P+GR+
Sbjct: 14  VDKTKALDAALSQIERAFGKGSIMRLGKNQKAVE-IETISTGSLGLDIALGVGGLPRGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTL LH IA++QK GG CAFVDAEHALD +YARKLGV+L+ LLISQPDT
Sbjct: 73  VEIYGPESSGKTTLTLHVIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLEELLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MGE  PG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGEVQPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+GSIKD+D +TGNQ
Sbjct: 193 ISRSNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGSIKDRDEVTGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GEL+DLGVKA +VDKSGAWFSF  QRLGQG
Sbjct: 253 TRVKVVKNKVAPPFKQVEFDIMYGEGVSKVGELVDLGVKAGVVDKSGAWFSFDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           REN+K FL++N E AE IE+ +R+NAGL+A+ +L
Sbjct: 313 RENAKAFLKQNKEAAERIEAAIRENAGLIAERIL 346


>gi|260460848|ref|ZP_05809098.1| recA protein [Mesorhizobium opportunistum WSM2075]
 gi|259033425|gb|EEW34686.1| recA protein [Mesorhizobium opportunistum WSM2075]
          Length = 353

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 255/335 (76%), Positives = 302/335 (90%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL+AALSQI+R +GKG+IM+LG+   + E IE V +GSLGLDIALG+GG P+GRI
Sbjct: 1   MDKSKALDAALSQIERAFGKGSIMRLGANEQVVE-IETVPTGSLGLDIALGVGGLPRGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALHT+A++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 60  IEIYGPESSGKTTLALHTVAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEICDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD+D + GNQ
Sbjct: 180 ISRSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDRDEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFK VEFDIMYGEG+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKVVEFDIMYGEGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K+FLR+N + A  IE  LRQNAGL+A+  L+
Sbjct: 300 RENAKLFLRDNPDTAREIELALRQNAGLIAEKFLE 334


>gi|240850807|ref|YP_002972207.1| recombinase A [Bartonella grahamii as4aup]
 gi|240267930|gb|ACS51518.1| recombinase A [Bartonella grahamii as4aup]
          Length = 347

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/335 (77%), Positives = 302/335 (90%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG +  + E IE V +GSL LDIALGIGG PKGRI
Sbjct: 1   MDKTKALDAALSQIERSFGKGSIMRLGQKEQVVE-IETVPTGSLSLDIALGIGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GG CAF+DAEHALD IYARKLGVDL+NL ISQPDT
Sbjct: 60  VEIYGPESSGKTTLALHAIAEAQKGGGICAFIDAEHALDPIYARKLGVDLENLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG++LPG+QARLMS+ALRKLT++
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDALPGLQARLMSKALRKLTAA 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C++VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKD+D+I GNQ
Sbjct: 180 IFRSNCMVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDAIVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK  IV+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKVGELIDLGVKVGIVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLRE+ EIA  IES LRQNAGL+A  LL+
Sbjct: 300 RENAKQFLREHAEIATEIESALRQNAGLIAIELLE 334


>gi|307945635|ref|ZP_07660971.1| protein RecA [Roseibium sp. TrichSKD4]
 gi|307771508|gb|EFO30733.1| protein RecA [Roseibium sp. TrichSKD4]
          Length = 355

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 260/349 (74%), Positives = 312/349 (89%), Gaps = 3/349 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E + +DK+KAL+AALSQI+R +GKG+IM++G QG   E ++ VS+GSLGLDIALGIGG P
Sbjct: 10  ESSQMDKTKALDAALSQIERAFGKGSIMRMG-QGQAVE-VQSVSTGSLGLDIALGIGGLP 67

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHT+A++QKTGG CAFVDAEHALD IYARKLGV++ +LLIS
Sbjct: 68  KGRIVEIYGPESSGKTTLALHTVAEAQKTGGICAFVDAEHALDPIYARKLGVNIDDLLIS 127

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPD GEQALEI D LVRSGA+D++VIDSVAALTP+AE+EG+MG+SLPGMQARLMSQALRK
Sbjct: 128 QPDAGEQALEIADTLVRSGAIDVLVIDSVAALTPKAELEGEMGDSLPGMQARLMSQALRK 187

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SIS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D +
Sbjct: 188 LTASISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEV 247

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PF+QVEFDI+YGEG+S  GELIDLGVK  IV+KSGAWFS+  QR
Sbjct: 248 VGNQTRVKVVKNKLAPPFRQVEFDIIYGEGVSKMGELIDLGVKGGIVEKSGAWFSYNSQR 307

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           LGQGREN+K FLR+N EIAE IE  +RQNAGL+A++++ +P     DD+
Sbjct: 308 LGQGRENAKQFLRDNPEIAEEIELAVRQNAGLIAEAII-DPTGGEDDDS 355


>gi|49474376|ref|YP_032418.1| recombinase A [Bartonella quintana str. Toulouse]
 gi|59798256|sp|Q6FZF0|RECA_BARQU RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|49239880|emb|CAF26278.1| recA protein [Bartonella quintana str. Toulouse]
          Length = 347

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 258/335 (77%), Positives = 301/335 (89%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG +  + E IE + +GSL LDIALG+GG PKGRI
Sbjct: 1   MDKTKALDAALSQIERSFGKGSIMRLGQKEQVVE-IETIPTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GG CAF+DAEHALD IYARKLGVDL+NL ISQPDT
Sbjct: 60  VEIYGPESSGKTTLALHAIAEAQKNGGVCAFIDAEHALDPIYARKLGVDLENLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG++LPG+QARLMS+ALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDALPGLQARLMSKALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRRVGSIKD+D I GNQ
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGSIKDRDMIVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK  IV+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGIVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLRE+ EIA  IE+ LRQNAGL+A  LL+
Sbjct: 300 RENAKQFLREHAEIATEIETALRQNAGLIAIELLE 334


>gi|118588632|ref|ZP_01546040.1| recombinase A [Stappia aggregata IAM 12614]
 gi|118438618|gb|EAV45251.1| recombinase A [Stappia aggregata IAM 12614]
          Length = 344

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 255/346 (73%), Positives = 314/346 (90%), Gaps = 3/346 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM++G QG + E ++ VS+GSLGLDIALGIGG P+GRI
Sbjct: 1   MDKTKALDAALSQIERAFGKGSIMKMG-QGQVVE-VQAVSTGSLGLDIALGIGGLPRGRI 58

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH ++++QKTGG CAF+DAEHALD IYARKLGVD+ NLLISQPD 
Sbjct: 59  VEIYGPESSGKTTLALHAVSEAQKTGGICAFIDAEHALDPIYARKLGVDIDNLLISQPDA 118

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++VIDSVAALTP+AE+EG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 119 GEQALEIADTLVRSGAIDVLVIDSVAALTPKAELEGEMGDSLPGMQARLMSQALRKLTAS 178

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D + GNQ
Sbjct: 179 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEVVGNQ 238

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PF+QVEFDI+YGEG+S  GELIDLGVK +IV+KSGAWFS+  QRLGQG
Sbjct: 239 TRVKVVKNKLAPPFRQVEFDIVYGEGVSKTGELIDLGVKGNIVEKSGAWFSYNSQRLGQG 298

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           REN+K FL++N EIA+ IE  +RQNAGL+A++++ +P    +++A+
Sbjct: 299 RENAKQFLKDNPEIADEIELAIRQNAGLIAEAII-DPDAGVEEEAE 343


>gi|319407396|emb|CBI81047.1| RecA protein [Bartonella sp. 1-1C]
          Length = 347

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/343 (74%), Positives = 306/343 (89%), Gaps = 1/343 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALEAALSQI+R +GKG+IM+LG +  + E IE VS+GSL LDIALG+GG PKGRI
Sbjct: 1   MDKTKALEAALSQIERSFGKGSIMRLGQKEQVVE-IETVSTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH+IA++QK GG CAFVDAEHALD IYARKLGVDL+NL ISQPDT
Sbjct: 60  IEIYGPESSGKTTLALHSIAEAQKNGGVCAFVDAEHALDPIYARKLGVDLENLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDSLPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D+I G+Q
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDTIIGSQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVK+VKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK  +V+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKIVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGLVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKD 352
           REN+K FL E+ EIA  IE+ LRQNAGL+A  LL+   + + +
Sbjct: 300 RENAKQFLCEHTEIAAEIETALRQNAGLIAIELLENSGVESTE 342


>gi|319404396|emb|CBI77999.1| RecA protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 347

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/343 (74%), Positives = 305/343 (88%), Gaps = 1/343 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALEAALSQI+R +GKG+IM+LG +  + E IE VS+GSL LDIALG+GG PKGRI
Sbjct: 1   MDKTKALEAALSQIERSFGKGSIMRLGQKEQVVE-IETVSTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH+IA++QK GG CAFVDAEHALD IYARKLGVDL NL ISQPDT
Sbjct: 60  IEIYGPESSGKTTLALHSIAEAQKNGGVCAFVDAEHALDPIYARKLGVDLANLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDSLPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D+I G+Q
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDTIIGSQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVK+VKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK  +V+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKIVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGLVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKD 352
           REN+K FL E+ EIA  IE+ LRQNAGL+A  LL+   + + +
Sbjct: 300 RENAKQFLCEHTEIAAEIETALRQNAGLIAIELLENSGVESTE 342


>gi|319899071|ref|YP_004159164.1| RecA protein [Bartonella clarridgeiae 73]
 gi|319403035|emb|CBI76590.1| RecA protein [Bartonella clarridgeiae 73]
          Length = 347

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 258/350 (73%), Positives = 310/350 (88%), Gaps = 4/350 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALEAALSQI+R +GKG+IM+LG +  + E IE VS+GSL LDIALG+GG PKGRI
Sbjct: 1   MDKTKALEAALSQIERSFGKGSIMRLGQKEQVVE-IETVSTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH+IA++QK GG CAF+DAEHALD IYARKLGVDL+NL ISQPDT
Sbjct: 60  IEIYGPESSGKTTLALHSIAEAQKNGGICAFIDAEHALDPIYARKLGVDLENLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG++LPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDALPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D++ G+Q
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDTVIGSQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK  +V+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGLVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDT 359
           REN+K FLRE  EIA  IE+ LRQNAGL+A  LL+       ++A+ D++
Sbjct: 300 RENAKQFLREYAEIAAEIETALRQNAGLIAIELLENAG---SENAEGDES 346


>gi|163868622|ref|YP_001609831.1| recombinase A [Bartonella tribocorum CIP 105476]
 gi|189039590|sp|A9IVY9|RECA_BART1 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|161018278|emb|CAK01836.1| RecA protein [Bartonella tribocorum CIP 105476]
          Length = 347

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 262/345 (75%), Positives = 306/345 (88%), Gaps = 2/345 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG +  + E IE V +GSL LDIALGIGG PKGRI
Sbjct: 1   MDKTKALDAALSQIERSFGKGSIMRLGQKEQVVE-IETVPTGSLSLDIALGIGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GG CAF+DAEHALD IYARKLGVDL+NL ISQPDT
Sbjct: 60  VEIYGPESSGKTTLALHAIAEAQKGGGICAFIDAEHALDPIYARKLGVDLENLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG++LPG+QARLMS+ALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDALPGLQARLMSKALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKD+D I GNQ
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDMIVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK  IV+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGIVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP-AINTKDD 353
           REN+K FLRE+ EIA  IE+ LRQNAGL+A  LL+   + NT+ D
Sbjct: 300 RENAKQFLREHAEIAAEIETALRQNAGLIAIELLENAGSENTEGD 344


>gi|207366352|emb|CAQ58071.1| recombinase A [Agrobacterium tumefaciens]
          Length = 322

 Score =  538 bits (1385), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/323 (79%), Positives = 295/323 (91%), Gaps = 1/323 (0%)

Query: 14  KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73
           KALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI+EIY
Sbjct: 1   KALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRIIEIY 59

Query: 74  GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133
           GPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDTGEQA
Sbjct: 60  GPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDTGEQA 119

Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193
           LEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS+S
Sbjct: 120 LEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISKS 179

Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253
           KC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQTRVK
Sbjct: 180 KCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTRVK 239

Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313
           VVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQGREN+
Sbjct: 240 VVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRENA 299

Query: 314 KIFLRENIEIAENIESLLRQNAG 336
           KIFLR+N E A  IE  LRQNAG
Sbjct: 300 KIFLRDNPETANEIELALRQNAG 322


>gi|158424479|ref|YP_001525771.1| recombinase A [Azorhizobium caulinodans ORS 571]
 gi|158331368|dbj|BAF88853.1| RecA protein [Azorhizobium caulinodans ORS 571]
          Length = 363

 Score =  538 bits (1385), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 255/348 (73%), Positives = 307/348 (88%), Gaps = 5/348 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG  G + E +E +SSGSLGLDIALGIGG PKGRI
Sbjct: 14  MDKTKALDAALSQIERHFGKGSIMRLGKSGKVME-VESISSGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHTIA++QK GGTCAF+DAEHALD IYARKLGV+L +LLISQPD 
Sbjct: 73  VEIYGPESSGKTTLALHTIAEAQKKGGTCAFIDAEHALDPIYARKLGVNLDDLLISQPDA 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAALTPRAE++G+MG++ PGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAIDVLVVDSVAALTPRAELDGEMGDNQPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGMIKERDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GEL+DLGV+A +V+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGELLDLGVRAGVVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           REN+K FLR+N E+A  IE+ +RQNAGL+AD +L      + +D D D
Sbjct: 313 RENAKTFLRQNPEVAGRIEATIRQNAGLIADQIL----TGSPEDEDGD 356


>gi|298292139|ref|YP_003694078.1| recA protein [Starkeya novella DSM 506]
 gi|296928650|gb|ADH89459.1| recA protein [Starkeya novella DSM 506]
          Length = 360

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 258/348 (74%), Positives = 307/348 (88%), Gaps = 2/348 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG    I E IE VS+GSLGLDIALGIGG P+GRI
Sbjct: 14  MDKAKALDAALSQIERHFGKGSIMRLGKNDKIME-IETVSTGSLGLDIALGIGGLPRGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEI+GPESSGKTTLALHTIA+SQK GG CAF+DAEHALD IYARKLGVDL NLLISQPD 
Sbjct: 73  VEIFGPESSGKTTLALHTIAESQKKGGVCAFIDAEHALDPIYARKLGVDLDNLLISQPDA 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAALTPRAE++G+MG++ PGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAVDVLVVDSVAALTPRAELDGEMGDNQPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I+RS+ +++FINQ+RMKIGVM+GSPETTTGGNALKFYSSVRLDIRR+G+IK++D + GNQ
Sbjct: 193 INRSQTMVIFINQIRMKIGVMYGSPETTTGGNALKFYSSVRLDIRRIGAIKERDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GELIDLG+KA +V+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGELIDLGIKAGVVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           REN+K FLR+N ++A  IE+ +RQNAGL+A+ +L   A    DD D +
Sbjct: 313 RENAKNFLRQNPDVAGRIEATIRQNAGLIAEQILAGEA-GEDDDGDAE 359


>gi|121602844|ref|YP_989026.1| recombinase A [Bartonella bacilliformis KC583]
 gi|166199600|sp|A1USS3|RECA_BARBK RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|120615021|gb|ABM45622.1| protein RecA [Bartonella bacilliformis KC583]
          Length = 347

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 257/335 (76%), Positives = 300/335 (89%), Gaps = 1/335 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KAL+AALSQI+R +GKG+IM+LG +  + E IE +S+GSL LDIALG+GG PKGRI
Sbjct: 1   MDKKKALDAALSQIERSFGKGSIMRLGQKEGVVE-IETISTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH IA++QK GG CAFVDAEHALD IYARKLGVDL+NL +SQPDT
Sbjct: 60  IEIYGPESSGKTTLALHAIAEAQKNGGVCAFVDAEHALDPIYARKLGVDLENLFVSQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+M +SLPG+QARLMS+ALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMSDSLPGLQARLMSKALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKDK+ + GNQ
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDKELVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK  IV+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGIVEKSGAWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ 344
           REN+K FLRE+ EIA  IE+ LRQNAGL+A  LL+
Sbjct: 300 RENAKQFLREHAEIAAEIETALRQNAGLLAIELLE 334


>gi|207366314|emb|CAQ58052.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366316|emb|CAQ58053.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  536 bits (1382), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 256/319 (80%), Positives = 293/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 62  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVDI+V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDILVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N E A  IE
Sbjct: 302 RENAKTFLRDNPETANEIE 320


>gi|207366250|emb|CAQ58020.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366252|emb|CAQ58021.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366254|emb|CAQ58022.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366256|emb|CAQ58023.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366258|emb|CAQ58024.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366260|emb|CAQ58025.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366262|emb|CAQ58026.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366264|emb|CAQ58027.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366266|emb|CAQ58028.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366268|emb|CAQ58029.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366270|emb|CAQ58030.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366272|emb|CAQ58031.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366274|emb|CAQ58032.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366276|emb|CAQ58033.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  536 bits (1382), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 255/319 (79%), Positives = 294/319 (92%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E +S+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETISTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 62  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVDI+V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDILVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N E+A  IE
Sbjct: 302 RENAKTFLRDNPEMASEIE 320


>gi|328543179|ref|YP_004303288.1| recombinase A [Polymorphum gilvum SL003B-26A1]
 gi|326412925|gb|ADZ69988.1| recombinase A [Polymorphum gilvum SL003B-26A1]
          Length = 344

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 256/349 (73%), Positives = 310/349 (88%), Gaps = 5/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG QG   E ++ VS+GSLGLDIALG+GG P+GRI
Sbjct: 1   MDKTKALDAALSQIERAFGKGSIMRLG-QGQAVE-VQTVSTGSLGLDIALGVGGLPRGRI 58

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHTIA++QK GG CAF+DAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 59  VEIYGPESSGKTTLALHTIAEAQKLGGICAFIDAEHALDPVYARKLGVNIDDLLISQPDA 118

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA++++VIDSVAALTP+AE+EG+MG+SLPGMQARLMSQALRKLT+S
Sbjct: 119 GEQALEIADTLVRSGAIEVLVIDSVAALTPKAELEGEMGDSLPGMQARLMSQALRKLTAS 178

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKD+D + GNQ
Sbjct: 179 ISKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDEVIGNQ 238

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PF+QVEFD++YGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 239 TRVKVVKNKLAPPFRQVEFDVIYGEGVSKMGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 298

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FLREN EIA  IE  +RQNAGL++D+++    +   D+A  DD
Sbjct: 299 RENAKQFLRENPEIAAEIELAIRQNAGLLSDAIIDPDGV---DEAGLDD 344


>gi|49475766|ref|YP_033807.1| recombinase A [Bartonella henselae str. Houston-1]
 gi|59798263|sp|Q6G2Z3|RECA_BARHE RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|49238573|emb|CAF27814.1| recA protein [Bartonella henselae str. Houston-1]
          Length = 347

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/345 (75%), Positives = 304/345 (88%), Gaps = 2/345 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KAL+AALSQI+R +GKG+IM+LG +  + E IE + +GSL LDIALG+GG PKGRI
Sbjct: 1   MDKIKALDAALSQIERSFGKGSIMRLGQKEQVVE-IETIPTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GG CAF+DAEHALD IYARKLGVDL+NL ISQPDT
Sbjct: 60  VEIYGPESSGKTTLALHAIAEAQKNGGVCAFIDAEHALDPIYARKLGVDLENLFISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEIT+ LVRSGAVD++V+DSVAALTPRAEI+G+MG++LPG+QARLMS+ALRKLT+S
Sbjct: 120 GEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDALPGLQARLMSKALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKD+D I GNQ
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDMIVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVK   V+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLGVKVGTVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP-AINTKDD 353
           REN+K FLRE+ EIA  IE+ LRQNAGL+A  LL+   + NT+ D
Sbjct: 300 RENAKQFLREHPEIATEIETALRQNAGLIAIELLENAGSENTESD 344


>gi|207366322|emb|CAQ58056.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366326|emb|CAQ58058.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366356|emb|CAQ58073.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366358|emb|CAQ58074.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 255/319 (79%), Positives = 293/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+KIFLR+N E A  IE
Sbjct: 302 RENAKIFLRDNPETANEIE 320


>gi|217979628|ref|YP_002363775.1| recA protein [Methylocella silvestris BL2]
 gi|217505004|gb|ACK52413.1| recA protein [Methylocella silvestris BL2]
          Length = 355

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 253/334 (75%), Positives = 300/334 (89%), Gaps = 1/334 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSLGLD+ALG+GG P+GR+
Sbjct: 14  VDKTKALDAALSQIERAFGKGSIMRLGKNQKVVE-IETVPTGSLGLDVALGVGGLPRGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTL LH IA++QK GG CAF+DAEHALD+IYARKLGV+L++LL+SQPDT
Sbjct: 73  VEIYGPESSGKTTLTLHVIAEAQKKGGVCAFIDAEHALDTIYARKLGVNLEDLLVSQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++VIDSVAALTPRAEIEG+MG+S PG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVIDSVAALTPRAEIEGEMGDSQPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+GSIKD + + GNQ
Sbjct: 193 ISRSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGSIKDHEEVIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GELIDLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKVAPPFKQVEFDIMYGEGISKIGELIDLGVKAGVVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           RENSK FL+ + EIA+ IE  +R+NAG++AD +L
Sbjct: 313 RENSKAFLKAHPEIADKIELAIRENAGMIADKIL 346


>gi|182679357|ref|YP_001833503.1| recA protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635240|gb|ACB96014.1| recA protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 343

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 254/345 (73%), Positives = 307/345 (88%), Gaps = 2/345 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG      E IE +S+GSLGLDIALG+GG P+GR+
Sbjct: 1   MDKTKALDAALSQIERAFGKGSIMRLGKSQKAIE-IETISTGSLGLDIALGVGGLPRGRV 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTL LH IA++QK GG CAF+DAEHALD +YARKLGV+L +LLISQPDT
Sbjct: 60  IEIYGPESSGKTTLTLHVIAEAQKKGGVCAFIDAEHALDPVYARKLGVNLDDLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++VIDSVAALTPRAEIEG+MG++ PG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITDTLVRSGAVDVLVIDSVAALTPRAEIEGEMGDNQPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS+ +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+GSIKD++ ITGNQ
Sbjct: 180 ISRSQTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGSIKDREDITGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 240 TRVKVVKNKVAPPFKQVEFDIMYGEGVSKVGELVDLGVKAGVVEKSGAWFSYDSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           REN+K FL+ N E+A+ IE  +R+N+GL+AD +L + A   +DDA
Sbjct: 300 RENAKTFLKNNPEVADKIEMTIRENSGLIADRILDQ-AEPEEDDA 343


>gi|207366324|emb|CAQ58057.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366354|emb|CAQ58072.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366360|emb|CAQ58075.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  534 bits (1376), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 254/319 (79%), Positives = 293/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+KIFLR+N E A  IE
Sbjct: 302 RENAKIFLRDNPETANEIE 320


>gi|207366288|emb|CAQ58039.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366290|emb|CAQ58040.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  534 bits (1376), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 254/319 (79%), Positives = 293/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL++LLISQPDT
Sbjct: 62  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQSLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N E A  IE
Sbjct: 302 RENAKTFLRDNPETANEIE 320


>gi|144123|gb|AAA22999.1| RecA protein [Brucella abortus]
          Length = 360

 Score =  534 bits (1375), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 256/340 (75%), Positives = 301/340 (88%), Gaps = 2/340 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N VDK+KAL+AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG P
Sbjct: 10  EDNSVDKTKALDAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGV L+NLLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVHLENLLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QP TGEQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+S  G+QARLMSQA+RK
Sbjct: 129 QPITGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDS-HGLQARLMSQAVRK 187

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D +
Sbjct: 188 LTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEV 247

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QR
Sbjct: 248 VGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQR 307

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           LGQGREN+K +L++N E+A  IE+ LRQNAGL+A+  L +
Sbjct: 308 LGQGRENAKQYLKDNPEVAREIETTLRQNAGLIAEQFLDD 347


>gi|207366292|emb|CAQ58041.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366294|emb|CAQ58042.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366296|emb|CAQ58043.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366298|emb|CAQ58044.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366300|emb|CAQ58045.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366302|emb|CAQ58046.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366304|emb|CAQ58047.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366306|emb|CAQ58048.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366308|emb|CAQ58049.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366310|emb|CAQ58050.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366312|emb|CAQ58051.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366348|emb|CAQ58069.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 254/319 (79%), Positives = 292/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDT
Sbjct: 62  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N E A  IE
Sbjct: 302 RENAKTFLRDNPETANEIE 320


>gi|218325541|emb|CAV24649.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 254/319 (79%), Positives = 292/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VD SKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDXSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+KIFLR+N E A  IE
Sbjct: 302 RENAKIFLRDNPETANEIE 320


>gi|207366346|emb|CAQ58068.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 253/319 (79%), Positives = 292/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N E A  IE
Sbjct: 302 RENAKTFLRDNPETANEIE 320


>gi|207366280|emb|CAQ58035.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366286|emb|CAQ58038.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 253/322 (78%), Positives = 294/322 (91%), Gaps = 1/322 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL++LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQSLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIESLL 331
           REN+K FLR+N + A  IE  L
Sbjct: 302 RENAKTFLRDNPDTANEIEPAL 323


>gi|207366328|emb|CAQ58059.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366330|emb|CAQ58060.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366332|emb|CAQ58061.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366334|emb|CAQ58062.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366336|emb|CAQ58063.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366338|emb|CAQ58064.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366340|emb|CAQ58065.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 253/319 (79%), Positives = 293/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL++LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQSLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++VIDSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVIDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N + A  IE
Sbjct: 302 RENAKTFLRDNPDTANEIE 320


>gi|283481769|emb|CBA10139.1| recombinase A [Agrobacterium larrymoorei]
          Length = 323

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 255/324 (78%), Positives = 294/324 (90%), Gaps = 1/324 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           N VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKG
Sbjct: 1   NSVDKSKALEAALSQIERSFGKGSIMKLGSNENVIE-VETVSTGSLSLDIALGIGGLPKG 59

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RI+EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQP
Sbjct: 60  RIIEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQP 119

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           DTGEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT
Sbjct: 120 DTGEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLT 179

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
           +SIS+SK +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + G
Sbjct: 180 ASISKSKTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVG 239

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           NQTRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLG
Sbjct: 240 NQTRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLG 299

Query: 308 QGRENSKIFLRENIEIAENIESLL 331
           QGREN+K FLR+N  +A  IE  L
Sbjct: 300 QGRENAKGFLRDNPAVANEIEMAL 323


>gi|207366278|emb|CAQ58034.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366342|emb|CAQ58066.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366344|emb|CAQ58067.1| recombinase A [Agrobacterium tumefaciens]
 gi|255287394|emb|CAQ58036.2| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 252/319 (78%), Positives = 293/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL++LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQSLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N + A  IE
Sbjct: 302 RENAKTFLRDNPDTANEIE 320


>gi|255287396|emb|CAQ58037.2| recombinase A [Agrobacterium tumefaciens]
          Length = 320

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 252/319 (78%), Positives = 293/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL++LLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQSLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N + A  IE
Sbjct: 302 RENAKTFLRDNPDTANEIE 320


>gi|207366318|emb|CAQ58054.1| recombinase A [Agrobacterium tumefaciens]
 gi|207366320|emb|CAQ58055.1| recombinase A [Agrobacterium tumefaciens]
          Length = 323

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 253/319 (79%), Positives = 292/319 (91%), Gaps = 1/319 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDT
Sbjct: 62  VEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQ
Sbjct: 182 ISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIE 328
           REN+K FLR+N + A  IE
Sbjct: 302 RENAKTFLRDNPDTANEIE 320


>gi|319408737|emb|CBI82394.1| RecA protein [Bartonella schoenbuchensis R1]
          Length = 347

 Score =  531 bits (1368), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 255/345 (73%), Positives = 305/345 (88%), Gaps = 2/345 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL++ALSQI+R +GKG+IM+LG +  + E IE + +GSL LDIALG+GG PKGRI
Sbjct: 1   MDKTKALDSALSQIERSFGKGSIMRLGQKEQVVE-IETIPTGSLSLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH IA++QK+GG CAFVDAEHALD IYARKLGV L++LLISQPDT
Sbjct: 60  IEIYGPESSGKTTLALHAIAEAQKSGGVCAFVDAEHALDPIYARKLGVKLEDLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI + LVRSGA+D++V+DSVAALTPRAEI+G+M +S+PG+QARLMS+ALRKLT+S
Sbjct: 120 GEQALEIAETLVRSGAIDVLVVDSVAALTPRAEIDGEMNDSVPGLQARLMSKALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRRVG+IKD+D + GNQ
Sbjct: 180 IFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGAIKDRDMVIGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVKA IV+KSG+WFS+  QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIIYGEGISKVGELIDLGVKAGIVEKSGSWFSYNSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAI-NTKDD 353
           REN+K FL EN EIA  IES LRQNAGL+A  LL+   + NT+ +
Sbjct: 300 RENAKQFLHENAEIATEIESALRQNAGLLAIELLENAGLENTESE 344


>gi|254692312|emb|CBA10404.1| recombinase A [Agrobacterium larrymoorei]
          Length = 323

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 254/322 (78%), Positives = 293/322 (90%), Gaps = 1/322 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI
Sbjct: 3   VDKSKALEAALSQIERSFGKGSIMKLGSNENVIE-VETVSTGSLSLDIALGIGGLPKGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 62  IEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SK +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 182 ISKSKTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 242 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQG 301

Query: 310 RENSKIFLRENIEIAENIESLL 331
           REN+K FLR+N  +A  IE  L
Sbjct: 302 RENAKGFLRDNPAVANEIEMAL 323


>gi|323137974|ref|ZP_08073048.1| recA protein [Methylocystis sp. ATCC 49242]
 gi|322396693|gb|EFX99220.1| recA protein [Methylocystis sp. ATCC 49242]
          Length = 356

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 256/352 (72%), Positives = 302/352 (85%), Gaps = 9/352 (2%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDK+KAL+AALSQI+R +GKG+IM+LG      E IE +S+GSLGLDIALG+GG P+GR+
Sbjct: 14  VDKTKALDAALSQIERAFGKGSIMRLGKNQKAVE-IETISTGSLGLDIALGVGGLPRGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTL LH IA++QK GG CAFVDAEHALD +YARKLGV+L+ LLISQPDT
Sbjct: 73  VEIYGPESSGKTTLTLHVIAEAQKMGGVCAFVDAEHALDPVYARKLGVNLEELLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+  PG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDVQPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I+RS  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR GSIKD+D   GNQ
Sbjct: 193 IARSNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSIKDRDEAIGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GELIDLGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKVAPPFKQVEFDIMYGEGVSKVGELIDLGVKAGVVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDN 361
           REN+K FLR+N E A  IE  +R+NAGL+A+ +L        D AD D+ ++
Sbjct: 313 RENAKNFLRQNPEAAARIEQAIRENAGLIAERIL--------DVADGDEAED 356


>gi|254470359|ref|ZP_05083763.1| protein RecA [Pseudovibrio sp. JE062]
 gi|211960670|gb|EEA95866.1| protein RecA [Pseudovibrio sp. JE062]
          Length = 354

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 254/337 (75%), Positives = 301/337 (89%), Gaps = 2/337 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N +DK+KAL+AALSQI+R +GKG+IM++G QG   E I+ VS+GSL LDI LGIGG P
Sbjct: 10  EGNQMDKNKALDAALSQIERAFGKGSIMRMG-QGQAVE-IQSVSTGSLSLDIGLGIGGLP 67

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRI+EIYGPESSGKTTLALHT+A +Q+ GG CAFVDAEHALD +YARKLGV++ +LLIS
Sbjct: 68  KGRIIEIYGPESSGKTTLALHTVASAQREGGICAFVDAEHALDPVYARKLGVNIDDLLIS 127

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPD GEQALEI D LVRSGA+D++VIDSVAALTP+AE+EG+MG+SLPG+QARLMSQALRK
Sbjct: 128 QPDAGEQALEIADTLVRSGAIDVLVIDSVAALTPKAELEGEMGDSLPGLQARLMSQALRK 187

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT+SIS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D I
Sbjct: 188 LTASISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEI 247

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PFKQVEFDI+YGEGIS  GEL+DLGVK  IV+KSGAWFS+  QR
Sbjct: 248 VGNQTRVKVVKNKLAPPFKQVEFDIIYGEGISKMGELLDLGVKGGIVEKSGAWFSYNSQR 307

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSL 342
           LGQGRENSK FLREN E+AE IE  +RQNAGL+A+++
Sbjct: 308 LGQGRENSKTFLRENPELAEEIELAIRQNAGLIAEAI 344


>gi|283481767|emb|CBA10138.1| recombinase A [Agrobacterium tumefaciens]
          Length = 317

 Score =  527 bits (1358), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 251/316 (79%), Positives = 289/316 (91%), Gaps = 1/316 (0%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRIVEI
Sbjct: 1   SKALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRIVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDTGEQ
Sbjct: 60  YGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS+
Sbjct: 120 ALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISK 179

Query: 193 SKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRV 252
           SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQTRV
Sbjct: 180 SKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQTRV 239

Query: 253 KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGREN 312
           KVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQGREN
Sbjct: 240 KVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGREN 299

Query: 313 SKIFLRENIEIAENIE 328
           +K FLR+N E A  IE
Sbjct: 300 AKTFLRDNPETANEIE 315


>gi|154248001|ref|YP_001418959.1| recombinase A [Xanthobacter autotrophicus Py2]
 gi|154162086|gb|ABS69302.1| recA protein [Xanthobacter autotrophicus Py2]
          Length = 361

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 250/334 (74%), Positives = 299/334 (89%), Gaps = 1/334 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM+LG  G   E IE V +GSLGLDIA+GIGG PKGR+
Sbjct: 14  MDKTKALDAALSQIERHFGKGSIMRLGKGGKALE-IESVPTGSLGLDIAIGIGGLPKGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEI+GPESSGKTTLALHT+A++QK GGTCAF+DAEHALD IYARKLGV+L +LLISQPD 
Sbjct: 73  VEIFGPESSGKTTLALHTVAEAQKRGGTCAFIDAEHALDPIYARKLGVNLDDLLISQPDA 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAALTPRAE++G+MG+S PGMQARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAIDVLVVDSVAALTPRAELDGEMGDSQPGMQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 193 ISKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGMIKERDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSGAWFS   QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVEKSGAWFSHDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           REN+K FL++N EIA  IE+ +RQNAGL+A+ +L
Sbjct: 313 RENAKTFLKQNQEIAGRIEAAIRQNAGLIAEKIL 346


>gi|288958054|ref|YP_003448395.1| recombination protein [Azospirillum sp. B510]
 gi|288910362|dbj|BAI71851.1| recombination protein [Azospirillum sp. B510]
          Length = 359

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 248/341 (72%), Positives = 301/341 (88%), Gaps = 1/341 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E + +DK KAL+AALSQI+R +GKG+IM+LG++ ++ E  EVVS+GSLGLDIALGIGG P
Sbjct: 10  EKDSMDKQKALDAALSQIERAFGKGSIMKLGARENLVE-TEVVSTGSLGLDIALGIGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           +GRIVEIYGPESSGKTTLALH IAQ+QK GGTCAFVDAEHALD  YARKLGV++  LLIS
Sbjct: 69  RGRIVEIYGPESSGKTTLALHAIAQAQKNGGTCAFVDAEHALDPSYARKLGVNIDELLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPD GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG+S  G+ ARLMSQALRK
Sbjct: 129 QPDAGEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDSHVGLHARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SI++S C+++FINQ+R+KIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIKD+D++
Sbjct: 189 LTGSIAKSNCLVIFINQIRLKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKDRDTV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNKMA PF+ VEFDIMYGEG+S  GEL+DLG++A +VDKSGAWFS+ G R
Sbjct: 249 VGNQTRVKVVKNKMAPPFRVVEFDIMYGEGVSKVGELLDLGIQAGVVDKSGAWFSYDGTR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           +GQGREN+K FLR N E+A+ IE+ +R NAGLVAD+++  P
Sbjct: 309 IGQGRENAKTFLRNNPEMADAIEAKIRGNAGLVADAMMGTP 349


>gi|83858788|ref|ZP_00952310.1| recombinase A [Oceanicaulis alexandrii HTCC2633]
 gi|83853611|gb|EAP91463.1| recombinase A [Oceanicaulis alexandrii HTCC2633]
          Length = 360

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 250/349 (71%), Positives = 307/349 (87%), Gaps = 6/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KALEAAL+QI R +GKG++M+LG++    + I+ +S+GSLGLDIALG+GG PKGRI
Sbjct: 14  MDKQKALEAALTQIDRAFGKGSVMKLGAKPD--QDIQAISTGSLGLDIALGVGGLPKGRI 71

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHT+A+ QK+GGT AFVDAEHALD +YARKLGVD+  LL+SQPD 
Sbjct: 72  VEIYGPESSGKTTLALHTVAECQKSGGTAAFVDAEHALDPVYARKLGVDVSELLVSQPDA 131

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++VIDSVAALTPRAE+EGDMG+SLPG+QARLMSQALRKLT+S
Sbjct: 132 GEQALEIADTLVRSGAIDVLVIDSVAALTPRAELEGDMGDSLPGLQARLMSQALRKLTAS 191

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IK++D + GNQ
Sbjct: 192 ISKSKCLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKNRDEVIGNQ 251

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PF++VEFDI+YGEGIS  GEL+DLGVK +I++KSG+W+S   +R+GQG
Sbjct: 252 TRVKVVKNKVAPPFREVEFDILYGEGISKTGELLDLGVKGNIIEKSGSWYSHDSERIGQG 311

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN++ FL +N EIA+ IE+ +R+NAGL+AD LL  P     +D D DD
Sbjct: 312 RENARQFLLDNPEIADRIEAQVRKNAGLIADELLVGPG----EDDDLDD 356


>gi|60392988|sp|P62209|RECA_AZOLI RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|37700516|gb|AAR00257.1| RecA [Azospirillum lipoferum]
          Length = 369

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 246/338 (72%), Positives = 301/338 (89%), Gaps = 1/338 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E + +DK KAL+AALSQI+R +GKG+IM+LG++ ++ E  EV+S+GSLGLDIALGIGG P
Sbjct: 10  EKDSMDKQKALDAALSQIERAFGKGSIMKLGARENLVE-TEVISTGSLGLDIALGIGGLP 68

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRIVEIYGPESSGKTTLALH IAQ+QK GGTCAFVDAEHALD  YARKLGV++  LLIS
Sbjct: 69  KGRIVEIYGPESSGKTTLALHAIAQAQKAGGTCAFVDAEHALDPSYARKLGVNIDELLIS 128

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPD GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG+++ G+ ARLMSQALRK
Sbjct: 129 QPDAGEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDAMSGLHARLMSQALRK 188

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SIS+S C+++FINQ+R+KIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIKD+D++
Sbjct: 189 LTGSISKSNCLVIFINQIRLKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKDRDTV 248

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNKMA PF+ VEFDIMYGEG+S  GEL+DLG++A +VDKSGAWFS+ G R
Sbjct: 249 VGNQTRVKVVKNKMAPPFRVVEFDIMYGEGVSKVGELLDLGIQAGVVDKSGAWFSYDGTR 308

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           +GQGREN+K +LR N E+A+ IE+ +R NAGLVAD+++
Sbjct: 309 IGQGRENAKTYLRNNPEMADAIEAKIRGNAGLVADAMM 346


>gi|207366350|emb|CAQ58070.1| recombinase A [Agrobacterium tumefaciens]
          Length = 316

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 250/315 (79%), Positives = 288/315 (91%), Gaps = 1/315 (0%)

Query: 14  KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73
           KALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRIVEIY
Sbjct: 1   KALEAALSQIERSFGKGSIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRIVEIY 59

Query: 74  GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133
           GPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDTGEQA
Sbjct: 60  GPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDTGEQA 119

Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193
           LEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS+S
Sbjct: 120 LEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISKS 179

Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253
           KC+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+++ + GNQTRVK
Sbjct: 180 KCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEREEVVGNQTRVK 239

Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313
           VVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQGREN+
Sbjct: 240 VVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRENA 299

Query: 314 KIFLRENIEIAENIE 328
           K FLR+N E A  IE
Sbjct: 300 KTFLRDNPETANEIE 314


>gi|6225929|sp|Q9ZIQ0|RECA_RHOVI RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|3769371|gb|AAC64504.1| RecA protein [Blastochloris viridis]
          Length = 348

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 248/350 (70%), Positives = 306/350 (87%), Gaps = 5/350 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AAL+QI+R +GKG+IM+LG  G+  E +E +S+GSLGLDIALGIGG P+GR+
Sbjct: 1   MDKTKALDAALTQIERAFGKGSIMRLGKSGAALE-VETISTGSLGLDIALGIGGLPRGRV 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEI+GPESSGKTTLALHT+A++QK GG CAF+DAEHALD +YARKLGV+L +LLISQPD 
Sbjct: 60  VEIFGPESSGKTTLALHTVAEAQKKGGVCAFIDAEHALDPLYARKLGVNLDDLLISQPDA 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG+S PGMQARLMSQALRKLT+S
Sbjct: 120 GEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDSQPGMQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS C+++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GNQ
Sbjct: 180 ISRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GELIDLGVKA +VDKSG+WFS   QR+GQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIMYGEGISKAGELIDLGVKAGVVDKSGSWFSHDSQRIGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDT 359
           REN K FL+ + ++A  IE+ +RQNAGL+A+ +L     +++D  D +D 
Sbjct: 300 RENVKGFLKGHPDVAGRIEAAIRQNAGLIAERILG----SSEDSEDGEDA 345


>gi|295810384|emb|CBL81076.1| recombinase A [Agrobacterium larrymoorei]
          Length = 316

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 250/317 (78%), Positives = 290/317 (91%), Gaps = 1/317 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           KSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI+E
Sbjct: 1   KSKALEAALSQIERSFGKGSIMKLGSNENVIE-VETVSTGSLSLDIALGIGGLPKGRIIE 59

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGE
Sbjct: 60  IYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 119

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS
Sbjct: 120 QALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 179

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
           +SK +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQTR
Sbjct: 180 KSKTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTR 239

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQGRE
Sbjct: 240 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRE 299

Query: 312 NSKIFLRENIEIAENIE 328
           N+K F+R+N  +A  IE
Sbjct: 300 NAKGFVRDNPAVANEIE 316


>gi|295810382|emb|CBL81075.1| recombinase A [Agrobacterium larrymoorei]
          Length = 319

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 251/320 (78%), Positives = 290/320 (90%), Gaps = 1/320 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           KSKALEAALSQI+R +GKG+IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI+E
Sbjct: 1   KSKALEAALSQIERSFGKGSIMKLGSNENVIE-VETVSTGSLSLDIALGIGGLPKGRIIE 59

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGE
Sbjct: 60  IYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDTGE 119

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS
Sbjct: 120 QALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASIS 179

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
           +SK +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQTR
Sbjct: 180 KSKTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTR 239

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQGR 
Sbjct: 240 VKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRX 299

Query: 312 NSKIFLRENIEIAENIESLL 331
           N+K FLR+N  +A  IE  L
Sbjct: 300 NAKGFLRDNPAVANEIEXAL 319


>gi|75675472|ref|YP_317893.1| recombinase A [Nitrobacter winogradskyi Nb-255]
 gi|123745720|sp|Q3ST50|RECA_NITWN RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|74420342|gb|ABA04541.1| RecA protein [Nitrobacter winogradskyi Nb-255]
          Length = 362

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 246/350 (70%), Positives = 302/350 (86%), Gaps = 2/350 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + +EV+SSGSLGLDIALG+GG PKGRI
Sbjct: 14  MDKSKALSAALSQIERQFGKGSVMKLGKNDKSMD-VEVISSGSLGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VE+YGPESSGKTTLALH +A++QK GG CAF+DAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 73  VEVYGPESSGKTTLALHAVAEAQKKGGICAFIDAEHALDPVYARKLGVNVDDLLISQPDH 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD+++IDSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAVDVLIIDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GNQ
Sbjct: 193 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA IV+KSGAWFS+  QR+GQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGISKMGEILDLGVKAGIVEKSGAWFSYDSQRMGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ-EPAINTKDDADKDD 358
           REN+K FLR N +I   +E  +RQN+GL+A+ +L   P   T DD   +D
Sbjct: 313 RENAKAFLRANPDITAKVEMAIRQNSGLIAEQILAGSPERETDDDETAED 362


>gi|85715199|ref|ZP_01046183.1| recombinase A [Nitrobacter sp. Nb-311A]
 gi|85698114|gb|EAQ35987.1| recombinase A [Nitrobacter sp. Nb-311A]
          Length = 362

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 247/350 (70%), Positives = 301/350 (86%), Gaps = 2/350 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + +EVVSSGSLGLDIALG+GG PKGRI
Sbjct: 14  MDKSKALSAALSQIERQFGKGSVMKLGKNDKSMD-VEVVSSGSLGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VE+YGPESSGKTTLALH +A++QK GG CAF+DAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 73  VEVYGPESSGKTTLALHAVAEAQKKGGICAFIDAEHALDPVYARKLGVNVDDLLISQPDH 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD+++IDSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAVDVLIIDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GNQ
Sbjct: 193 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA IV+KSGAWFS+  QR+GQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGISKMGEILDLGVKAGIVEKSGAWFSYDSQRMGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ-EPAINTKDDADKDD 358
           REN+K FLR N +I   +E  +RQN+GL+A+ +L   P   T DD    D
Sbjct: 313 RENAKAFLRANPDITAKVEMAIRQNSGLIAEQILAGSPERETDDDETAGD 362


>gi|304321908|ref|YP_003855551.1| recombinase A [Parvularcula bermudensis HTCC2503]
 gi|303300810|gb|ADM10409.1| recombinase A [Parvularcula bermudensis HTCC2503]
          Length = 360

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 251/340 (73%), Positives = 298/340 (87%), Gaps = 1/340 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALEAALSQI + +GKG++M+LGSQ  I + IE +S+GSLGLDIALGIGG PKGRI
Sbjct: 12  MDKSKALEAALSQIDKAFGKGSVMKLGSQDKIVQ-IEGISTGSLGLDIALGIGGLPKGRI 70

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH  A+SQK GGT AF+DAEHALD IYA KLGV L  LLISQPDT
Sbjct: 71  VEIYGPESSGKTTLALHCAAESQKAGGTAAFIDAEHALDPIYASKLGVKLDELLISQPDT 130

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++VIDSVAALTP+AE+EG+MG+SLPG+QARLMSQALRKLT S
Sbjct: 131 GEQALEIADTLVRSGAIDVLVIDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTGS 190

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K +D + GNQ
Sbjct: 191 ISRSNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGALKARDEVIGNQ 250

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV  +IV+KSG+W+S+  +R+GQG
Sbjct: 251 TRVKVVKNKVAPPFKQVEFDIMYGEGISKVGELLDLGVLGNIVEKSGSWYSYNSERIGQG 310

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAIN 349
           R+N+K FL++N +IA  IE  +R+NAGL+AD +L  P  N
Sbjct: 311 RDNAKSFLKDNPDIAAAIEQAVRRNAGLIADDMLVGPKDN 350


>gi|148256739|ref|YP_001241324.1| recombinase A [Bradyrhizobium sp. BTAi1]
 gi|146408912|gb|ABQ37418.1| RecA protein [Bradyrhizobium sp. BTAi1]
          Length = 362

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 246/349 (70%), Positives = 304/349 (87%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + +E VS+GSLGLDIALGIGG PKGR+
Sbjct: 14  MDKSKALSAALSQIERQFGKGSVMKLGKNDRSMD-VETVSTGSLGLDIALGIGGLPKGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALHT+A++QK GG CAF+DAEHALD +YARKLGV++  LLISQPDT
Sbjct: 73  IEIYGPESSGKTTLALHTVAEAQKKGGICAFIDAEHALDPVYARKLGVNIDELLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAAL P+AE+EG+MGESLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEICDTLVRSGAVDVLVVDSVAALVPKAELEGEMGESLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+S+RLDIRR+G+IK++D + GN 
Sbjct: 193 INKSHTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASIRLDIRRIGAIKERDEVIGNT 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           RENSK FL+ N ++   IE+ +RQN+GL+A+ +L   A N + DAD ++
Sbjct: 313 RENSKSFLKANPDMTAKIEAAIRQNSGLIAEQIL---AGNAERDADGEE 358


>gi|330993236|ref|ZP_08317172.1| Protein recA [Gluconacetobacter sp. SXCC-1]
 gi|329759638|gb|EGG76146.1| Protein recA [Gluconacetobacter sp. SXCC-1]
          Length = 348

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 249/337 (73%), Positives = 298/337 (88%), Gaps = 2/337 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALE ALSQI+R +GKG+IM++G + S  E ++V+S+GSLGLDIALGIGG P+GRI
Sbjct: 7   IDKSKALEGALSQIERAFGKGSIMRMGERPS--EQVDVISTGSLGLDIALGIGGLPRGRI 64

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTT+ALH IA++Q+ GGTCAF+DAEHALD  YARKLGVD+ NLLISQPD 
Sbjct: 65  VEIYGPESSGKTTMALHAIAEAQRKGGTCAFIDAEHALDPGYARKLGVDVDNLLISQPDA 124

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EGDMG+S  G+ ARLMSQALRKLT S
Sbjct: 125 GEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGDMGDSHVGLHARLMSQALRKLTGS 184

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +SRS  +L+F+NQ+R+KIGVMFGSPETTTGGNALKFY+SVR+DIRR+GSIKDKD +TGNQ
Sbjct: 185 VSRSNTMLIFLNQIRLKIGVMFGSPETTTGGNALKFYASVRMDIRRIGSIKDKDEVTGNQ 244

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDIMYGEGIS  GELIDLGVKA IV+KSGAWFS   QR+GQG
Sbjct: 245 TRVKVVKNKMAPPFRQVEFDIMYGEGISKVGELIDLGVKAGIVEKSGAWFSCDSQRIGQG 304

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           REN+K FLR++ E+A +IE  +R+ AG+VA+++L  P
Sbjct: 305 RENAKQFLRDHPEMAADIERRVREQAGVVAEAMLVGP 341


>gi|209964227|ref|YP_002297142.1| RecA protein [Rhodospirillum centenum SW]
 gi|226723637|sp|B6IS93|RECA_RHOCS RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|209957693|gb|ACI98329.1| RecA protein [Rhodospirillum centenum SW]
          Length = 358

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 242/337 (71%), Positives = 297/337 (88%), Gaps = 1/337 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KAL+AAL QI+R +GKG+IM+LG++ ++ E  E +S+GSLGLDIALGIGG P+GRI
Sbjct: 13  MDKQKALDAALGQIERAFGKGSIMKLGAREAMAE-TEAISTGSLGLDIALGIGGLPRGRI 71

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GGTCAFVDAEHALD  YARKLGVD+  LLISQPD 
Sbjct: 72  VEIYGPESSGKTTLALHAIAEAQKAGGTCAFVDAEHALDPAYARKLGVDVDELLISQPDA 131

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG+S  G+ ARLMSQALRKLT S
Sbjct: 132 GEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDSHVGLHARLMSQALRKLTGS 191

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S+C+++FINQ+R+KIGVMFG+PETTTGGNALKFY+S+RLDIRR+G+IKD+D++ GNQ
Sbjct: 192 ISKSRCLVIFINQIRLKIGVMFGNPETTTGGNALKFYASIRLDIRRIGAIKDRDNVVGNQ 251

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+ VEFDIMYGEG+S  GEL+DLG++A +V+KSGAWFS+ GQR+GQG
Sbjct: 252 TRVKVVKNKMAPPFRVVEFDIMYGEGVSKVGELLDLGIQAGVVEKSGAWFSYDGQRIGQG 311

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           REN+K FLR N  +AE IE+ +R NAGLVA +++  P
Sbjct: 312 RENAKTFLRNNAAVAEAIEAKVRANAGLVASAMMGAP 348


>gi|163852021|ref|YP_001640064.1| recA protein [Methylobacterium extorquens PA1]
 gi|218530775|ref|YP_002421591.1| recA protein [Methylobacterium chloromethanicum CM4]
 gi|240139288|ref|YP_002963763.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Methylobacterium extorquens AM1]
 gi|254561744|ref|YP_003068839.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Methylobacterium extorquens DM4]
 gi|163663626|gb|ABY30993.1| recA protein [Methylobacterium extorquens PA1]
 gi|218523078|gb|ACK83663.1| recA protein [Methylobacterium chloromethanicum CM4]
 gi|240009260|gb|ACS40486.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Methylobacterium extorquens AM1]
 gi|254269022|emb|CAX24983.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Methylobacterium extorquens DM4]
          Length = 366

 Score =  521 bits (1341), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/346 (75%), Positives = 305/346 (88%), Gaps = 2/346 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKA+EAAL+QI+R +GKG+IM+LG    + E +E +S+GSLGLDIALG+GG P+GR+V
Sbjct: 20  DKSKAIEAALTQIERAFGKGSIMRLGKSDKVQE-VETISTGSLGLDIALGVGGLPRGRVV 78

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGV+L +LLISQPDTG
Sbjct: 79  EIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPDTG 138

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MGES PG+QARLMSQALRKLT SI
Sbjct: 139 EQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGESQPGLQARLMSQALRKLTGSI 198

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRRV ++KD+D   GN  
Sbjct: 199 SRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRVSTLKDRDEAIGNSV 258

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIM+GEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQGR
Sbjct: 259 RVKVVKNKVAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYDSQRLGQGR 318

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK 356
           ENSK FLR+N +IA  IE+ +RQN+GLVAD +L E A  T DD D+
Sbjct: 319 ENSKGFLRDNPDIANKIEASIRQNSGLVADRIL-ETAKPTADDLDE 363


>gi|209542693|ref|YP_002274922.1| recA protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530370|gb|ACI50307.1| recA protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 350

 Score =  521 bits (1341), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 245/337 (72%), Positives = 296/337 (87%), Gaps = 2/337 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALE ALSQI+R +GKG++M+LG + +  E ++V+S+GSLGLDIALGIGG P+GRI
Sbjct: 7   IDKSKALEGALSQIERAFGKGSVMRLGQRAN--EAVDVISTGSLGLDIALGIGGLPRGRI 64

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GG CAF+DAEHALD  YARKLGVD+ NLLISQPD 
Sbjct: 65  VEIYGPESSGKTTLALHAIAEAQKKGGVCAFIDAEHALDPGYARKLGVDVDNLLISQPDA 124

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EGDMG+S  G+ ARLMSQALRKLT +
Sbjct: 125 GEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGDMGDSHVGLHARLMSQALRKLTGT 184

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +SRS  +++F+NQ+R+KIGVMFGSPETTTGGNALKFY+SVR+DIRR+G IKDKD + GNQ
Sbjct: 185 VSRSNTMMIFLNQIRLKIGVMFGSPETTTGGNALKFYASVRMDIRRIGQIKDKDEVVGNQ 244

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDI+YGEGIS  GELIDLGVKA IV+KSGAWFS+  QR+GQG
Sbjct: 245 TRVKVVKNKMAPPFRQVEFDIVYGEGISKMGELIDLGVKAGIVEKSGAWFSYDSQRIGQG 304

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           RENSK +LRE+ E+A +IE  +R+ AG+VA+++L  P
Sbjct: 305 RENSKQYLREHPEMAADIERRVREQAGVVAEAMLVSP 341


>gi|114569557|ref|YP_756237.1| recA protein [Maricaulis maris MCS10]
 gi|114340019|gb|ABI65299.1| RecA protein [Maricaulis maris MCS10]
          Length = 359

 Score =  521 bits (1341), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 250/351 (71%), Positives = 307/351 (87%), Gaps = 4/351 (1%)

Query: 4   RKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGG 63
           + E N+ DK KA+EAALSQI + +GKG++M+LG + ++   IE +S+GSLGLDIALGIGG
Sbjct: 10  KNEKNM-DKEKAIEAALSQIDKAFGKGSVMKLGQKPAME--IETISTGSLGLDIALGIGG 66

Query: 64  FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLL 123
            PKGRI+EIYGPESSGKTTLALHT+A++QK GG  AFVDAEHALD +YA KLGVDL  LL
Sbjct: 67  LPKGRIIEIYGPESSGKTTLALHTVAEAQKAGGVAAFVDAEHALDPVYAGKLGVDLGELL 126

Query: 124 ISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQAL 183
           ISQPDTGEQALEI D LVRSGA+DI+VIDSVAALTPRAE+EG+MG+SLPG+QARLMSQAL
Sbjct: 127 ISQPDTGEQALEIADTLVRSGAIDILVIDSVAALTPRAELEGEMGDSLPGLQARLMSQAL 186

Query: 184 RKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKD 243
           RKLT SIS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IK++D
Sbjct: 187 RKLTGSISKSKCLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKNRD 246

Query: 244 SITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKG 303
            + GNQTRVKVVKNK+A PF++VEFDI+YGEGIS  GELIDLGVK  +++KSG+W+S+  
Sbjct: 247 EVIGNQTRVKVVKNKVAPPFREVEFDILYGEGISKMGELIDLGVKGDVIEKSGSWYSYNS 306

Query: 304 QRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           +R+GQGREN++ FL E+ +IA +IE+ +R NAGL+AD +L  P +  +DDA
Sbjct: 307 ERIGQGRENARQFLLEHGDIAADIEARVRSNAGLIADEMLTGPDL-AEDDA 356


>gi|146341855|ref|YP_001206903.1| recombinase A [Bradyrhizobium sp. ORS278]
 gi|146194661|emb|CAL78686.1| Recombinase A (recA) [Bradyrhizobium sp. ORS278]
          Length = 362

 Score =  521 bits (1341), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 248/349 (71%), Positives = 303/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + +E VS+GSLGLDIALGIGG PKGRI
Sbjct: 14  MDKSKALSAALSQIERQFGKGSVMKLGKNDRSMD-VETVSTGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHT+A++QK GG CAF+DAEHALD +YARKLGV++  LLISQPDT
Sbjct: 73  VEIYGPESSGKTTLALHTVAEAQKKGGICAFIDAEHALDPVYARKLGVNIDELLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAAL P+AE+EG+MGESLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEICDTLVRSGAVDVLVVDSVAALVPKAELEGEMGESLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GN 
Sbjct: 193 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVIGNT 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           RENSK FL+ N ++   IE+ +RQN+GL+A+ +L   A   + DAD ++
Sbjct: 313 RENSKSFLKANPDMTAKIEAAIRQNSGLIAEQILAGAA---ERDADGEE 358


>gi|299131743|ref|ZP_07024938.1| recA protein [Afipia sp. 1NLS2]
 gi|298591880|gb|EFI52080.1| recA protein [Afipia sp. 1NLS2]
          Length = 360

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 242/334 (72%), Positives = 298/334 (89%), Gaps = 1/334 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL AALSQI+R +GKG++M+LG      + IEV+SSGSLGLDIALG+GG PKGR+
Sbjct: 14  MDKTKALTAALSQIERQFGKGSVMRLGKADRSMD-IEVISSGSLGLDIALGVGGLPKGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHT+A++QK GGTCAF+DAEHALD +YARKLGV++  LLISQPD 
Sbjct: 73  VEIYGPESSGKTTLALHTVAEAQKKGGTCAFIDAEHALDPVYARKLGVNVDELLISQPDH 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAVDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GN 
Sbjct: 193 INKSHTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVIGNS 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           RENSK FLR+N ++   IE+ +RQN+GL+A+ +L
Sbjct: 313 RENSKAFLRDNPDMTAKIEAAIRQNSGLIAEQIL 346


>gi|209884571|ref|YP_002288428.1| protein RecA [Oligotropha carboxidovorans OM5]
 gi|209872767|gb|ACI92563.1| protein RecA [Oligotropha carboxidovorans OM5]
          Length = 360

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 243/337 (72%), Positives = 298/337 (88%), Gaps = 1/337 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL AALSQI+R +GKG++M+LG      + IEV+SSGSLGLDIALG+GG PKGRI
Sbjct: 14  MDKTKALTAALSQIERQFGKGSVMRLGKNDRSMD-IEVISSGSLGLDIALGVGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GGTCAF+DAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 73  VEIYGPESSGKTTLALHAVAEAQKKGGTCAFIDAEHALDPVYARKLGVNVDDLLISQPDH 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++++DSVAAL PRAE+EG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAVDVLIVDSVAALVPRAELEGEMGDSLPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR G+IK++D + GN 
Sbjct: 193 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRTGAIKERDEVIGNS 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           REN+K FLR+N ++   IE+ +RQN+GL+A+ +L  P
Sbjct: 313 RENAKSFLRDNPDMVAKIEAAIRQNSGLIAEQILAGP 349


>gi|154253020|ref|YP_001413844.1| recA protein [Parvibaculum lavamentivorans DS-1]
 gi|189039601|sp|A7HWA4|RECA_PARL1 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|154156970|gb|ABS64187.1| recA protein [Parvibaculum lavamentivorans DS-1]
          Length = 365

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/350 (73%), Positives = 302/350 (86%), Gaps = 1/350 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL+AALSQI+R +GKG+IM+LG    I E IE VS+GSLGLDIALGIGG P+GRI+
Sbjct: 14  DKKKALDAALSQIERSFGKGSIMRLGKNEQIVE-IESVSTGSLGLDIALGIGGLPRGRII 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLAL T+A++QK+GG CAFVDAEHALD IYARKLGV L +LLISQPDTG
Sbjct: 73  EIYGPESSGKTTLALQTVAEAQKSGGVCAFVDAEHALDPIYARKLGVQLDDLLISQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD++VIDSVAALTP+AE+EG+MG+SLPG+QARLMSQALRKLT SI
Sbjct: 133 EQALEIADTLVRSGAVDVLVIDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTGSI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D + GNQT
Sbjct: 193 SKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEVVGNQT 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLG KA IV+KSG+WFS+  QR+GQGR
Sbjct: 253 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELVDLGSKAGIVEKSGSWFSYNSQRIGQGR 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360
           EN+K FLR+N E+A  IE+ +R NAGL+A+ ++  P      D D  D +
Sbjct: 313 ENAKQFLRDNPEMAAEIEAAIRANAGLIAEKIMDVPGSERDGDEDAGDME 362


>gi|27380866|ref|NP_772395.1| recombinase A [Bradyrhizobium japonicum USDA 110]
 gi|37537946|sp|Q89I84|RECA_BRAJA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|27354032|dbj|BAC51020.1| RecA protein [Bradyrhizobium japonicum USDA 110]
          Length = 362

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 247/349 (70%), Positives = 303/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + +E VSSGSLGLDIALGIGG PKGR+
Sbjct: 14  MDKSKALAAALSQIERQFGKGSVMKLGKNDRSMD-VEAVSSGSLGLDIALGIGGLPKGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHT+A++QK GG CAF+DAEHALD +YARKLGV++  LLISQPDT
Sbjct: 73  VEIYGPESSGKTTLALHTVAEAQKKGGICAFIDAEHALDPVYARKLGVNIDELLISQPDT 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAAL P+AE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEICDTLVRSGAVDVLVVDSVAALVPKAELEGEMGDALPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GN 
Sbjct: 193 INKSHTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNT 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           RENSK FL+ N +I   IE+ +RQN+GL+A+ +L   A   + DAD ++
Sbjct: 313 RENSKAFLKANPDITAKIETAIRQNSGLIAEQIL---AGTPERDADGEE 358


>gi|254292634|ref|YP_003058657.1| recA protein [Hirschia baltica ATCC 49814]
 gi|254041165|gb|ACT57960.1| recA protein [Hirschia baltica ATCC 49814]
          Length = 364

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 250/352 (71%), Positives = 300/352 (85%), Gaps = 2/352 (0%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N +DK KALE AL QI+R +GKG+IM+LG   S+   +E VS+GSL LDIALGIGG P
Sbjct: 10  ENNGMDKQKALETALGQIERNFGKGSIMRLGDNASM--DVEAVSTGSLSLDIALGIGGLP 67

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           KGRI+EIYGPESSGKTTLALH IA++QK GG  AFVDAEHALD IYA KLGVDL +LL+S
Sbjct: 68  KGRIIEIYGPESSGKTTLALHCIAEAQKNGGVAAFVDAEHALDPIYAGKLGVDLGDLLVS 127

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQ+LEI D LVRSGAVD++VIDSVAALTPRAE+EG+MG+SLPG+QARLMSQALRK
Sbjct: 128 QPDTGEQSLEIADTLVRSGAVDVLVIDSVAALTPRAELEGEMGDSLPGLQARLMSQALRK 187

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SIS+SKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D +
Sbjct: 188 LTGSISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALKDRDEV 247

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PF+QVEFDI+YGEGIS  GELIDLGVKA +VDK+G+W+S+  +R
Sbjct: 248 IGNQTRVKVVKNKVAPPFRQVEFDIIYGEGISKTGELIDLGVKAGVVDKAGSWYSYGSER 307

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           +GQGREN++ FL+ N  IA  IE  +R +AGL+++ +L     N  D+ D D
Sbjct: 308 IGQGRENARTFLKANPSIAAEIEEKIRADAGLISEEMLAAGQANITDEEDPD 359


>gi|162148079|ref|YP_001602540.1| protein recA (recombinase A) [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786656|emb|CAP56239.1| Protein recA (Recombinase A) [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 381

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 245/337 (72%), Positives = 296/337 (87%), Gaps = 2/337 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALE ALSQI+R +GKG++M+LG + +  E ++V+S+GSLGLDIALGIGG P+GRI
Sbjct: 38  IDKSKALEGALSQIERAFGKGSVMRLGQRAN--EAVDVISTGSLGLDIALGIGGLPRGRI 95

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GG CAF+DAEHALD  YARKLGVD+ NLLISQPD 
Sbjct: 96  VEIYGPESSGKTTLALHAIAEAQKKGGVCAFIDAEHALDPGYARKLGVDVDNLLISQPDA 155

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EGDMG+S  G+ ARLMSQALRKLT +
Sbjct: 156 GEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGDMGDSHVGLHARLMSQALRKLTGT 215

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +SRS  +++F+NQ+R+KIGVMFGSPETTTGGNALKFY+SVR+DIRR+G IKDKD + GNQ
Sbjct: 216 VSRSNTMMIFLNQIRLKIGVMFGSPETTTGGNALKFYASVRMDIRRIGQIKDKDEVVGNQ 275

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDI+YGEGIS  GELIDLGVKA IV+KSGAWFS+  QR+GQG
Sbjct: 276 TRVKVVKNKMAPPFRQVEFDIVYGEGISKMGELIDLGVKAGIVEKSGAWFSYDSQRIGQG 335

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           RENSK +LRE+ E+A +IE  +R+ AG+VA+++L  P
Sbjct: 336 RENSKQYLREHPEMAADIERRVREQAGVVAEAMLVSP 372


>gi|163794127|ref|ZP_02188100.1| RecA protein [alpha proteobacterium BAL199]
 gi|159180741|gb|EDP65260.1| RecA protein [alpha proteobacterium BAL199]
          Length = 360

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 248/356 (69%), Positives = 305/356 (85%), Gaps = 5/356 (1%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E + +DKSKALEAALSQI+R +GKG++M+LG +    E I+ VS+GS+GLDIALGIGG P
Sbjct: 9   EKDGMDKSKALEAALSQIERAFGKGSVMKLGQREGAVE-IDTVSTGSIGLDIALGIGGLP 67

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           +GR+VEIYGPESSGKTTL+LH +A++QK GGTCAFVDAEHALD IYARKLGVD+  LLIS
Sbjct: 68  RGRVVEIYGPESSGKTTLSLHVVAEAQKAGGTCAFVDAEHALDPIYARKLGVDVDELLIS 127

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPDTGEQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG++  G+QARLMSQALRK
Sbjct: 128 QPDTGEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDTHVGLQARLMSQALRK 187

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSI 245
           LT SIS+S+C+++FINQ+R KIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IKD+D +
Sbjct: 188 LTGSISKSRCMVIFINQIRQKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKDRDEV 247

Query: 246 TGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQR 305
            GNQTRVKVVKNK+A PF+ VEFDIMYGEG+S  GEL+DLGV A IV+KSGAWFS  G R
Sbjct: 248 VGNQTRVKVVKNKLAPPFRVVEFDIMYGEGVSKMGELLDLGVNAGIVEKSGAWFSHGGNR 307

Query: 306 LGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDN 361
           +GQGREN+K FLR+N ++A+ IE  +R+NAGLVAD++L    +   D  + D  D+
Sbjct: 308 IGQGRENAKTFLRQNPDVAQIIERKIRENAGLVADAML----VGDPDPGEGDSGDD 359


>gi|5103048|dbj|BAA78779.1| RecA protein [Rhodopseudomonas palustris]
          Length = 363

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 245/349 (70%), Positives = 304/349 (87%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      E IE +SSGSLGLDIALG+GG PKGRI
Sbjct: 15  MDKSKALSAALSQIERQFGKGSVMKLGKNDRAME-IETISSGSLGLDIALGVGGLPKGRI 73

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GG CAF+DAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 74  VEIYGPESSGKTTLALHCVAEAQKKGGICAFIDAEHALDPVYARKLGVNVDDLLISQPDH 133

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 134 GEQALEIADTLVRSGAIDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 193

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GNQ
Sbjct: 194 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVIGNQ 253

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 254 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQG 313

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FLR N ++   IE+ +RQN+GL+A+ +L   A + + DAD ++
Sbjct: 314 RENAKSFLRSNPDMTAKIEAAIRQNSGLIAEQIL---AGSPERDADGEE 359


>gi|585797|sp|Q08327|RECA_ACEPO RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|300185|gb|AAC60438.1| RecA [Gluconacetobacter polyoxogenes]
 gi|391592|dbj|BAA02478.1| RecA protein [Gluconacetobacter polyoxogenes]
          Length = 348

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 247/337 (73%), Positives = 298/337 (88%), Gaps = 2/337 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALE ALSQI+R +GKG+IM++G + +  E ++V+S+GSLGLDIALGIGG P+GRI
Sbjct: 7   IDKSKALEGALSQIERAFGKGSIMRMGERPT--EQVDVISTGSLGLDIALGIGGLPRGRI 64

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTT+ALH IA++Q+ GGTCAF+DAEHALD  YARKLGVD+ NLLISQPD 
Sbjct: 65  IEIYGPESSGKTTMALHAIAEAQRKGGTCAFIDAEHALDPGYARKLGVDVDNLLISQPDA 124

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAAL PRAE+EGDMG+S  G+ ARLMSQALRKLT S
Sbjct: 125 GEQALEIADTLVRSGAVDVLVVDSVAALVPRAELEGDMGDSHVGLHARLMSQALRKLTGS 184

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +SRS  +L+F+NQ+R+KIGVMFGSPE+TTGGNALKFY+SVR+DIRR+GSIKDKD +TGNQ
Sbjct: 185 VSRSNTMLIFLNQIRLKIGVMFGSPESTTGGNALKFYASVRMDIRRIGSIKDKDEVTGNQ 244

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDIMYGEGIS  GELIDLGVKA IV+KSGAWFS   QR+GQG
Sbjct: 245 TRVKVVKNKMAPPFRQVEFDIMYGEGISKVGELIDLGVKAGIVEKSGAWFSCDSQRIGQG 304

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           REN+K FLR++ E+A +IE  +R+ AG+VA+++L  P
Sbjct: 305 RENAKQFLRDHPEMAADIERRVREQAGVVAEAMLVGP 341


>gi|92117166|ref|YP_576895.1| recombinase A [Nitrobacter hamburgensis X14]
 gi|123083700|sp|Q1QMW2|RECA_NITHX RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|91800060|gb|ABE62435.1| RecA protein [Nitrobacter hamburgensis X14]
          Length = 362

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 245/334 (73%), Positives = 295/334 (88%), Gaps = 1/334 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + IEV+SSGSLGLDIALG+GG PKGR+
Sbjct: 14  MDKSKALSAALSQIERQFGKGSVMKLGKNDKSMD-IEVISSGSLGLDIALGVGGLPKGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHT+A++QK GG CAF+DAEHALD IYARKLGV + +LLISQPD 
Sbjct: 73  VEIYGPESSGKTTLALHTVAEAQKKGGICAFIDAEHALDPIYARKLGVKVDDLLISQPDH 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD+++IDSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAVDVLIIDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GNQ
Sbjct: 193 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA IV+KSGAWFS   QR+GQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGISKMGEILDLGVKAGIVEKSGAWFSHDSQRMGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           REN+K FLR N +I   IE  +RQN+GL+A+ +L
Sbjct: 313 RENAKAFLRANPDITAKIEVAIRQNSGLLAEQIL 346


>gi|258541148|ref|YP_003186581.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-01]
 gi|256632226|dbj|BAH98201.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-01]
 gi|256635283|dbj|BAI01252.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-03]
 gi|256638338|dbj|BAI04300.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-07]
 gi|256641392|dbj|BAI07347.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-22]
 gi|256644447|dbj|BAI10395.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-26]
 gi|256647502|dbj|BAI13443.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-32]
 gi|256650555|dbj|BAI16489.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653546|dbj|BAI19473.1| DNA recombinase RecA [Acetobacter pasteurianus IFO 3283-12]
          Length = 398

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 243/344 (70%), Positives = 301/344 (87%), Gaps = 2/344 (0%)

Query: 3   YRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIG 62
           +RK M  +DK+KALE AL QI+R +GKG++M+LG +  +    +V+ +GSLGLDIALGIG
Sbjct: 51  HRKGMVKMDKAKALEGALGQIERAFGKGSVMRLGQRPKVEA--DVIPTGSLGLDIALGIG 108

Query: 63  GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNL 122
           G P+GR+VEIYGPESSGKTTLALH IA++QK GGTCAF+DAEHALD  YA+KLGVD+ NL
Sbjct: 109 GLPRGRVVEIYGPESSGKTTLALHAIAEAQKRGGTCAFIDAEHALDPSYAKKLGVDVDNL 168

Query: 123 LISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQA 182
           LISQPDTGEQALEI D LVRSGA+D++V+DSVAAL PRAE+EGDMG+S  G+ ARLMSQA
Sbjct: 169 LISQPDTGEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGDMGDSHVGLHARLMSQA 228

Query: 183 LRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDK 242
           LRKLT +++RS  +++F+NQ+R+KIGVMFG+PETTTGGNALKFYSSVR+DIRR+GSIKDK
Sbjct: 229 LRKLTGTVARSNTLMIFLNQIRLKIGVMFGNPETTTGGNALKFYSSVRMDIRRIGSIKDK 288

Query: 243 DSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFK 302
           D +TGNQTRVKVVKNKMA PF+QVEFDIMYGEGIS  GELIDLGVKA +V+KSGAWFS+ 
Sbjct: 289 DEVTGNQTRVKVVKNKMAPPFRQVEFDIMYGEGISKVGELIDLGVKAGVVEKSGAWFSYD 348

Query: 303 GQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
            QR+GQGREN+K FLR++ E+A +IE  +R++AG+VA++++  P
Sbjct: 349 SQRIGQGRENAKQFLRDHPEMAADIERRVREHAGVVAEAMMVAP 392


>gi|170748646|ref|YP_001754906.1| recA protein [Methylobacterium radiotolerans JCM 2831]
 gi|238688878|sp|B1LWT6|RECA_METRJ RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|170655168|gb|ACB24223.1| recA protein [Methylobacterium radiotolerans JCM 2831]
          Length = 363

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/346 (74%), Positives = 305/346 (88%), Gaps = 2/346 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKA++AALSQI+R +GKG+IM+LG    + E +E VS+GSLGLDIALG+GG P+GR++
Sbjct: 17  DKSKAIDAALSQIERAFGKGSIMRLGKSDKVQE-VETVSTGSLGLDIALGVGGLPRGRVI 75

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGV+L +LLISQPDTG
Sbjct: 76  EIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPDTG 135

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MGES PG+QARLMSQALRKLT SI
Sbjct: 136 EQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGESQPGLQARLMSQALRKLTGSI 195

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+ ++KD+D   GNQ 
Sbjct: 196 SRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRISTLKDRDEAIGNQV 255

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIM+GEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQGR
Sbjct: 256 RVKVVKNKVAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYNSQRLGQGR 315

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK 356
           ENSK FLR+N +IA  IE  +RQN+GLVA+ +L E A  T DD D+
Sbjct: 316 ENSKGFLRDNPKIAAEIEGSIRQNSGLVAEKIL-ENAAPTADDLDE 360


>gi|312115731|ref|YP_004013327.1| recA protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311220860|gb|ADP72228.1| recA protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 378

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 247/334 (73%), Positives = 294/334 (88%), Gaps = 1/334 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KALEAALSQI+R +GKG++M+LG    + E +E +S+GSLGLDIALGIGG P+GR+
Sbjct: 16  MDKQKALEAALSQIERNFGKGSVMRLGKNDKLVE-VEAISTGSLGLDIALGIGGLPRGRV 74

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEI+GPESSGKTTLALH IA++QK GG+C FVDAEHALD  YARKLGV+L+ L+ISQPD 
Sbjct: 75  VEIFGPESSGKTTLALHVIAEAQKKGGSCGFVDAEHALDPGYARKLGVNLEELIISQPDA 134

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGA+D+IV+DSVAALTP+AEIEG+MG+ LPGMQARLMSQALRKLT S
Sbjct: 135 GEQALEITDTLVRSGAIDVIVVDSVAALTPKAEIEGEMGDVLPGMQARLMSQALRKLTGS 194

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G IK++D + GNQ
Sbjct: 195 ISKSNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGQIKERDEVVGNQ 254

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA+IV+KSG+W+S   QR+GQG
Sbjct: 255 TRVKVVKNKVAPPFKQVEFDIMYGEGISKTGELVDLGVKANIVEKSGSWYSHDSQRIGQG 314

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           REN+K FLR N  +AE IE  +R NAGL+A  +L
Sbjct: 315 RENAKAFLRGNPLVAEAIEREIRANAGLIATKIL 348


>gi|188581876|ref|YP_001925321.1| recA protein [Methylobacterium populi BJ001]
 gi|179345374|gb|ACB80786.1| recA protein [Methylobacterium populi BJ001]
          Length = 366

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/346 (74%), Positives = 305/346 (88%), Gaps = 2/346 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKA+EAAL+QI+R +GKG+IM+LG    + E +E VS+GSLGLDIALG+GG P+GR++
Sbjct: 20  DKSKAIEAALTQIERAFGKGSIMRLGKTDKVQE-VETVSTGSLGLDIALGVGGLPRGRVI 78

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGV+L +LLISQPDTG
Sbjct: 79  EIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPDTG 138

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MGES PG+QARLMSQALRKLT SI
Sbjct: 139 EQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGESQPGLQARLMSQALRKLTGSI 198

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRRV ++KD+D   GN  
Sbjct: 199 SRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRVSTLKDRDEAIGNSV 258

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIM+GEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQGR
Sbjct: 259 RVKVVKNKVAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYDSQRLGQGR 318

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK 356
           ENSK FLR+N +IA  IE+ +RQN+GLVAD +L E A  T +D D+
Sbjct: 319 ENSKGFLRDNPDIANKIEASIRQNSGLVADRIL-ENAKPTAEDLDE 363


>gi|316932870|ref|YP_004107852.1| recA protein [Rhodopseudomonas palustris DX-1]
 gi|315600584|gb|ADU43119.1| recA protein [Rhodopseudomonas palustris DX-1]
          Length = 363

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/334 (72%), Positives = 295/334 (88%), Gaps = 1/334 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      E IE +SSGSLGLDIALG+GG PKGRI
Sbjct: 15  MDKSKALSAALSQIERQFGKGSVMKLGKNDRAME-IETISSGSLGLDIALGVGGLPKGRI 73

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GG CAF+DAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 74  VEIYGPESSGKTTLALHCVAEAQKKGGICAFIDAEHALDPVYARKLGVNVDDLLISQPDH 133

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 134 GEQALEIADTLVRSGAIDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 193

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GNQ
Sbjct: 194 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQ 253

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS   QRLGQG
Sbjct: 254 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSHDSQRLGQG 313

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           REN+K FLR N ++   IE+ +RQN+GL+A+ +L
Sbjct: 314 RENAKAFLRANPDMTAKIEAAIRQNSGLIAEQIL 347


>gi|114797171|ref|YP_761421.1| recA protein [Hyphomonas neptunium ATCC 15444]
 gi|114737345|gb|ABI75470.1| recA protein [Hyphomonas neptunium ATCC 15444]
          Length = 356

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 245/348 (70%), Positives = 301/348 (86%), Gaps = 2/348 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDK KALE AL  I+R +GKG++M+LG + ++   IE VS+GSLGLDIALGIGG PKGRI
Sbjct: 7   VDKQKALETALGNIERSFGKGSVMRLGDKKTL--DIEAVSTGSLGLDIALGIGGLPKGRI 64

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EI+GPESSGKTTL+LH +A++QK GG CAF+DAEHALD +YA KLGVDL +LLISQPDT
Sbjct: 65  IEIFGPESSGKTTLSLHCVAEAQKNGGVCAFIDAEHALDPVYASKLGVDLDDLLISQPDT 124

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++VIDSVAALTPRAEIEG+MG+ LPG+QARLMSQALRKLT S
Sbjct: 125 GEQALEIADTLVRSGAVDLVVIDSVAALTPRAEIEGEMGDQLPGLQARLMSQALRKLTGS 184

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G IKD++ + GNQ
Sbjct: 185 ISKSKCMVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGQIKDREEVIGNQ 244

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PF+QVEFDI+YGEGIS  GEL+DLGVKA++V+KSG+WFS+ G+R+GQG
Sbjct: 245 TRVKVVKNKVAPPFRQVEFDIIYGEGISKTGELVDLGVKANVVEKSGSWFSYNGERIGQG 304

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           RE ++ FL++N  +A  IE  +R+NAGL+A+ LL    +  + D D +
Sbjct: 305 REKARQFLKDNPAVANEIEDAVRRNAGLLAEELLSAGMVAGEGDDDAE 352


>gi|329114759|ref|ZP_08243516.1| Protein RecA [Acetobacter pomorum DM001]
 gi|326695890|gb|EGE47574.1| Protein RecA [Acetobacter pomorum DM001]
          Length = 367

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 242/350 (69%), Positives = 302/350 (86%), Gaps = 2/350 (0%)

Query: 3   YRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIG 62
           +RK M  +DK+KALE AL QI+R +GKG++M+LG +  +    +V+ +GSLGLDIALGIG
Sbjct: 20  HRKGMVKMDKAKALEGALGQIERAFGKGSVMRLGQRPKVEA--DVIPTGSLGLDIALGIG 77

Query: 63  GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNL 122
           G P+GR+VEIYGPESSGKTTLALH IA++QK GGTCAF+DAEHALD  YA+KLGVD+ NL
Sbjct: 78  GLPRGRVVEIYGPESSGKTTLALHAIAEAQKRGGTCAFIDAEHALDPGYAKKLGVDVDNL 137

Query: 123 LISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQA 182
           LISQPD GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EGDMG+S  G+ ARLMSQA
Sbjct: 138 LISQPDAGEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGDMGDSHVGLHARLMSQA 197

Query: 183 LRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDK 242
           LRKLT +++RS  +++F+NQ+R+KIGVMFG+PETTTGGNALKFYSSVR+DIRR+GSIKDK
Sbjct: 198 LRKLTGTVARSNTLMIFLNQIRLKIGVMFGNPETTTGGNALKFYSSVRMDIRRIGSIKDK 257

Query: 243 DSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFK 302
           D +TGNQTRVKVVKNKMA PF+QVEFDIMYGEGIS  GELIDLGVKA +V+KSG+WFS+ 
Sbjct: 258 DEVTGNQTRVKVVKNKMAPPFRQVEFDIMYGEGISKVGELIDLGVKAGVVEKSGSWFSYD 317

Query: 303 GQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKD 352
            QR+GQGREN+K FLR++ E+A +IE  +R++AG+VA++++  P  +  D
Sbjct: 318 SQRIGQGRENAKQFLRDHPEMAADIERRVREHAGVVAEAMMVAPEHHEGD 367


>gi|297717870|gb|ADI50078.1| RecA protein [Candidatus Odyssella thessalonicensis L13]
          Length = 349

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/349 (69%), Positives = 304/349 (87%), Gaps = 2/349 (0%)

Query: 7   MNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPK 66
           M+  DK KAL+AALSQI+R +GKG++M+LG + ++   IE +SSGSLGLDIALGIGGFP+
Sbjct: 1   MSTADKGKALDAALSQIERAFGKGSVMRLGQRETVE--IEALSSGSLGLDIALGIGGFPR 58

Query: 67  GRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQ 126
           GRI+EIYGPESSGKTTLALH +A++QK GGTCAFVDAEHALD  YARKLGV++ NL+ISQ
Sbjct: 59  GRIIEIYGPESSGKTTLALHAVAEAQKVGGTCAFVDAEHALDPSYARKLGVNIDNLIISQ 118

Query: 127 PDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKL 186
           PDTGEQALEI D LVRSGA+D++++DSVAAL P+AE+EGDMG+S  G+QARLMSQALRKL
Sbjct: 119 PDTGEQALEIADTLVRSGAIDVLIVDSVAALVPKAELEGDMGDSHMGLQARLMSQALRKL 178

Query: 187 TSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSIT 246
             SI+++ C+++FINQ+R KIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIKDKD +T
Sbjct: 179 AGSINKTNCMVIFINQIRQKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKDKDQVT 238

Query: 247 GNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRL 306
           GNQTRVKVVKNKMA PFK V+FDIMYGEG+S  GELIDLGV A +V+K+G+W+S   QR+
Sbjct: 239 GNQTRVKVVKNKMAPPFKVVDFDIMYGEGVSKTGELIDLGVSAGVVEKAGSWYSMGSQRI 298

Query: 307 GQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           GQG+E ++ FLR+N +IA  IE+ +R NAGL++D++++    N++D+AD
Sbjct: 299 GQGKEAARQFLRDNPDIANQIETAIRNNAGLLSDNMMRGSESNSEDEAD 347


>gi|86750850|ref|YP_487346.1| recombinase A [Rhodopseudomonas palustris HaA2]
 gi|86573878|gb|ABD08435.1| RecA protein [Rhodopseudomonas palustris HaA2]
          Length = 364

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 244/349 (69%), Positives = 301/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL AALSQI+R +GKG++M+LG      + IE +SSGSLGLDIALG+GG PKGR+
Sbjct: 16  MDKTKALAAALSQIERQFGKGSVMKLGKNDRSMD-IETISSGSLGLDIALGVGGLPKGRV 74

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH  A++QK GG CAF+DAEHALD +YARKLGV++  LLISQPD 
Sbjct: 75  VEIYGPESSGKTTLALHCAAEAQKKGGICAFIDAEHALDPVYARKLGVNVDELLISQPDH 134

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++++DSVAAL PRAE+EGDMG++LPG+QARLMSQALRKLT+S
Sbjct: 135 GEQALEIADTLVRSGAIDVLIVDSVAALVPRAELEGDMGDALPGLQARLMSQALRKLTAS 194

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 195 INKSHTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGQIKERDEVVGNQ 254

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS+  QRLGQG
Sbjct: 255 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSYDSQRLGQG 314

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           RENSK FLR N ++   IE+ +RQN+GL+A+ +L   A + + DAD ++
Sbjct: 315 RENSKAFLRANPDMTAKIEASIRQNSGLIAEQIL---AGSPESDADGEE 360


>gi|39936912|ref|NP_949188.1| recombinase A [Rhodopseudomonas palustris CGA009]
 gi|192292742|ref|YP_001993347.1| recombinase A [Rhodopseudomonas palustris TIE-1]
 gi|39650769|emb|CAE29292.1| recombination protein recA [Rhodopseudomonas palustris CGA009]
 gi|192286491|gb|ACF02872.1| recA protein [Rhodopseudomonas palustris TIE-1]
          Length = 363

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 244/349 (69%), Positives = 302/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + IE +SSGSLGLDIALG+GG PKGRI
Sbjct: 15  MDKSKALSAALSQIERQFGKGSVMRLGKNDRSMD-IETISSGSLGLDIALGVGGLPKGRI 73

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GG CAFVDAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 74  VEIYGPESSGKTTLALHCVAEAQKKGGICAFVDAEHALDPVYARKLGVNVDDLLISQPDH 133

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 134 GEQALEIADTLVRSGAIDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 193

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 194 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGQIKERDEVVGNQ 253

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS   QRLGQG
Sbjct: 254 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSHDSQRLGQG 313

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FL+ N ++   IE+ +RQN+GL+A+ +L   A + + DAD ++
Sbjct: 314 RENAKAFLKANPDMTAKIEAAIRQNSGLIAEQIL---AGSPESDADGEE 359


>gi|115523612|ref|YP_780523.1| recombinase A [Rhodopseudomonas palustris BisA53]
 gi|115517559|gb|ABJ05543.1| RecA protein [Rhodopseudomonas palustris BisA53]
          Length = 362

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 245/349 (70%), Positives = 301/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + +E +S+GSLGLDIALG+GG PKGR+
Sbjct: 14  MDKSKALAAALSQIERQFGKGSVMRLGKNDRSMD-VETISTGSLGLDIALGVGGLPKGRV 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH  A++QK GG CAF+DAEHALD IYARKLGV++  LLISQPD 
Sbjct: 73  VEIYGPESSGKTTLALHCAAEAQKKGGICAFIDAEHALDPIYARKLGVNVDELLISQPDH 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 133 GEQALEIADTLVRSGAVDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 193 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGQIKERDEVVGNQ 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IVDKSGAWFS+  QRLGQG
Sbjct: 253 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVDKSGAWFSYDSQRLGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           RENSK FL+ N +I   IE+ +RQN+GL+A+ +L   A + + DAD ++
Sbjct: 313 RENSKTFLKGNPDITAKIEAAIRQNSGLIAEQIL---AGSPERDADGEE 358


>gi|90423078|ref|YP_531448.1| recombinase A [Rhodopseudomonas palustris BisB18]
 gi|90105092|gb|ABD87129.1| RecA protein [Rhodopseudomonas palustris BisB18]
          Length = 363

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 244/349 (69%), Positives = 301/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL AALSQI+R +GKG++M+LG      + IE +SSGSLGLDIALG+GG PKGR+
Sbjct: 15  MDKTKALAAALSQIERQFGKGSVMKLGKNDRSMD-IETISSGSLGLDIALGVGGLPKGRV 73

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH  A++QK GG CAF+DAEHALD +YARKLGV++  LLISQPD 
Sbjct: 74  VEIYGPESSGKTTLALHCAAEAQKKGGICAFIDAEHALDPVYARKLGVNVDELLISQPDH 133

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 134 GEQALEIADTLVRSGAVDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 193

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 194 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGQIKERDEVVGNQ 253

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IVDKSGAWFS+  QRLGQG
Sbjct: 254 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVDKSGAWFSYDSQRLGQG 313

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           RENSK FL+ N ++   IE+ +RQN+GL+A+ +L   A + + DAD ++
Sbjct: 314 RENSKAFLKANPDMTAKIEAAIRQNSGLIAEQIL---AGSPERDADGEE 359


>gi|83594151|ref|YP_427903.1| recombinase A [Rhodospirillum rubrum ATCC 11170]
 gi|123766962|sp|Q2RQH9|RECA_RHORT RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|83577065|gb|ABC23616.1| RecA protein [Rhodospirillum rubrum ATCC 11170]
          Length = 366

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 244/347 (70%), Positives = 300/347 (86%), Gaps = 2/347 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           + +DK KALEAA+ QI+R +GKG+IM+LG +GS+ + IE +S+GSLGLDIALGIGG P+G
Sbjct: 12  DTMDKQKALEAAVGQIERAFGKGSIMKLGQRGSVVD-IESISTGSLGLDIALGIGGLPRG 70

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RIVEIYGPESSGKTTLALH +A++QK GG CAFVDAEHA D +YARKLGV L +LL+SQP
Sbjct: 71  RIVEIYGPESSGKTTLALHVVAEAQKKGGQCAFVDAEHAFDPLYARKLGVSLDDLLVSQP 130

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           DTGEQALEI D LVRSGA+D++VIDSVAAL P+AE+EGDMG+S  G+QARLMSQALRKLT
Sbjct: 131 DTGEQALEIADTLVRSGAIDVLVIDSVAALVPKAELEGDMGDSHVGLQARLMSQALRKLT 190

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            ++SRS  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+G++KDK+ + G
Sbjct: 191 GTVSRSNTLIIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKDKEEVVG 250

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           NQTRVKVVKNK+A PFK VEFDIMYGEGIS  GE++DLGVKA+I++KSGAWFS+   R+G
Sbjct: 251 NQTRVKVVKNKVAPPFKVVEFDIMYGEGISKLGEMLDLGVKANIIEKSGAWFSYNSTRIG 310

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           QGREN+K FLR+N  +AE IE+ +R NAGL+A+ ++  P     DDA
Sbjct: 311 QGRENAKQFLRDNPAMAEEIENAVRANAGLIAEEMIGGPG-GEDDDA 356


>gi|62288901|sp|Q9XBC1|RECA_RHOPA RecName: Full=Protein RecA; AltName: Full=Recombinase A
          Length = 349

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 244/349 (69%), Positives = 302/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKAL AALSQI+R +GKG++M+LG      + IE +SSGSLGLDIALG+GG PKGRI
Sbjct: 1   MDKSKALSAALSQIERQFGKGSVMRLGKNDRSMD-IETISSGSLGLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GG CAFVDAEHALD +YARKLGV++ +LLISQPD 
Sbjct: 60  VEIYGPESSGKTTLALHCVAEAQKKGGICAFVDAEHALDPVYARKLGVNVDDLLISQPDH 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEIADTLVRSGAIDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 180 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGQIKERDEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IV+KSGAWFS   QRLGQG
Sbjct: 240 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVEKSGAWFSHDSQRLGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FL+ N ++   IE+ +RQN+GL+A+ +L   A + + DAD ++
Sbjct: 300 RENAKAFLKANPDMTAKIEAAIRQNSGLIAEQIL---AGSPESDADGEE 345


>gi|91976208|ref|YP_568867.1| recombinase A [Rhodopseudomonas palustris BisB5]
 gi|91682664|gb|ABE38966.1| RecA protein [Rhodopseudomonas palustris BisB5]
          Length = 363

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 242/349 (69%), Positives = 301/349 (86%), Gaps = 4/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL AALSQI+R +GKG++M+LG      + IE +SSGSLGLDIALG+GG PKGR+
Sbjct: 15  MDKTKALTAALSQIERQFGKGSVMRLGKNDRSMD-IETISSGSLGLDIALGVGGLPKGRV 73

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GG CAF+DAEHALD +YARKLGV++  LLISQPD 
Sbjct: 74  VEIYGPESSGKTTLALHCVAEAQKKGGICAFIDAEHALDPVYARKLGVNVDELLISQPDH 133

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++++DSVAAL PRAE+EG+MG++LPG+QARLMSQALRKLT+S
Sbjct: 134 GEQALEIADTLVRSGAIDVLIVDSVAALVPRAELEGEMGDALPGLQARLMSQALRKLTAS 193

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G IK++D + GNQ
Sbjct: 194 INKSNTMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGQIKERDEVVGNQ 253

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA IVDKSGAWFS   QRLGQG
Sbjct: 254 TRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIVDKSGAWFSHDSQRLGQG 313

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FL+ N ++   IE+ +RQN+GL+A+ +L   A + + DAD ++
Sbjct: 314 RENAKAFLKANPDLTAKIEASIRQNSGLIAEQIL---AGSPESDADGEE 359


>gi|83309721|ref|YP_419985.1| recombinase A [Magnetospirillum magneticum AMB-1]
 gi|123754202|sp|Q2W9P9|RECA_MAGSA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|82944562|dbj|BAE49426.1| RecA protein [Magnetospirillum magneticum AMB-1]
          Length = 359

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 243/339 (71%), Positives = 295/339 (87%), Gaps = 1/339 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           + +D+ KALEAA+SQI+R +GKG+IM+LG +  + E  EVVS+GSLGLD+ALGIGG P+G
Sbjct: 12  DTMDRQKALEAAVSQIERAFGKGSIMKLGGKDQVVE-TEVVSTGSLGLDVALGIGGVPRG 70

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RI+E+YGPESSGKTTLALH IA++QK GGTCAFVDAEHALD  YARKLGV+L  LLISQP
Sbjct: 71  RIIEVYGPESSGKTTLALHIIAEAQKKGGTCAFVDAEHALDPSYARKLGVNLDELLISQP 130

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           D GEQALEI D LVRSGAVD++V+DSVAAL PRAE+EG+MG++  G+ ARLMSQALRKLT
Sbjct: 131 DAGEQALEIADTLVRSGAVDVLVVDSVAALVPRAELEGEMGDNHMGLHARLMSQALRKLT 190

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            S+S+SK I++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR++IRRVG+IKD+D + G
Sbjct: 191 GSVSKSKTIVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMEIRRVGAIKDRDEVVG 250

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           NQTRVKVVKNK+A PFK V+FDIMYGEGIS  GELIDLGVKA++V+KSGAWFS+   R+G
Sbjct: 251 NQTRVKVVKNKLAPPFKVVDFDIMYGEGISKMGELIDLGVKANVVEKSGAWFSYNSTRIG 310

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           QGREN+K FLREN  +A  IE  +RQNAGL++++L   P
Sbjct: 311 QGRENAKTFLRENPAMAAEIEGAIRQNAGLISEALAGGP 349


>gi|207366362|emb|CAQ58076.1| recombinase A [Agrobacterium tumefaciens]
          Length = 308

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 242/307 (78%), Positives = 280/307 (91%), Gaps = 1/307 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI+R +GKG IM+LGS  ++ E +E VS+GSL LDIALGIGG PKGRI+EIYGPESSGKT
Sbjct: 1   QIERSFGKGXIMKLGSNENVVE-VETVSTGSLSLDIALGIGGLPKGRIIEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TLAL TIA++QK GG CAFVDAEHALD +YARKLGVDL+ LLISQPDTGEQALEITD LV
Sbjct: 60  TLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLQGLLISQPDTGEQALEITDTLV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS+SKC+++FIN
Sbjct: 120 RSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISKSKCMVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQTRVKVVKNKMA 
Sbjct: 180 QIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVVGNQTRVKVVKNKMAP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLGQGREN+K+FLR+N 
Sbjct: 240 PFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLGQGRENAKMFLRDNX 299

Query: 322 EIAENIE 328
           E A  IE
Sbjct: 300 ETANEIE 306


>gi|148260042|ref|YP_001234169.1| recA protein [Acidiphilium cryptum JF-5]
 gi|326403005|ref|YP_004283086.1| recombinase A [Acidiphilium multivorum AIU301]
 gi|189039588|sp|A5FXB8|RECA_ACICJ RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|146401723|gb|ABQ30250.1| recA protein [Acidiphilium cryptum JF-5]
 gi|325049866|dbj|BAJ80204.1| recombinase A [Acidiphilium multivorum AIU301]
          Length = 343

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 240/336 (71%), Positives = 299/336 (88%), Gaps = 1/336 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           ++K+KAL+AAL+QI+R +GKG+IM++GS+ S  E I+V+S+GSLGLD+ALGIGG P+GR+
Sbjct: 1   MEKNKALDAALAQIERAFGKGSIMRMGSR-SESEAIDVISTGSLGLDLALGIGGLPRGRV 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH +A++QK GGTCAFVDAEHALD IYARKLGVD+ NLLISQPDT
Sbjct: 60  IEIYGPESSGKTTLALHAVAEAQKRGGTCAFVDAEHALDPIYARKLGVDVDNLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG+S  G+ ARLMSQALRKLT S
Sbjct: 120 GEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDSHVGLHARLMSQALRKLTGS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRSK +++F+NQ+R+KIGVMFG+PETTTGGNALKFY+S+R+DIRR+GSIKD++ +TGNQ
Sbjct: 180 ISRSKTLVIFLNQIRLKIGVMFGNPETTTGGNALKFYASIRMDIRRIGSIKDREEVTGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PF+QVEFDIMYGEGIS  GEL+DLGVKA IV+KSGAWFS   QR+GQG
Sbjct: 240 TRVKVVKNKLAPPFRQVEFDIMYGEGISKVGELLDLGVKAGIVEKSGAWFSCDSQRIGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQE 345
           REN+K FLR+N ++A +IE  +R  A LV  +++ +
Sbjct: 300 RENAKQFLRDNPDVAASIEQRIRAQANLVEAAMITD 335


>gi|220925348|ref|YP_002500650.1| recA protein [Methylobacterium nodulans ORS 2060]
 gi|254790438|sp|B8IP29|RECA_METNO RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|219949955|gb|ACL60347.1| recA protein [Methylobacterium nodulans ORS 2060]
          Length = 363

 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/346 (73%), Positives = 305/346 (88%), Gaps = 2/346 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKA++AAL+QI+R +GKG+IM+LG +G   + +E +S+GSLGLDIALG+GG P+GR++
Sbjct: 17  DKSKAIDAALAQIERAFGKGSIMRLG-KGDKVQEVETISTGSLGLDIALGVGGLPRGRVI 75

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGV+L +LLISQPDTG
Sbjct: 76  EIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPDTG 135

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+  PG+QARLMSQALRKLT SI
Sbjct: 136 EQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDQQPGLQARLMSQALRKLTGSI 195

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRRV ++KD+D   GN  
Sbjct: 196 SRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRVSTLKDRDEPIGNSV 255

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIM+GEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQGR
Sbjct: 256 RVKVVKNKVAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYDSQRLGQGR 315

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK 356
           EN+K FLR+N +IA  IE+ +RQN GLVAD +L E A+ T +D D+
Sbjct: 316 ENAKGFLRDNPDIAGRIEAAIRQNMGLVADKIL-ENAVPTAEDYDE 360


>gi|114328048|ref|YP_745205.1| recombinase A [Granulibacter bethesdensis CGDNIH1]
 gi|84620800|gb|ABC59514.1| RecA [Granulibacter bethesdensis CGDNIH1]
 gi|114316222|gb|ABI62282.1| recA protein [Granulibacter bethesdensis CGDNIH1]
          Length = 351

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 242/350 (69%), Positives = 304/350 (86%), Gaps = 7/350 (2%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           ++K+KAL+AAL+QI+R +GKG+IM++G++ ++ E IEV+ SGSLGLD+ALGIGG P+GRI
Sbjct: 7   MEKNKALDAALAQIERSFGKGSIMRMGAR-NVAEQIEVIPSGSLGLDLALGIGGMPRGRI 65

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHT+A++QK GGTCAFVDAEHALD IYARKLGVD+ NLLISQPD 
Sbjct: 66  VEIYGPESSGKTTLALHTVAEAQKRGGTCAFVDAEHALDPIYARKLGVDVDNLLISQPDA 125

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG+S  G+ ARLMSQALRKLT S
Sbjct: 126 GEQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDSHVGLHARLMSQALRKLTGS 185

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ++RS   L+F+NQ+RMKIGVMFGSPETTTGGNALKFY+SVR DIRR+G +KDK+ + GNQ
Sbjct: 186 VNRSNTTLIFLNQIRMKIGVMFGSPETTTGGNALKFYASVRFDIRRIGQLKDKEEVIGNQ 245

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PF+QVEFDI+YGEGIS  GELIDLGVKA++V+KSGAW+S+  QR+GQG
Sbjct: 246 TRVKVVKNKLAPPFRQVEFDIIYGEGISKVGELIDLGVKANVVEKSGAWYSYDSQRIGQG 305

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDT 359
           REN+K FLR++ EIA  IE+ +R+ +G V ++++  P      DA++ +T
Sbjct: 306 RENAKQFLRDHPEIANAIENRIREQSGTVQNAMITTP------DAEEAET 349


>gi|300023634|ref|YP_003756245.1| recA protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525455|gb|ADJ23924.1| recA protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 377

 Score =  511 bits (1315), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 241/337 (71%), Positives = 293/337 (86%), Gaps = 2/337 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK +ALE AL QI + +GKG+IM+LG+   +   IE + +GSLGLDIALGIGG PKGRI
Sbjct: 14  MDKKQALEHALQQIDKNFGKGSIMRLGANDKV--DIEAIPTGSLGLDIALGIGGLPKGRI 71

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH +A++QK GG CAF+DAEHA+D  YA+KLGV +++LLISQPDT
Sbjct: 72  IEIYGPESSGKTTLALHVVAEAQKRGGICAFIDAEHAIDPGYAKKLGVKIEDLLISQPDT 131

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAALTP+AE+EG+MG+SLPG+QARLMSQALRKLT S
Sbjct: 132 GEQALEIADTLVRSGAVDVLVVDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTGS 191

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+SKC++VFINQ+RMKIG+MFG+PETTTGGNALKFY+SVRLDIRR+G IK+++   GNQ
Sbjct: 192 ISKSKCMVVFINQIRMKIGIMFGNPETTTGGNALKFYASVRLDIRRIGQIKEREETVGNQ 251

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GELIDLGVKA IV+KSGAW S+ G R+GQG
Sbjct: 252 TRVKVVKNKVAPPFKQVEFDIMYGEGISKVGELIDLGVKAGIVEKSGAWMSYNGDRIGQG 311

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           REN+K +L+EN +IA  IE+ +R NAGL+ + +L  P
Sbjct: 312 RENAKTYLKENPKIAAEIENSIRANAGLIVEKMLVNP 348


>gi|241762016|ref|ZP_04760100.1| recA protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|283856414|ref|YP_162901.2| recombinase A [Zymomonas mobilis subsp. mobilis ZM4]
 gi|292495071|sp|Q9X5D8|RECA_ZYMMO RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|241373482|gb|EER63069.1| recA protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|283775414|gb|AAV89790.2| recA protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 354

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/341 (71%), Positives = 295/341 (86%), Gaps = 3/341 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           N +DK KALEAAL+QI R +GKG++M+LGS+  I   I+ +SSGSLGLDIALGIGG P+G
Sbjct: 14  NNMDKQKALEAALAQIDRAFGKGSVMRLGSREKI--EIDTISSGSLGLDIALGIGGLPRG 71

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RIVEIYGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGV+  +L++SQP
Sbjct: 72  RIVEIYGPESSGKTTLALHAIAEAQKAGGTAAFVDAEHALDPVYAKKLGVNTDDLIVSQP 131

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           DTGEQALEITD L+RS AVDI+V+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T
Sbjct: 132 DTGEQALEITDTLIRSNAVDILVVDSVAALTPRAEIEGEMGDSHVGLQARLMSQALRKIT 191

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            SI+RS+ +++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRRVG IKD+D I G
Sbjct: 192 GSINRSQTLVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRVGQIKDRDEIVG 251

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           N TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA I+DKSG+WFS    R+G
Sbjct: 252 NATRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIIDKSGSWFSHDSVRIG 311

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAI 348
           QGREN+K FLRE+ E+ E IE ++R N   +AD +L +P+I
Sbjct: 312 QGRENAKTFLREHPEMTEKIEKMIRHNTAEIADEML-DPSI 351


>gi|170738641|ref|YP_001767296.1| recA protein [Methylobacterium sp. 4-46]
 gi|238688062|sp|B0UGP0|RECA_METS4 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|168192915|gb|ACA14862.1| recA protein [Methylobacterium sp. 4-46]
          Length = 363

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 253/346 (73%), Positives = 305/346 (88%), Gaps = 2/346 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKA++AAL+QI+R +GKG+IM+LG +G   + +E +S+GSLGLD+ALG+GG P+GR++
Sbjct: 17  DKSKAIDAALAQIERAFGKGSIMRLG-KGDKVQEVETISTGSLGLDVALGVGGLPRGRVI 75

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGV+L +LLISQPDTG
Sbjct: 76  EIYGPESSGKTTLALHTIAEAQKKGGVCAFVDAEHALDPVYARKLGVNLDDLLISQPDTG 135

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+  PG+QARLMSQALRKLT SI
Sbjct: 136 EQALEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDQQPGLQARLMSQALRKLTGSI 195

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRRV ++KD+D   GN  
Sbjct: 196 SRSNCMVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRVSTLKDRDEPIGNSV 255

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIM+GEG+S  GELIDLGVKA IV+KSGAWFS+  QRLGQGR
Sbjct: 256 RVKVVKNKVAPPFKQVEFDIMFGEGVSKVGELIDLGVKAGIVEKSGAWFSYDSQRLGQGR 315

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK 356
           EN+K FLR+N +IA  IE+ +RQN GLVAD +L E A+ T +D D+
Sbjct: 316 ENAKGFLRDNPDIAGRIEAAIRQNMGLVADKIL-ENAVPTAEDFDE 360


>gi|46200836|ref|ZP_00056375.2| COG0468: RecA/RadA recombinase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 351

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 242/339 (71%), Positives = 294/339 (86%), Gaps = 1/339 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           + +D+ KALEAA+SQI+R +GKG+IM+LG +  + E  EVVS+GSLGLD+ALGIGG P+G
Sbjct: 4   DTMDRQKALEAAVSQIERAFGKGSIMKLGGKDQVVE-TEVVSTGSLGLDVALGIGGVPRG 62

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RI+E+YGPESSGKTTLALH IA++QK GGTCAFVDAEHALD  YARKLGV L  LLISQP
Sbjct: 63  RIIEVYGPESSGKTTLALHIIAEAQKKGGTCAFVDAEHALDPSYARKLGVALDELLISQP 122

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           D GEQALEI D LVRSGAVD++V+DSVAAL PRAE+EG+MG++  G+ ARLMSQALRKLT
Sbjct: 123 DAGEQALEIADTLVRSGAVDVLVVDSVAALVPRAELEGEMGDNHMGLHARLMSQALRKLT 182

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            S+S+SK I++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR++IRRVG+IKD+D + G
Sbjct: 183 GSVSKSKTIVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMEIRRVGAIKDRDEVVG 242

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           NQTRVKVVKNK+A PFK V+FDIMYGEGIS  GELIDLGVKA++V+KSGAWFS+   R+G
Sbjct: 243 NQTRVKVVKNKLAPPFKVVDFDIMYGEGISKMGELIDLGVKANVVEKSGAWFSYNSTRIG 302

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           QGREN+K FLR+N  +A  IE  +RQNAGL++++L   P
Sbjct: 303 QGRENAKQFLRDNPAMAAEIEGAIRQNAGLISEALAAGP 341


>gi|144900462|emb|CAM77326.1| RecA bacterial DNA recombination protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 358

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 242/339 (71%), Positives = 296/339 (87%), Gaps = 2/339 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           + +D+ KALEAA+SQI+R +GKG+IM++G + ++    EVVS+GSLGLDIALGIGG P+G
Sbjct: 12  DTMDRQKALEAAVSQIERAFGKGSIMKMGQKETVE--TEVVSTGSLGLDIALGIGGLPRG 69

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RI+EIYGPESSGKTTLALH +A++QK GGTCAF+DAEHALD  YARKLGV+L +LLISQP
Sbjct: 70  RIIEIYGPESSGKTTLALHVLAEAQKKGGTCAFIDAEHALDPSYARKLGVNLDDLLISQP 129

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           D GEQALEI D LVRSGAVD++V+DSVAAL PRAE+EG+MG+S  G+ ARLMSQALRKLT
Sbjct: 130 DAGEQALEICDTLVRSGAVDVLVVDSVAALVPRAELEGEMGDSHVGLHARLMSQALRKLT 189

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            S+S+SK I++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR++IRRVG+IKD+D + G
Sbjct: 190 GSVSKSKTIVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMEIRRVGAIKDRDEVVG 249

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           NQTRVKVVKNK+A PFK V+FDIMYGEGIS  GELIDLGVKA++V+KSGAWFS+   R+G
Sbjct: 250 NQTRVKVVKNKLAPPFKVVDFDIMYGEGISKTGELIDLGVKANVVEKSGAWFSYNSTRVG 309

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           QGREN+K FLR+N  +A  IE+ +R NAGLVA++L   P
Sbjct: 310 QGRENAKQFLRDNPAMAGEIEATIRANAGLVAEALAAGP 348


>gi|254464079|ref|ZP_05077490.1| protein RecA [Rhodobacterales bacterium Y4I]
 gi|206684987|gb|EDZ45469.1| protein RecA [Rhodobacterales bacterium Y4I]
          Length = 355

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/343 (72%), Positives = 292/343 (85%), Gaps = 5/343 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG  G+  + IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 14  DKQKALDSALAQIERQFGKGSIMKLGD-GTALQEIEASSTGSLGLDIALGIGGLPMGRIV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA KLGVDL  LLISQPDTG
Sbjct: 73  EIYGPESSGKTTLTLHCIAEQQKKGGVCAFVDAEHALDPQYAAKLGVDLDELLISQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 133 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSSVGVQARLMSQAMRKLTGSI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRSKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIKD+D + GN T
Sbjct: 193 SRSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIKDRDEVVGNST 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV A +V+KSGAWFS+  +R+GQGR
Sbjct: 253 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVAAGVVNKSGAWFSYGDERIGQGR 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           EN+K+FLREN  IA +IE  +R + GL      Q P +++ DD
Sbjct: 313 ENAKVFLRENPSIAYDIEDKIRASHGLD----FQRPDLDSADD 351


>gi|58039956|ref|YP_191920.1| recombinase A [Gluconobacter oxydans 621H]
 gi|61252238|sp|P48289|RECA_GLUOX RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|58002370|gb|AAW61264.1| RecA protein [Gluconobacter oxydans 621H]
          Length = 345

 Score =  508 bits (1307), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/351 (69%), Positives = 298/351 (84%), Gaps = 6/351 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALE ALSQI+R +GKG+IM++G +  +     V+S+GS+GLDIALGIGG P+GRI
Sbjct: 1   MDKTKALEGALSQIERAFGKGSIMRMGQRPKV--ETNVISTGSIGLDIALGIGGMPRGRI 58

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GGT AF+DAEHALD  YARKLGV++ +LL+SQPD 
Sbjct: 59  VEIYGPESSGKTTLALHVLAEAQKKGGTVAFIDAEHALDPGYARKLGVNIDDLLLSQPDA 118

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAAL PRAE+EGDMG+S  G+ ARLMSQALRKLT +
Sbjct: 119 GEQALEIADTLVRSGAVDVLVVDSVAALVPRAELEGDMGDSHVGLHARLMSQALRKLTGT 178

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +SRS  +++F+NQ+RMKIGVMFG+PETTTGGNALKFYSS+RLDIRR+GSIKDKD + GNQ
Sbjct: 179 VSRSNTLVIFLNQIRMKIGVMFGNPETTTGGNALKFYSSIRLDIRRIGSIKDKDEVVGNQ 238

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDIMYGEGIS  GEL+DLGVK +IV+KSGAWFSF  QR+GQG
Sbjct: 239 TRVKVVKNKMAPPFRQVEFDIMYGEGISKMGELLDLGVKGNIVEKSGAWFSFDSQRIGQG 298

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360
           REN+K FLRE+ E+A  IE  +R  AG+++D+L+ +P    + DAD    D
Sbjct: 299 RENAKQFLREHPEMASEIERRIRAEAGVLSDALMTDP----EPDADGTPED 345


>gi|110679928|ref|YP_682935.1| recombinase A [Roseobacter denitrificans OCh 114]
 gi|109456044|gb|ABG32249.1| RecA protein [Roseobacter denitrificans OCh 114]
          Length = 359

 Score =  507 bits (1306), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/345 (70%), Positives = 294/345 (85%), Gaps = 5/345 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG++G++ + I+  S+GSLGLDIALGIGG P GRIV
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGAEGAV-QDIQASSTGSLGLDIALGIGGLPMGRIV 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGVDL  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHCVAEQQKAGGVCAFVDAEHALDPTYAKKLGVDLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 135 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSSVGVQARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D + GN T
Sbjct: 195 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALKDRDEVVGNHT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PFKQVEFDIMYGEGIS  GEL+DLGV A +VDKSG+WFS+  +R+GQGR
Sbjct: 255 RVKVVKNKVAAPFKQVEFDIMYGEGISKMGELLDLGVAAGVVDKSGSWFSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           EN+K FLREN+++A  IE  +R   GL  D     PA   K D D
Sbjct: 315 ENAKGFLRENVQMALEIEDKIRAAHGLDFDM----PAHEKKADDD 355


>gi|109254803|emb|CAK22263.1| recombinase A [Ochrobactrum oryzae]
 gi|148897703|emb|CAM18505.1| recombinase A [Ochrobactrum oryzae]
          Length = 299

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 240/300 (80%), Positives = 275/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKRGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GELIDLGVKA +V+KSGAWFS+  QRLGQGREN+K F
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKTGELIDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQF 299


>gi|260752406|ref|YP_003225299.1| recombinase A [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258551769|gb|ACV74715.1| recA protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 354

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 294/341 (86%), Gaps = 3/341 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           N +DK KALEAAL+QI R +GKG++M+LGS+  I   I+ +SSGSLGLDIALGIGG P+G
Sbjct: 14  NNMDKQKALEAALAQIDRAFGKGSVMRLGSREKI--EIDTISSGSLGLDIALGIGGLPRG 71

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RIVEIYG ESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGV+  +L++SQP
Sbjct: 72  RIVEIYGHESSGKTTLALHAIAEAQKAGGTAAFVDAEHALDPVYAKKLGVNTDDLIVSQP 131

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           DTGEQALEITD L+RS AVDI+V+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T
Sbjct: 132 DTGEQALEITDTLIRSNAVDILVVDSVAALTPRAEIEGEMGDSHVGLQARLMSQALRKIT 191

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            SI+RS+ +++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRRVG IKD+D I G
Sbjct: 192 GSINRSQTLVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRVGQIKDRDEIVG 251

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           N TRVKVVKNK+A PFKQVEFDIMYGEG+S  GE++DLGVKA I+DKSG+WFS    R+G
Sbjct: 252 NATRVKVVKNKLAPPFKQVEFDIMYGEGVSKMGEILDLGVKAGIIDKSGSWFSHDSVRIG 311

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAI 348
           QGREN+K FLRE+ E+ E IE ++R N   +AD +L +P+I
Sbjct: 312 QGRENAKTFLREHPEMTEKIEKMIRHNTAEIADEML-DPSI 351


>gi|148553436|ref|YP_001261018.1| recombinase A [Sphingomonas wittichii RW1]
 gi|148498626|gb|ABQ66880.1| recA protein [Sphingomonas wittichii RW1]
          Length = 357

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/343 (69%), Positives = 296/343 (86%), Gaps = 2/343 (0%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           +E   +D+ KALEAAL+QI R +GKG+ M+LGS+ ++   +E +S+GSLGLDIALGIGG 
Sbjct: 12  REAANMDRQKALEAALAQIDRAFGKGSAMKLGSRETM--QVEAISTGSLGLDIALGIGGL 69

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           PKGR+VE++GPESSGKTTLALH IA++QK GGT AF+DAEHALD +YA+KLGV++  L++
Sbjct: 70  PKGRVVEVFGPESSGKTTLALHAIAEAQKVGGTAAFIDAEHALDPVYAKKLGVNIDELIV 129

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPDTGEQALEI D LVRS A+D++VIDSVAAL PRAEIEG+MG+S  G+QARLMSQALR
Sbjct: 130 SQPDTGEQALEIADTLVRSNAIDVLVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALR 189

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           K+T SISRSKC+++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR G+IKD+D 
Sbjct: 190 KITGSISRSKCLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRTGAIKDRDE 249

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           + GN TRVKVVKNK+A PFKQVEFDIMYGEG+S  GEL+DLGVKA +V+KSGAWFS+   
Sbjct: 250 VVGNATRVKVVKNKVAPPFKQVEFDIMYGEGVSKVGELLDLGVKAGLVEKSGAWFSYDSI 309

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPA 347
           R+GQGRENSK++LREN E+A  +E+ +R NA  V ++++  P+
Sbjct: 310 RIGQGRENSKVYLRENPEVAAKLEAAIRGNADGVGEAMMAGPS 352


>gi|126729802|ref|ZP_01745615.1| recombinase A [Sagittula stellata E-37]
 gi|126709921|gb|EBA08974.1| recombinase A [Sagittula stellata E-37]
          Length = 349

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/327 (74%), Positives = 285/327 (87%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG + +I + IE  S+GSLGLDIALGIGG PKGRI+
Sbjct: 8   DKQKALDSALAQIERQFGKGSIMKLGGENAI-KDIEATSTGSLGLDIALGIGGLPKGRII 66

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YARKLGVDL  LLISQPDTG
Sbjct: 67  EIYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYARKLGVDLDELLISQPDTG 126

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV ++V+DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT+SI
Sbjct: 127 EQALEITDTLVRSGAVSLVVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTASI 186

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GNQT
Sbjct: 187 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNQT 246

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSGAWFS+  +R+GQGR
Sbjct: 247 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVKAGVVDKSGAWFSYGDERIGQGR 306

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +LREN  +A  IE  +R   GL
Sbjct: 307 ENAKNYLRENSRVALEIEDKIRAAHGL 333


>gi|212726671|gb|AAM50050.2| recombinase A [Zymomonas mobilis subsp. mobilis]
          Length = 354

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 294/341 (86%), Gaps = 3/341 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           N +DK KALEAAL+QI R +GKG++M+LGS+  I   I+ +SSGSLGLDIALGIGG P+G
Sbjct: 14  NNMDKQKALEAALAQIDRAFGKGSVMRLGSREKI--EIDTISSGSLGLDIALGIGGLPRG 71

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           RIVEIYGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGV+  +L++SQP
Sbjct: 72  RIVEIYGPESSGKTTLALHAIAEAQKAGGTAAFVDAEHALDPVYAKKLGVNTDDLIVSQP 131

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           DTGEQALEITD L+RS AVDI+V+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T
Sbjct: 132 DTGEQALEITDTLIRSNAVDILVVDSVAALTPRAEIEGEMGDSHVGLQARLMSQALRKIT 191

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            SI+RS+ +++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRRVG IKD+D I G
Sbjct: 192 GSINRSQTLVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRVGQIKDRDEIVG 251

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           N TRVKVVKNK+A  FKQVEFDIMYGEG+S  GE++DLGVKA I+DKSG+WFS    R+G
Sbjct: 252 NATRVKVVKNKLAPRFKQVEFDIMYGEGVSKMGEILDLGVKAGIIDKSGSWFSHDSVRIG 311

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAI 348
           QGREN+K FLRE+ E+ E IE ++R N   +AD +L +P+I
Sbjct: 312 QGRENAKTFLREHPEMTEKIEKMIRHNTAEIADEML-DPSI 351


>gi|254461098|ref|ZP_05074514.1| protein RecA [Rhodobacterales bacterium HTCC2083]
 gi|206677687|gb|EDZ42174.1| protein RecA [Rhodobacteraceae bacterium HTCC2083]
          Length = 351

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/345 (71%), Positives = 290/345 (84%), Gaps = 5/345 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG + ++ + IE  S+GSLGLDIALGIGG PKGRIV
Sbjct: 8   DKQKALDSALAQIERQFGKGSIMKLGDENAV-QQIEATSTGSLGLDIALGIGGLPKGRIV 66

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LHT+A+ QK GG CAFVDAEHALD  YA+KLGVDL  LLISQPDTG
Sbjct: 67  EIYGPESSGKTTLTLHTVAEEQKKGGVCAFVDAEHALDPQYAKKLGVDLDELLISQPDTG 126

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV++IV+DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT SI
Sbjct: 127 EQALEIVDTLVRSGAVNMIVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSI 186

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D + GN T
Sbjct: 187 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALKDRDEVVGNAT 246

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA IVDKSG+WFS+  +R+GQGR
Sbjct: 247 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVKAGIVDKSGSWFSYGDERIGQGR 306

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           EN+K FL+EN  I+  IE  +R   GL  D     P    KDD D
Sbjct: 307 ENAKTFLKENTRISYEIEDKIRAAHGLDFDM----PKEEQKDDDD 347


>gi|4768851|gb|AAD29645.1|AF124757_5 RecA protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 339

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 242/339 (71%), Positives = 293/339 (86%), Gaps = 3/339 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KALEAAL+QI R +GKG++M+LGS+  I   I+ +SSGSLGLDIALGIGG P+GRI
Sbjct: 1   MDKQKALEAALAQIDRAFGKGSVMRLGSREKI--EIDTISSGSLGLDIALGIGGLPRGRI 58

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGV+  +L++SQPDT
Sbjct: 59  VEIYGPESSGKTTLALHAIAEAQKAGGTAAFVDAEHALDPVYAKKLGVNTDDLIVSQPDT 118

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD L+RS AVDI+V+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T S
Sbjct: 119 GEQALEITDTLIRSNAVDILVVDSVAALTPRAEIEGEMGDSHVGLQARLMSQALRKITGS 178

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I+RS+ +++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRRVG IKD+D I GN 
Sbjct: 179 INRSQTLVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRVGQIKDRDEIVGNA 238

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+  PFKQVEFDIMYGEG+S  GE++DLGVKA I+DKSG+WFS    R+GQG
Sbjct: 239 TRVKVVKNKLLRPFKQVEFDIMYGEGVSKMGEILDLGVKAGIIDKSGSWFSHDSVRIGQG 298

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAI 348
           REN+K FLRE+ E+ E IE ++R N   +AD +L +P+I
Sbjct: 299 RENAKTFLREHPEMTEKIEKMIRHNTAEIADEML-DPSI 336


>gi|146424893|emb|CAM12555.1| recombinase A [Ochrobactrum anthropi]
 gi|146424973|emb|CAM12595.1| recombinase A [Ochrobactrum anthropi]
 gi|148887245|emb|CAM12789.1| recombinase A [Ochrobactrum intermedium]
 gi|148897667|emb|CAM18487.1| recombinase A [Ochrobactrum intermedium]
 gi|148897669|emb|CAM18488.1| recombinase A [Ochrobactrum intermedium]
 gi|148897671|emb|CAM18489.1| recombinase A [Ochrobactrum intermedium]
 gi|148897673|emb|CAM18490.1| recombinase A [Ochrobactrum intermedium]
 gi|148897675|emb|CAM18491.1| recombinase A [Ochrobactrum intermedium]
 gi|148897677|emb|CAM18492.1| recombinase A [Ochrobactrum intermedium]
 gi|148897681|emb|CAM18494.1| recombinase A [Ochrobactrum intermedium]
 gi|148897683|emb|CAM18495.1| recombinase A [Ochrobactrum intermedium]
 gi|148897685|emb|CAM18496.1| recombinase A [Ochrobactrum intermedium]
 gi|148897687|emb|CAM18497.1| recombinase A [Ochrobactrum intermedium]
 gi|148897689|emb|CAM18498.1| recombinase A [Ochrobactrum intermedium]
 gi|148897691|emb|CAM18499.1| recombinase A [Ochrobactrum intermedium]
 gi|148897693|emb|CAM18500.1| recombinase A [Ochrobactrum intermedium]
          Length = 299

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/300 (79%), Positives = 275/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|148887229|emb|CAM12781.1| recombinase A [Ochrobactrum anthropi]
          Length = 299

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/300 (79%), Positives = 274/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG      E IE VS+GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGQNDHSIE-IETVSTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++VIDSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVIDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKMGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|112362894|emb|CAL34148.1| recombinase A [Brucella microti CCM 4915]
 gi|112362896|emb|CAL34149.1| recombinase A [Brucella microti]
          Length = 299

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/300 (79%), Positives = 274/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTGSISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKVGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|148887237|emb|CAM12785.1| recombinase A [Ochrobactrum sp. TK 14]
          Length = 299

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/300 (79%), Positives = 275/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRIV+IYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRIVKIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++VIDSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVIDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKMGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|146424877|emb|CAM12547.1| recombinase A [Ochrobactrum anthropi]
 gi|146424881|emb|CAM12549.1| recombinase A [Ochrobactrum anthropi]
 gi|146424883|emb|CAM12550.1| recombinase A [Ochrobactrum anthropi]
 gi|146424885|emb|CAM12551.1| recombinase A [Ochrobactrum anthropi]
 gi|146424887|emb|CAM12552.1| recombinase A [Ochrobactrum anthropi]
 gi|146424889|emb|CAM12553.1| recombinase A [Ochrobactrum anthropi]
 gi|146424891|emb|CAM12554.1| recombinase A [Ochrobactrum anthropi]
 gi|146424895|emb|CAM12556.1| recombinase A [Ochrobactrum anthropi]
 gi|146424897|emb|CAM12557.1| recombinase A [Ochrobactrum anthropi]
 gi|146424899|emb|CAM12558.1| recombinase A [Ochrobactrum anthropi]
 gi|146424901|emb|CAM12559.1| recombinase A [Ochrobactrum anthropi]
 gi|146424903|emb|CAM12560.1| recombinase A [Ochrobactrum anthropi]
 gi|146424905|emb|CAM12561.1| recombinase A [Ochrobactrum anthropi]
 gi|146424907|emb|CAM12562.1| recombinase A [Ochrobactrum anthropi]
 gi|146424909|emb|CAM12563.1| recombinase A [Ochrobactrum anthropi]
 gi|146424911|emb|CAM12564.1| recombinase A [Ochrobactrum anthropi]
 gi|146424913|emb|CAM12565.1| recombinase A [Ochrobactrum anthropi]
 gi|146424915|emb|CAM12566.1| recombinase A [Ochrobactrum anthropi]
 gi|146424917|emb|CAM12567.1| recombinase A [Ochrobactrum anthropi]
 gi|146424919|emb|CAM12568.1| recombinase A [Ochrobactrum anthropi]
 gi|146424921|emb|CAM12569.1| recombinase A [Ochrobactrum anthropi]
 gi|146424923|emb|CAM12570.1| recombinase A [Ochrobactrum anthropi]
 gi|146424925|emb|CAM12571.1| recombinase A [Ochrobactrum anthropi]
 gi|146424927|emb|CAM12572.1| recombinase A [Ochrobactrum anthropi]
 gi|146424929|emb|CAM12573.1| recombinase A [Ochrobactrum anthropi]
 gi|146424931|emb|CAM12574.1| recombinase A [Ochrobactrum anthropi]
 gi|146424933|emb|CAM12575.1| recombinase A [Ochrobactrum anthropi]
 gi|146424935|emb|CAM12576.1| recombinase A [Ochrobactrum anthropi]
 gi|146424937|emb|CAM12577.1| recombinase A [Ochrobactrum anthropi]
 gi|146424939|emb|CAM12578.1| recombinase A [Ochrobactrum anthropi]
 gi|146424941|emb|CAM12579.1| recombinase A [Ochrobactrum anthropi]
 gi|146424943|emb|CAM12580.1| recombinase A [Ochrobactrum anthropi]
 gi|146424945|emb|CAM12581.1| recombinase A [Ochrobactrum anthropi]
 gi|146424947|emb|CAM12582.1| recombinase A [Ochrobactrum anthropi]
 gi|146424949|emb|CAM12583.1| recombinase A [Ochrobactrum anthropi]
 gi|146424951|emb|CAM12584.1| recombinase A [Ochrobactrum anthropi]
 gi|146424953|emb|CAM12585.1| recombinase A [Ochrobactrum anthropi]
 gi|146424955|emb|CAM12586.1| recombinase A [Ochrobactrum anthropi]
 gi|146424957|emb|CAM12587.1| recombinase A [Ochrobactrum anthropi]
 gi|146424959|emb|CAM12588.1| recombinase A [Ochrobactrum anthropi]
 gi|146424961|emb|CAM12589.1| recombinase A [Ochrobactrum anthropi]
 gi|146424963|emb|CAM12590.1| recombinase A [Ochrobactrum anthropi]
 gi|146424965|emb|CAM12591.1| recombinase A [Ochrobactrum anthropi]
 gi|146424967|emb|CAM12592.1| recombinase A [Ochrobactrum anthropi]
 gi|146424969|emb|CAM12593.1| recombinase A [Ochrobactrum anthropi]
 gi|146424971|emb|CAM12594.1| recombinase A [Ochrobactrum anthropi]
 gi|146424977|emb|CAM12597.1| recombinase A [Ochrobactrum anthropi]
 gi|146424979|emb|CAM12598.1| recombinase A [Ochrobactrum anthropi]
 gi|146424981|emb|CAM12599.1| recombinase A [Ochrobactrum anthropi]
 gi|146424983|emb|CAM12600.1| recombinase A [Ochrobactrum anthropi]
 gi|148887235|emb|CAM12784.1| recombinase A [Ochrobactrum anthropi]
 gi|148887247|emb|CAM12790.1| recombinase A [Ochrobactrum anthropi]
 gi|148897665|emb|CAM18486.1| recombinase A [Ochrobactrum intermedium]
 gi|148897695|emb|CAM18501.1| recombinase A [Ochrobactrum lupini]
 gi|148897697|emb|CAM18502.1| recombinase A [Ochrobactrum tritici]
 gi|148897699|emb|CAM18503.1| recombinase A [Ochrobactrum tritici]
 gi|148897701|emb|CAM18504.1| recombinase A [Ochrobactrum tritici]
 gi|148897711|emb|CAM18509.1| recombinase A [Ochrobactrum anthropi]
          Length = 299

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/300 (79%), Positives = 274/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|56696903|ref|YP_167265.1| recombinase A [Ruegeria pomeroyi DSS-3]
 gi|76363341|sp|Q5LRU0|RECA_SILPO RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|56678640|gb|AAV95306.1| RecA [Ruegeria pomeroyi DSS-3]
          Length = 347

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/330 (74%), Positives = 285/330 (86%), Gaps = 1/330 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG + +I E IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 8   DKQKALDSALAQIERQFGKGSIMRLGGENAIQE-IEASSTGSLGLDIALGIGGLPMGRIV 66

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YARKLGVDL  LLISQPDTG
Sbjct: 67  EIYGPESSGKTTLTLHCIAEQQKRGGVCAFVDAEHALDPQYARKLGVDLDELLISQPDTG 126

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++V+DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT SI
Sbjct: 127 EQALEITDTLVRSGAVNMVVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSI 186

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRSKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GN T
Sbjct: 187 SRSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNAT 246

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSG+WFS+  +R+GQGR
Sbjct: 247 RVKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVDKSGSWFSYGDERIGQGR 306

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
           EN+K FLREN  IA  IE  +R   GL  D
Sbjct: 307 ENAKTFLRENQSIALAIEDKIRAAHGLEFD 336


>gi|83955443|ref|ZP_00964074.1| recombinase A [Sulfitobacter sp. NAS-14.1]
 gi|83840087|gb|EAP79262.1| recombinase A [Sulfitobacter sp. NAS-14.1]
          Length = 348

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 246/363 (67%), Positives = 301/363 (82%), Gaps = 16/363 (4%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K+    +K KAL++AL+QI+R +GKG+IM+LG++G+I + I+  S+GSLGLDIALG
Sbjct: 1   MDNKKQ---AEKQKALDSALAQIERQFGKGSIMKLGAEGAI-QDIKASSTGSLGLDIALG 56

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG P GRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YARKLGVD+ 
Sbjct: 57  IGGLPMGRIIEIYGPESSGKTTLTLHCVAEQQKNGGVCAFVDAEHALDPQYARKLGVDID 116

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEITD LVRSGAV+++V+DSVAALTP++E+EGDMG+S  G+QARLMS
Sbjct: 117 ELLISQPDTGEQALEITDTLVRSGAVNMVVVDSVAALTPKSELEGDMGDSSVGVQARLMS 176

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++K
Sbjct: 177 QAMRKLTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALK 236

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D + GN TRVK+VKNK+A+PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSG+WFS
Sbjct: 237 DRDEVVGNATRVKIVKNKVAAPFKQVEFDIMYGEGISKMGELLDLGVKAGVVDKSGSWFS 296

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360
           +  +R+GQGREN+K FL+EN  +A +IE  +R   GL  D             +D DD D
Sbjct: 297 YGDERIGQGRENAKTFLKENTAMANDIEDKIRAAHGLDFDG------------SDSDDAD 344

Query: 361 NVE 363
            +E
Sbjct: 345 ILE 347


>gi|83944500|ref|ZP_00956953.1| recombinase A [Sulfitobacter sp. EE-36]
 gi|83844702|gb|EAP82586.1| recombinase A [Sulfitobacter sp. EE-36]
          Length = 356

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 246/363 (67%), Positives = 300/363 (82%), Gaps = 16/363 (4%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K+    +K KAL++AL+QI+R +GKG+IM+LG++G+I + I+  S+GSLGLDIALG
Sbjct: 9   MDNKKQ---AEKQKALDSALAQIERQFGKGSIMKLGAEGAI-QDIKASSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG P GRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YARKLGVD+ 
Sbjct: 65  IGGLPMGRIIEIYGPESSGKTTLTLHCVAEQQKNGGVCAFVDAEHALDPQYARKLGVDID 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEITD LVRSGAV+++V+DSVAALTP++E+EGDMG+S  G+QARLMS
Sbjct: 125 ELLISQPDTGEQALEITDTLVRSGAVNMVVVDSVAALTPKSELEGDMGDSSVGVQARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++K
Sbjct: 185 QAMRKLTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D + GN TRVK+VKNK+A+PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSG+WFS
Sbjct: 245 DRDEVVGNATRVKIVKNKVAAPFKQVEFDIMYGEGISKMGELLDLGVKAGVVDKSGSWFS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360
           +  +R+GQGREN+K FL+EN  +A  IE  +R   GL  D             +D DD D
Sbjct: 305 YGDERIGQGRENAKTFLKENTAMANEIEDKIRAAHGLDFDG------------SDSDDAD 352

Query: 361 NVE 363
            +E
Sbjct: 353 ILE 355


>gi|87199296|ref|YP_496553.1| recombinase A [Novosphingobium aromaticivorans DSM 12444]
 gi|87134977|gb|ABD25719.1| recA protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 356

 Score =  504 bits (1298), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/348 (69%), Positives = 294/348 (84%), Gaps = 8/348 (2%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +D+ KAL+AAL+QI R +GKG+ M+LGS+ ++   +E VS+GSLGLDIALGIGG P+GRI
Sbjct: 16  MDRQKALDAALAQIDRAFGKGSAMRLGSKEAM--QVEAVSTGSLGLDIALGIGGLPRGRI 73

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLALH IA++QK GGT AF+DAEHALD +YARKLGVD+ NL++SQPDT
Sbjct: 74  IEIYGPESSGKTTLALHAIAEAQKGGGTAAFIDAEHALDPVYARKLGVDIDNLIVSQPDT 133

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRS A+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQALRKLT S
Sbjct: 134 GEQALEITDTLVRSNAIDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKLTGS 193

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS+C+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD+D I GN 
Sbjct: 194 ISRSRCMVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRDEIVGNA 253

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA +V+KSGAWFS+   R+GQG
Sbjct: 254 TRVKVVKNKVAPPFKQVEFDIMYGEGISKIGEILDLGVKAGLVEKSGAWFSYDSIRIGQG 313

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           REN+K FLREN E+   +E+ +R     VA+ L+  P      DAD D
Sbjct: 314 RENAKNFLRENPEVCSRLEAAIRGRTDQVAEGLMAGP------DADDD 355


>gi|83951872|ref|ZP_00960604.1| recombinase A [Roseovarius nubinhibens ISM]
 gi|83836878|gb|EAP76175.1| recombinase A [Roseovarius nubinhibens ISM]
          Length = 352

 Score =  504 bits (1298), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/345 (71%), Positives = 289/345 (83%), Gaps = 5/345 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG+   + E IE  S+GSLGLDIALGIGG PKGRI+
Sbjct: 8   DKQKALDSALAQIERQFGKGSIMKLGADNPVQE-IEATSTGSLGLDIALGIGGLPKGRII 66

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD IYARKLGVDL  LLISQPDTG
Sbjct: 67  EIYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPIYARKLGVDLDELLISQPDTG 126

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV ++V+DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 127 EQALEIVDTLVRSGAVSMVVVDSVAALTPKSELEGDMGDSNVGVQARLMSQAMRKLTGSI 186

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRSKC ++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D + GN T
Sbjct: 187 SRSKCTVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALKDRDEVVGNAT 246

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSG+WFS+  +R+GQGR
Sbjct: 247 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVKAGVVEKSGSWFSYGDERIGQGR 306

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           EN+K FL+EN  IA  IE  +R   GL  D     P I  + D D
Sbjct: 307 ENAKTFLKENSAIALAIEDKIRAAHGLEFDM----PEIEKQGDED 347


>gi|146424879|emb|CAM12548.1| recombinase A [Ochrobactrum anthropi]
          Length = 298

 Score =  504 bits (1298), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/298 (79%), Positives = 273/298 (91%), Gaps = 1/298 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAK 297


>gi|326387207|ref|ZP_08208817.1| recombinase A [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208388|gb|EGD59195.1| recombinase A [Novosphingobium nitrogenifigens DSM 19370]
          Length = 356

 Score =  504 bits (1297), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/350 (69%), Positives = 296/350 (84%), Gaps = 7/350 (2%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           KEM   D+ KAL+AAL+QI R +GKG++M+LG + ++   IE +SSGSLGLDIALGIGG 
Sbjct: 14  KEM---DRQKALDAALAQIDRAFGKGSVMKLGQKETM--QIEAISSGSLGLDIALGIGGL 68

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           P+GRIVEIYGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGVD+ NL++
Sbjct: 69  PRGRIVEIYGPESSGKTTLALHVIAEAQKAGGTAAFVDAEHALDPVYAKKLGVDIDNLIV 128

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPDTGEQALEITD LVRS A+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQALR
Sbjct: 129 SQPDTGEQALEITDTLVRSNAIDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALR 188

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLT SISRS+C+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD+D 
Sbjct: 189 KLTGSISRSRCLVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRDE 248

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA +V+KSGAWFS+   
Sbjct: 249 IVGNATRVKVVKNKVAPPFKQVEFDIMYGEGISKIGEILDLGVKAGLVEKSGAWFSYDSI 308

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           R+GQGREN+K +LR N E+   +E+ +R     VA+ ++  P  + +DDA
Sbjct: 309 RIGQGRENAKNYLRNNPEVCNRLEAAIRSRTDQVAEGMMTGP--DAEDDA 356


>gi|163731785|ref|ZP_02139232.1| recombinase A [Roseobacter litoralis Och 149]
 gi|161395239|gb|EDQ19561.1| recombinase A [Roseobacter litoralis Och 149]
          Length = 359

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 242/345 (70%), Positives = 292/345 (84%), Gaps = 5/345 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG+ G++ + I   S+GSLGLDIALGIGG P GRI+
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGTAGAV-QDITASSTGSLGLDIALGIGGLPMGRII 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLG+DL  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHCVAEQQKAGGVCAFVDAEHALDPAYAKKLGIDLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 135 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSSVGVQARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D + GN T
Sbjct: 195 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALKDRDEVVGNHT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PFKQVEFDIMYGEGIS  GEL+DLGV A +VDKSG+WFS+  +R+GQGR
Sbjct: 255 RVKVVKNKVAAPFKQVEFDIMYGEGISKMGELLDLGVAAGVVDKSGSWFSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           EN+K FLREN+++A  IE  +R   GL  D     PA   K D D
Sbjct: 315 ENAKGFLRENVQMALEIEDKIRAAHGLDFDM----PAHEKKADDD 355


>gi|148887243|emb|CAM12788.1| recombinase A [Ochrobactrum intermedium]
          Length = 299

 Score =  503 bits (1296), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/300 (79%), Positives = 274/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++Q  GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQXKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|148897679|emb|CAM18493.1| recombinase A [Ochrobactrum intermedium]
          Length = 299

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/300 (79%), Positives = 274/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGQNDQVVE-IETVSTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALR LT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRTLTASISRSGCL 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|149915204|ref|ZP_01903732.1| recombinase A [Roseobacter sp. AzwK-3b]
 gi|149810925|gb|EDM70764.1| recombinase A [Roseobacter sp. AzwK-3b]
          Length = 364

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 249/358 (69%), Positives = 297/358 (82%), Gaps = 6/358 (1%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K     DK KALE+AL+QI+R +GKG+IM++GS   + + IE  S+GSLGLDIALG
Sbjct: 9   MDSKKN---ADKQKALESALAQIERQFGKGSIMKMGSDNPVAD-IEATSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG PKGRIVEIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD IYA+KLGVD+ 
Sbjct: 65  IGGLPKGRIVEIYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPIYAQKLGVDIN 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQ+LEI D LVRSGAV +IV+DSVAALTP++E+EGDMG+S  G+QARLMS
Sbjct: 125 ELLISQPDTGEQSLEIVDTLVRSGAVSMIVVDSVAALTPKSELEGDMGDSNVGVQARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT SISRSKC ++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIK
Sbjct: 185 QAMRKLTGSISRSKCTVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D + GN TRVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSG+WFS
Sbjct: 245 DRDEVVGNATRVKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVEKSGSWFS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           +  +R+GQGREN+K FL++N + A +IE  +R + GL  D  + EP    +   + DD
Sbjct: 305 YGDERIGQGRENAKQFLKDNPKTAYSIEDKIRASHGLEFD--MAEPDGGDRGGPEGDD 360


>gi|218515602|ref|ZP_03512442.1| recombinase A [Rhizobium etli 8C-3]
          Length = 297

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 239/298 (80%), Positives = 276/298 (92%), Gaps = 1/298 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DKSKALEAALSQI+R +GKG+IM+LGS  ++ E IE +S+GSLGLDIALG+GG PKGRI
Sbjct: 1   MDKSKALEAALSQIERSFGKGSIMKLGSNENVIE-IETISTGSLGLDIALGVGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTLAL TIA+SQK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 60  IEIYGPESSGKTTLALQTIAESQKKGGICAFVDAEHALDPVYARKLGVDLQNLLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAVD++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 120 GEQALEITDTLVRSGAVDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           IS+S  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+K+++ + GNQ
Sbjct: 180 ISKSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKEREEVIGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           TRVKVVKNKMA PFKQVEFDIMYGEG+S  GEL+DLGVKA IV+KSGAWFS+  QRLG
Sbjct: 240 TRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGAWFSYNSQRLG 297


>gi|260427837|ref|ZP_05781816.1| protein RecA [Citreicella sp. SE45]
 gi|260422329|gb|EEX15580.1| protein RecA [Citreicella sp. SE45]
          Length = 359

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 244/337 (72%), Positives = 286/337 (84%), Gaps = 4/337 (1%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K     D+ KAL++AL+QI+R +GKG+IM+LG   ++ + IE  S+GSLGLDIALG
Sbjct: 9   MDSKKN---ADRQKALDSALAQIERQFGKGSIMKLGGDNAMKD-IEATSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG PKGRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGVDL 
Sbjct: 65  IGGLPKGRIIEIYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVDLD 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEITD LVRSGAV ++V+DSVAALTP++E+EGDMG+S  G+ ARLMS
Sbjct: 125 ELLISQPDTGEQALEITDTLVRSGAVSLVVVDSVAALTPKSELEGDMGDSSVGVHARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIK
Sbjct: 185 QAMRKLTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D + GNQTRVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSGAW+S
Sbjct: 245 DRDEVVGNQTRVKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVDKSGAWYS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           +  +R+GQGREN+K FLREN   A  IE  +R   GL
Sbjct: 305 YGDERIGQGRENAKTFLRENPRQAMEIEDKIRAAHGL 341


>gi|146424975|emb|CAM12596.1| recombinase A [Ochrobactrum anthropi]
          Length = 299

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 236/300 (78%), Positives = 273/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERAFGKGSIMRLGKNAPVIE-IETVPTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTTLALHTIA++Q  GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTLALHTIAEAQXKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SISRS C+
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISRSNCM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVKVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG G+S  GEL+DLGVKA +V+KSGAWFS+  QRLGQGREN+K +
Sbjct: 240 NKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKQY 299


>gi|262277415|ref|ZP_06055208.1| protein RecA [alpha proteobacterium HIMB114]
 gi|262224518|gb|EEY74977.1| protein RecA [alpha proteobacterium HIMB114]
          Length = 376

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/343 (70%), Positives = 288/343 (83%), Gaps = 1/343 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KALEAA+ QI + +GKG++M+LG +    + IE +S+GSL LDIALGIGG PK RIV
Sbjct: 18  DKQKALEAAIGQIDQNFGKGSVMKLGQKDQALD-IEAISTGSLSLDIALGIGGLPKSRIV 76

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLAL  IA++QKTGG CAFVDAEHALD  YARKLGVD   LLISQPDTG
Sbjct: 77  EIYGPESSGKTTLALQVIAEAQKTGGVCAFVDAEHALDPTYARKLGVDTSELLISQPDTG 136

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV ++V+DSVAALTPRAE+EGDMG++  G+QARLMSQALRKLT SI
Sbjct: 137 EQALEIADTLVRSGAVSVLVVDSVAALTPRAELEGDMGDTHVGLQARLMSQALRKLTGSI 196

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+S  +++FINQ+RMKIGVMFGSPETT GGNALKFYSSVR+DIRR+G+IK+KD I GNQT
Sbjct: 197 SKSNTMVIFINQIRMKIGVMFGSPETTAGGNALKFYSSVRMDIRRIGAIKEKDEIIGNQT 256

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK VEFDIMYGEGIS  GELIDLG KA+I++KSGAW+S+KG+++GQG+
Sbjct: 257 RVKVVKNKVAPPFKVVEFDIMYGEGISKMGELIDLGAKANIIEKSGAWYSYKGEKIGQGK 316

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           EN+K +L+ N+ IA  IE  +R NAGL+++ L   P    K +
Sbjct: 317 ENAKQYLKNNLNIAAEIEMAIRANAGLISEKLEGNPIAKEKTE 359


>gi|84500803|ref|ZP_00999038.1| recombinase A [Oceanicola batsensis HTCC2597]
 gi|84390870|gb|EAQ03288.1| recombinase A [Oceanicola batsensis HTCC2597]
          Length = 359

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 242/337 (71%), Positives = 288/337 (85%), Gaps = 4/337 (1%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +++ N   K KAL++AL+QI+R +GKG+IM+LG     F  IE  S+GSLGLDIALG
Sbjct: 9   MDSKRDAN---KQKALDSALAQIERQFGKGSIMKLGGDNP-FRDIEATSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG PKGRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YARKLGVDL 
Sbjct: 65  IGGLPKGRIIEIYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPQYARKLGVDLD 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEITD LVRSGAV ++++DSVAALTP++E+EGDMG+S  G+ ARLMS
Sbjct: 125 ELLISQPDTGEQALEITDTLVRSGAVSMVIVDSVAALTPKSELEGDMGDSSVGVHARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT SI+RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IK
Sbjct: 185 QAMRKLTGSIARSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           ++D + GNQTRVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSG+W+S
Sbjct: 245 ERDEVVGNQTRVKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVEKSGSWYS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           +  +R+GQGREN+K+FLREN EIA  IE  +R   GL
Sbjct: 305 YGDERIGQGRENAKVFLRENGEIAYAIEDKIRAAHGL 341


>gi|915212|gb|AAA73517.1| RecA [Gluconobacter oxydans]
          Length = 344

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 244/349 (69%), Positives = 295/349 (84%), Gaps = 5/349 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALE ALSQI+R +GKG+IM++G +    E  +V+S+GSLGLDIALGIGG P+GRI
Sbjct: 1   MDKTKALEGALSQIERAFGKGSIMRMGQRPK--EQADVISTGSLGLDIALGIGGMPRGRI 58

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH +A++QK GGT A +DAEHALD  YARKLGV++  LL+SQPD 
Sbjct: 59  VEIYGPESSGKTTLALHVLAEAQKKGGTVAVIDAEHALDPGYARKLGVNIDELLLSQPDA 118

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAAL PR E+EGDMG+S  G+ ARLMSQALRKLT +
Sbjct: 119 GEQALEICDTLVRSGAVDVLVVDSVAALVPRRELEGDMGDSHVGLHARLMSQALRKLTGT 178

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +SRS  +++F+NQM MKIGVMFG+PETTTGGNALKFYSS+RLDIR +GSIKDKD + GNQ
Sbjct: 179 VSRSNTLVIFLNQMGMKIGVMFGNPETTTGGNALKFYSSIRLDIRHIGSIKDKDEVVGNQ 238

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDIMYGEGIS  GEL+DLGVKA+IV+KSGAWFSF  QR+GQG
Sbjct: 239 TRVKVVKNKMAPPFRQVEFDIMYGEGISKMGELLDLGVKANIVEKSGAWFSFDSQRIGQG 298

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           REN+K FLR++ E++  IE  +R +AG+VAD+L+  P     D+A  DD
Sbjct: 299 RENAKQFLRDDPEMSSEIERRIRSDAGVVADALMVGP---EGDEASSDD 344


>gi|89143137|emb|CAJ41870.1| recombinase A [Pseudochrobactrum asaccharolyticum]
          Length = 302

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/303 (78%), Positives = 277/303 (91%), Gaps = 1/303 (0%)

Query: 14  KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73
           KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG PKGRIVEIY
Sbjct: 1   KALDAALSQIERSFGKGSIMRLGQNDKVVE-IETVPTGSLSLDIALGVGGLPKGRIVEIY 59

Query: 74  GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133
           GPESSGKTT+ALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQA
Sbjct: 60  GPESSGKTTMALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQA 119

Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193
           LEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS+S
Sbjct: 120 LEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISKS 179

Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253
             +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D + GNQTRVK
Sbjct: 180 NTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEVVGNQTRVK 239

Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313
           VVKNK+A PFKQVEFDIMYG+G+S  GEL+DLGVKA IV+KSG+WFS+  QRLGQGR+N+
Sbjct: 240 VVKNKLAPPFKQVEFDIMYGQGVSKTGELVDLGVKAGIVEKSGSWFSYNSQRLGQGRDNA 299

Query: 314 KIF 316
           K F
Sbjct: 300 KNF 302


>gi|259419113|ref|ZP_05743030.1| protein RecA [Silicibacter sp. TrichCH4B]
 gi|259345335|gb|EEW57189.1| protein RecA [Silicibacter sp. TrichCH4B]
          Length = 357

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 243/327 (74%), Positives = 283/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG  G+  + IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 15  DKQKALDSALAQIERQFGKGSIMKLGD-GTALQEIEASSTGSLGLDIALGIGGLPMGRIV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA+KLGVDL  LLISQPDTG
Sbjct: 74  EIYGPESSGKTTLTLHCIAEQQKKGGVCAFVDAEHALDPQYAKKLGVDLDELLISQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 134 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSNVGVQARLMSQAMRKLTGSI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRSKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIKD+D + GN T
Sbjct: 194 SRSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIKDRDEVVGNAT 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV A +V+KSGAWFS+  +R+GQGR
Sbjct: 254 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVAAGVVNKSGAWFSYGDERIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +LREN  IA  IE  +R   GL
Sbjct: 314 ENAKTYLRENSRIALEIEDKIRAAHGL 340


>gi|126735783|ref|ZP_01751528.1| recA protein [Roseobacter sp. CCS2]
 gi|126714970|gb|EBA11836.1| recA protein [Roseobacter sp. CCS2]
          Length = 360

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/347 (71%), Positives = 290/347 (83%), Gaps = 6/347 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KALE+AL+QI+R +GKG+IM+LG +  + E IE  S+GSLGLDIALGIGG PKGR++
Sbjct: 16  DKEKALESALAQIERQFGKGSIMKLGGENKMPE-IEATSTGSLGLDIALGIGGLPKGRVI 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHAIAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT SI
Sbjct: 135 EQALEIVDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D + GN T
Sbjct: 195 NRSGCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEVVGNAT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSGAWFS+  +R+GQGR
Sbjct: 255 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVKAGVVEKSGAWFSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           ENSKIFLREN  IA  IE  +R   GL  D  L E      DD D D
Sbjct: 315 ENSKIFLRENQSIALEIEDKIRAAHGLDFD--LPE---GNHDDGDDD 356


>gi|89071225|ref|ZP_01158406.1| RecA [Oceanicola granulosus HTCC2516]
 gi|89043238|gb|EAR49467.1| RecA [Oceanicola granulosus HTCC2516]
          Length = 358

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/327 (73%), Positives = 283/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG    + + IE  S+GSLGLDIALGIGG PKGRI+
Sbjct: 17  DKQKALDSALAQIERQFGKGSIMKLGGDNKLND-IEATSTGSLGLDIALGIGGLPKGRII 75

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDTG
Sbjct: 76  EIYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDTG 135

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV ++V+DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT SI
Sbjct: 136 EQALEITDTLVRSGAVSLVVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSI 195

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GNQT
Sbjct: 196 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNQT 255

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSG+WFS+  +R+GQGR
Sbjct: 256 RVKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVDKSGSWFSYGDERIGQGR 315

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K FLREN +IA  IE  +R   GL
Sbjct: 316 ENAKQFLRENTQIALAIEDKIRAAHGL 342


>gi|84517389|ref|ZP_01004742.1| recombinase A [Loktanella vestfoldensis SKA53]
 gi|84508753|gb|EAQ05217.1| recombinase A [Loktanella vestfoldensis SKA53]
          Length = 359

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 240/327 (73%), Positives = 284/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KALE+AL+QI+R +GKG+IM+LG Q  + E IE  S+GSLGLDIALGIGG PKGR++
Sbjct: 16  DKEKALESALAQIERQFGKGSIMKLGGQNQMPE-IEATSTGSLGLDIALGIGGLPKGRVI 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH+IA+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHSIAEEQKKGGICAFVDAEHALDPQYAKKLGVNLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV ++V+DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT SI
Sbjct: 135 EQALEIVDTLVRSGAVSLVVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IKD+D + GN T
Sbjct: 195 NRSGCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKDRDEVVGNAT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSGAWFS+  +R+GQGR
Sbjct: 255 RVKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVEKSGAWFSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           ENSK+FL+EN +IA  IE  +R   GL
Sbjct: 315 ENSKLFLKENPKIANEIEDKIRAAHGL 341


>gi|89143139|emb|CAJ41871.1| recombinase A [Pseudochrobactrum saccharolyticum]
          Length = 302

 Score =  501 bits (1289), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 238/303 (78%), Positives = 276/303 (91%), Gaps = 1/303 (0%)

Query: 14  KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73
           KAL+AALSQI+R +GKG+IM+LG    + E IE V +GSL LDIALG+GG PKGRIVEIY
Sbjct: 1   KALDAALSQIERSFGKGSIMRLGQNDKVVE-IETVPTGSLSLDIALGVGGLPKGRIVEIY 59

Query: 74  GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133
           GPESSGKTT+ALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQA
Sbjct: 60  GPESSGKTTMALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQA 119

Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193
           LEITD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS+S
Sbjct: 120 LEITDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISKS 179

Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253
             +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK++D I GNQTRVK
Sbjct: 180 NTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKERDEIVGNQTRVK 239

Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313
           VVKNK+A PFKQVEFDIMYG G+S  GEL+DLGVKA IV+KSG+WFS+  QRLGQGR+N+
Sbjct: 240 VVKNKLAPPFKQVEFDIMYGAGVSKTGELVDLGVKAGIVEKSGSWFSYNSQRLGQGRDNA 299

Query: 314 KIF 316
           K F
Sbjct: 300 KNF 302


>gi|85374373|ref|YP_458435.1| recombinase A [Erythrobacter litoralis HTCC2594]
 gi|84787456|gb|ABC63638.1| recombinase A [Erythrobacter litoralis HTCC2594]
          Length = 352

 Score =  501 bits (1289), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 235/339 (69%), Positives = 290/339 (85%), Gaps = 2/339 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           N VD+ KAL+AAL+QI R +GKG+ M+LGS+ ++   +E +S+GSLGLDIALGIGG PKG
Sbjct: 12  NNVDRQKALDAALAQIDRAFGKGSAMKLGSKEAM--NVEAISTGSLGLDIALGIGGLPKG 69

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           R++E+YGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+ LGVD+  L++SQP
Sbjct: 70  RVIEVYGPESSGKTTLALHAIAEAQKAGGTAAFVDAEHALDPVYAKALGVDIDELIVSQP 129

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           DTGEQALEITD LVRS AVDI+V+DSVAAL PRAEIEG+MG+S  G+QARLMSQ+LRKLT
Sbjct: 130 DTGEQALEITDTLVRSNAVDILVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQSLRKLT 189

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            SI+RSKC+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD+D + G
Sbjct: 190 GSINRSKCMVIFINQLRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRDEVVG 249

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           N TRVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA IV+KSG+WFS+   R+G
Sbjct: 250 NSTRVKVVKNKVAPPFKQVEFDIMYGEGISKIGEILDLGVKAGIVEKSGSWFSYDSIRIG 309

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           QGREN+K +L+EN EI + +E+ +R     VA+ ++  P
Sbjct: 310 QGRENAKTYLKENPEICDKLEAAIRGKTDEVAEEMMTGP 348


>gi|329890680|ref|ZP_08269023.1| protein RecA [Brevundimonas diminuta ATCC 11568]
 gi|328845981|gb|EGF95545.1| protein RecA [Brevundimonas diminuta ATCC 11568]
          Length = 351

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 291/336 (86%), Gaps = 1/336 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK +ALEAA++QI R +GKG++M+LG  G + E IE VS+GSLGLD+ALGIGG P GR++
Sbjct: 7   DKQRALEAAIAQIDRAFGKGSVMKLGKAGQVAE-IESVSTGSLGLDMALGIGGLPVGRVI 65

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E++GPESSGKTTLALHT+A+ QK GG  AFVDAEHALD +YA+KLGV+L +LL+SQPD G
Sbjct: 66  EVFGPESSGKTTLALHTVAEVQKKGGVAAFVDAEHALDPVYAQKLGVNLDDLLVSQPDAG 125

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVDI+V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SI
Sbjct: 126 EQALEIVDTLVRSGAVDIVVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASI 185

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+SKCI++FINQ+R KIGVM+GSPETTTGGNALKFY+SVRLDIRR G+IK++D + GN T
Sbjct: 186 SKSKCIVLFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGAIKNRDEVVGNTT 245

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++V FDIMYGEGIS  GE+IDLGVKA+I++KSG+WFS+   R+GQGR
Sbjct: 246 RVKVVKNKVAPPFREVIFDIMYGEGISKIGEIIDLGVKANIIEKSGSWFSYDSTRIGQGR 305

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           EN+K FL+ N ++A  IE  +RQ+   +AD +L  P
Sbjct: 306 ENAKEFLKNNPDMALAIEKAVRQSTAKIADDMLGAP 341


>gi|254449721|ref|ZP_05063158.1| protein RecA [Octadecabacter antarcticus 238]
 gi|198264127|gb|EDY88397.1| protein RecA [Octadecabacter antarcticus 238]
          Length = 371

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 244/346 (70%), Positives = 285/346 (82%), Gaps = 2/346 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM LG  G+  + IE  S+GSLGLDIALGIGG PKGR+V
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMTLG--GNAIQEIESTSTGSLGLDIALGIGGIPKGRVV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDTG
Sbjct: 74  EIYGPESSGKTTLTLHCLAEEQKKGGVCAFVDAEHALDPGYAKKLGVNLDELLISQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV +IV+DSVAALTP++E+EGDMG+   G+ ARLMSQA+RKLT SI
Sbjct: 134 EQALEIVDTLVRSGAVSMIVVDSVAALTPKSELEGDMGDHSVGVHARLMSQAMRKLTGSI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SR+KC ++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GS+KD+D I GN T
Sbjct: 194 SRTKCTVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSVKDRDEIVGNST 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+D+GVKA IV+KSG+WFS+  +R+GQGR
Sbjct: 254 RVKVVKNKVAPPFKQVEFDIMYGEGISKLGELVDMGVKAGIVEKSGSWFSYGDERIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK 356
           EN+K FLREN   A  IE  +R   GL  D   ++     KD A K
Sbjct: 314 ENAKTFLRENPHFANEIEDKIRAAHGLDFDGATKKDCATKKDGAAK 359


>gi|254512103|ref|ZP_05124170.1| protein RecA [Rhodobacteraceae bacterium KLH11]
 gi|221535814|gb|EEE38802.1| protein RecA [Rhodobacteraceae bacterium KLH11]
          Length = 354

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 242/327 (74%), Positives = 283/327 (86%), Gaps = 2/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG      + IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 14  DKQKALDSALAQIERQFGKGSIMKLGEDAK--QDIEASSTGSLGLDIALGIGGLPMGRIV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YARKLGVDL  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLHCIAEQQKRGGVCAFVDAEHALDPQYARKLGVDLDELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++V+DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 132 EQALEITDTLVRSGAVNMVVVDSVAALTPKSELEGDMGDSNVGVQARLMSQAMRKLTGSI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GNQT
Sbjct: 192 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNQT 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSG+WFS+  +R+GQGR
Sbjct: 252 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVKAGVVEKSGSWFSYGDERIGQGR 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +LR+N  IA +IE  +R   GL
Sbjct: 312 ENAKQYLRDNARIALDIEDKIRAAHGL 338


>gi|99081071|ref|YP_613225.1| recombinase A [Ruegeria sp. TM1040]
 gi|99037351|gb|ABF63963.1| recA protein [Ruegeria sp. TM1040]
          Length = 357

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/327 (74%), Positives = 283/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG  G+  + IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 15  DKQKALDSALAQIERQFGKGSIMKLGD-GTALQEIEASSTGSLGLDIALGIGGLPMGRIV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA+KLGVDL  LLISQPDTG
Sbjct: 74  EIYGPESSGKTTLTLHCIAEQQKKGGVCAFVDAEHALDPQYAKKLGVDLDELLISQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 134 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSNVGVQARLMSQAMRKLTGSI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRSKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIKD+D + GN T
Sbjct: 194 SRSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIKDRDEVVGNAT 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV A +V+KSGAWFS+  +R+GQGR
Sbjct: 254 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVAAGVVNKSGAWFSYGDERIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +LREN  IA  IE  +R   GL
Sbjct: 314 ENAKGYLRENSRIALEIEDKIRAAHGL 340


>gi|85708968|ref|ZP_01040034.1| recombinase A [Erythrobacter sp. NAP1]
 gi|85690502|gb|EAQ30505.1| recombinase A [Erythrobacter sp. NAP1]
          Length = 354

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 236/348 (67%), Positives = 294/348 (84%), Gaps = 8/348 (2%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VD+ KAL+AAL+QI R +GKG+ M+LGS+ ++   +E +S+GSLGLDIALGIGG PKGR+
Sbjct: 14  VDRQKALDAALAQIDRAFGKGSAMKLGSKEAM--QVESISTGSLGLDIALGIGGLPKGRV 71

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +E+YGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGVD+  L++SQPDT
Sbjct: 72  IEVYGPESSGKTTLALHCIAEAQKAGGTAAFVDAEHALDPVYAKKLGVDIDELVVSQPDT 131

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRS AVD++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQ+LRKLT S
Sbjct: 132 GEQALEITDTLVRSNAVDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQSLRKLTGS 191

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I+RSKC+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD+D + GN 
Sbjct: 192 INRSKCMVIFINQLRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRDEVIGNS 251

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA IV+KSG+W+S+   R+GQG
Sbjct: 252 TRVKVVKNKVAPPFKQVEFDIMYGEGISKIGEILDLGVKAGIVEKSGSWYSYDSVRIGQG 311

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           REN+K +L+EN E+ + +E+ +R     VA+ ++  P      DAD D
Sbjct: 312 RENAKTYLKENPEVCDKLEAAIRGKTDEVAEEMMTGP------DADTD 353


>gi|296282672|ref|ZP_06860670.1| recombinase A [Citromicrobium bathyomarinum JL354]
          Length = 354

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 236/342 (69%), Positives = 293/342 (85%), Gaps = 3/342 (0%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           KE N VD+ KAL+AAL+QI R +GKG+ M+LGS+ ++   +E +S+GSLGLDIALGIGG 
Sbjct: 12  KETN-VDRQKALDAALAQIDRAFGKGSAMKLGSKETM--NVESISTGSLGLDIALGIGGL 68

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           PKGR++E+YGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGVD+  L++
Sbjct: 69  PKGRVIEVYGPESSGKTTLALHVIAEAQKAGGTAAFVDAEHALDPVYAKKLGVDIDELIV 128

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPDTGEQALEITD LVRS A+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQ+LR
Sbjct: 129 SQPDTGEQALEITDTLVRSNAIDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQSLR 188

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLT SI+RSKC+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD+D 
Sbjct: 189 KLTGSINRSKCMVIFINQLRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRDE 248

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK+A PFKQVEFDIMYG+GIS  GE++DLGVKA +V+KSG+WFS+   
Sbjct: 249 IIGNSTRVKVVKNKVAPPFKQVEFDIMYGQGISKIGEILDLGVKAGVVEKSGSWFSYDSI 308

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           R+GQGREN+K FL+EN EI + +E+ +R     VA+ ++  P
Sbjct: 309 RIGQGRENAKTFLKENPEICDKLEAAIRGKTDDVAEEMMVGP 350


>gi|126737804|ref|ZP_01753534.1| recombinase A [Roseobacter sp. SK209-2-6]
 gi|126721197|gb|EBA17901.1| recombinase A [Roseobacter sp. SK209-2-6]
          Length = 355

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/343 (71%), Positives = 290/343 (84%), Gaps = 5/343 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG  G+  + IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 14  DKQKALDSALAQIERQFGKGSIMKLGD-GNAMQEIEASSTGSLGLDIALGIGGLPMGRIV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA KLGVDL  LLISQPDTG
Sbjct: 73  EIYGPESSGKTTLTLHCIAEQQKKGGVCAFVDAEHALDPQYAAKLGVDLDELLISQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 133 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSNVGVQARLMSQAMRKLTGSI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RSKC+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GNQT
Sbjct: 193 NRSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNQT 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV A +V+KSGAWFS+  +R+GQGR
Sbjct: 253 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVAAGVVNKSGAWFSYGDERIGQGR 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           EN+K FLR++ E A +IE  +R   GL  D     P +  +DD
Sbjct: 313 ENAKQFLRDHPETAFDIEDKIRAAHGLDFD----RPELGGEDD 351


>gi|254486860|ref|ZP_05100065.1| protein RecA [Roseobacter sp. GAI101]
 gi|214043729|gb|EEB84367.1| protein RecA [Roseobacter sp. GAI101]
          Length = 356

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/363 (67%), Positives = 299/363 (82%), Gaps = 16/363 (4%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K+    +K KAL++AL+QI+R +GKG+IM+LG+ G+I + I+  S+GSLGLDIALG
Sbjct: 9   MDNKKQ---AEKQKALDSALAQIERQFGKGSIMKLGAPGAI-QDIKSSSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG P GRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YARKLGVD+ 
Sbjct: 65  IGGLPMGRIIEIYGPESSGKTTLTLHCVAEQQKAGGVCAFVDAEHALDPQYARKLGVDID 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEI D LVRSGAV+++V+DSVAALTP++E+EGDMG+S  G+QARLMS
Sbjct: 125 ELLISQPDTGEQALEIVDTLVRSGAVNMVVVDSVAALTPKSELEGDMGDSSVGVQARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT SISRS C+++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVRLDIRR+G++K
Sbjct: 185 QAMRKLTGSISRSNCMVIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRLDIRRIGALK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D + GN TRVK+VKNK+A+PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSG+WFS
Sbjct: 245 DRDEVVGNATRVKIVKNKVAAPFKQVEFDIMYGEGISKMGELLDLGVKAGVVDKSGSWFS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360
           +  +R+GQGREN+K FLREN  +A  IE  +R   GL              D ++KDD D
Sbjct: 305 YGDERIGQGRENAKTFLRENEAMAMEIEDKIRAAHGL------------DFDGSEKDDID 352

Query: 361 NVE 363
            +E
Sbjct: 353 ILE 355


>gi|302382290|ref|YP_003818113.1| recA protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302192918|gb|ADL00490.1| recA protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 367

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 291/336 (86%), Gaps = 1/336 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK +ALEAA++QI R +GKG++M+LG +G I + I  VS+GSLGLD+ALGIGG P+GR++
Sbjct: 23  DKQRALEAAIAQIDRAFGKGSVMKLG-KGGIADVIPSVSTGSLGLDMALGIGGLPRGRVI 81

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E++GPESSGKTTLALHT+A+ QK+GGT AFVDAEHALD  YA+KLGV+L +LL+SQPDTG
Sbjct: 82  EVFGPESSGKTTLALHTVAEIQKSGGTAAFVDAEHALDPGYAQKLGVNLDDLLVSQPDTG 141

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVDI+V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SI
Sbjct: 142 EQALEIVDTLVRSGAVDIVVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASI 201

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+S CI++FINQ+R KIGVM+GSPETTTGGNALKFY+SVRLDIRR G+IKD+D + GN T
Sbjct: 202 SKSNCIVLFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGAIKDRDEVVGNTT 261

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++V FDIMYGEGIS  GE+IDLGVKA I++KSG+WFS+   R+GQGR
Sbjct: 262 RVKVVKNKVAPPFREVIFDIMYGEGISKLGEIIDLGVKAGIIEKSGSWFSYDSTRIGQGR 321

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           EN + FL+ N ++A  IE  +R++   +AD LL  P
Sbjct: 322 ENVRAFLKANPDMAAAIEDKVRKSTSKIADELLGTP 357


>gi|94496514|ref|ZP_01303090.1| recA protein [Sphingomonas sp. SKA58]
 gi|94423874|gb|EAT08899.1| recA protein [Sphingomonas sp. SKA58]
          Length = 384

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 244/355 (68%), Positives = 296/355 (83%), Gaps = 5/355 (1%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           +D +K  N+ D+ KAL+AAL+QI R +GKG+ M+LGS+  I   IE +S+GSLGLDIALG
Sbjct: 35  IDSKKTGNM-DRQKALDAALAQIDRAFGKGSAMKLGSREKIE--IESISTGSLGLDIALG 91

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG PKGRI+EIYGPESSGKTTL LH IA++QK GGT AFVDAEHALD  YA+KLGVD+ 
Sbjct: 92  IGGLPKGRIIEIYGPESSGKTTLTLHAIAEAQKAGGTAAFVDAEHALDPAYAKKLGVDID 151

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            L++SQPDTGEQALEI D LVRS A+DI+VIDSVAAL PRAEIEG+MG+S  G+QARLMS
Sbjct: 152 ELIVSQPDTGEQALEIVDTLVRSNAIDILVIDSVAALVPRAEIEGEMGDSHVGLQARLMS 211

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLT SISRSKC+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IK
Sbjct: 212 QALRKLTGSISRSKCMVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIK 271

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D I GN TRVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+D+GVKA +V+KSGAWFS
Sbjct: 272 DRDDIVGNATRVKVVKNKVAPPFKQVEFDIMYGEGISKIGELLDIGVKAGLVEKSGAWFS 331

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           +   R+GQGREN+K +L+E+ E+A+ +E  +R     VAD ++  P  + +DD +
Sbjct: 332 YDSIRIGQGRENAKTYLKEHPELADRLEKAIRGKTEEVADGMMTGP--DAEDDGE 384


>gi|109254800|emb|CAK22262.1| recombinase A [Pseudochrobactrum kiredjianiae]
          Length = 299

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/300 (77%), Positives = 275/300 (91%), Gaps = 1/300 (0%)

Query: 17  EAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPE 76
           +AALSQI+R +GKG+IM+LG    + E IE VS+GSL LDIALG+GG PKGRIVEIYGPE
Sbjct: 1   DAALSQIERSFGKGSIMRLGQNDKVVE-IETVSTGSLSLDIALGVGGLPKGRIVEIYGPE 59

Query: 77  SSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEI 136
           SSGKTT+ALHTIA++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDTGEQALEI
Sbjct: 60  SSGKTTMALHTIAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDTGEQALEI 119

Query: 137 TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCI 196
           TD LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SIS+S  +
Sbjct: 120 TDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASISKSNTM 179

Query: 197 LVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVK 256
           ++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G+IK++D + GNQTR+KVVK
Sbjct: 180 VIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKERDEVVGNQTRIKVVK 239

Query: 257 NKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIF 316
           NK+A PFKQVEFDIMYG+G+S  GEL+DLGVKA IV+KSG+WFS+  QRLGQGR+N+K F
Sbjct: 240 NKLAPPFKQVEFDIMYGQGVSKTGELVDLGVKAGIVEKSGSWFSYNSQRLGQGRDNAKNF 299


>gi|163736399|ref|ZP_02143818.1| recA protein [Phaeobacter gallaeciensis BS107]
 gi|163741066|ref|ZP_02148458.1| recombinase A [Phaeobacter gallaeciensis 2.10]
 gi|161385419|gb|EDQ09796.1| recombinase A [Phaeobacter gallaeciensis 2.10]
 gi|161390269|gb|EDQ14619.1| recA protein [Phaeobacter gallaeciensis BS107]
          Length = 355

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 281/330 (85%), Gaps = 1/330 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG  G+    IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 15  DKQKALDSALAQIERQFGKGSIMKLGD-GNPLNEIEASSTGSLGLDIALGIGGLPMGRIV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA KLGVDL  LLISQPDTG
Sbjct: 74  EIYGPESSGKTTLTLHCIAEQQKKGGVCAFVDAEHALDPQYAAKLGVDLDELLISQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 134 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSSVGVQARLMSQAMRKLTGSI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GN T
Sbjct: 194 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNAT 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV A +V KSGAWFS+  +R+GQGR
Sbjct: 254 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVAAGVVAKSGAWFSYGDERIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
           EN+K +LREN  IA +IE  +R   GL  D
Sbjct: 314 ENAKTYLRENAHIAYDIEDKIRAAHGLEFD 343


>gi|84686865|ref|ZP_01014749.1| recombinase A [Maritimibacter alkaliphilus HTCC2654]
 gi|84665062|gb|EAQ11542.1| recombinase A [Rhodobacterales bacterium HTCC2654]
          Length = 361

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 246/353 (69%), Positives = 290/353 (82%), Gaps = 11/353 (3%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL++AL+QI+R +GKG+IM+LG+   + E I   S+GSLGLDIALGIGG PKGRI+
Sbjct: 19  EKQKALDSALAQIERQFGKGSIMKLGADNPVAE-IASTSTGSLGLDIALGIGGLPKGRII 77

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA++LGVDL  LLISQPDTG
Sbjct: 78  EIYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPQYAKRLGVDLDELLISQPDTG 137

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV+++V+DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 138 EQALEIVDTLVRSGAVNMVVVDSVAALTPKSELEGDMGDSSVGVQARLMSQAMRKLTGSI 197

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GN T
Sbjct: 198 ARSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNAT 257

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +V+KSGAWFS+  +R+GQGR
Sbjct: 258 RVKVVKNKVAPPFKQVEFDIMYGEGISKTGELLDLGVKAGVVEKSGAWFSYGDERIGQGR 317

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE 363
           ENSK FL+EN  IA  IE  +R   GL  D             AD DD D VE
Sbjct: 318 ENSKTFLKENPSIALEIEDKIRAAHGLDFD----------MGGADFDDADVVE 360


>gi|254475519|ref|ZP_05088905.1| protein RecA [Ruegeria sp. R11]
 gi|214029762|gb|EEB70597.1| protein RecA [Ruegeria sp. R11]
          Length = 355

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 243/330 (73%), Positives = 281/330 (85%), Gaps = 1/330 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG  G+    IE  S+GSLGLDIALGIGG P GRIV
Sbjct: 15  DKQKALDSALAQIERQFGKGSIMKLGD-GNPLNEIEASSTGSLGLDIALGIGGLPMGRIV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA KLGVDL  LLISQPDTG
Sbjct: 74  EIYGPESSGKTTLTLHCIAEQQKKGGVCAFVDAEHALDPQYAAKLGVDLDELLISQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 134 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSNVGVQARLMSQAMRKLTGSI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GN T
Sbjct: 194 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNAT 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV A +V KSGAWFS+  +R+GQGR
Sbjct: 254 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVAAGVVAKSGAWFSYGDERIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
           EN+K FLREN  IA +IE  +R   GL  D
Sbjct: 314 ENAKTFLRENPHIAYDIEDKIRAAHGLEFD 343


>gi|255264284|ref|ZP_05343626.1| protein RecA [Thalassiobium sp. R2A62]
 gi|255106619|gb|EET49293.1| protein RecA [Thalassiobium sp. R2A62]
          Length = 362

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 239/327 (73%), Positives = 280/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG + +I E IE  S+GSLGLDIALGIGG PKGR+V
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGGENAIQE-IESTSTGSLGLDIALGIGGIPKGRVV 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YARKLGV+L  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPQYARKLGVNLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV +IV+DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT SI
Sbjct: 135 EQALEIVDTLVRSGAVSMIVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +R+ C ++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D + GN T
Sbjct: 195 NRTNCTVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALKDRDEVVGNAT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA IVDKSGAWFS+  +R+GQGR
Sbjct: 255 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVKAGIVDKSGAWFSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +L+EN   A  IE  +R   GL
Sbjct: 315 ENAKTYLKENTRTALEIEDKIRAAHGL 341


>gi|254419524|ref|ZP_05033248.1| protein RecA [Brevundimonas sp. BAL3]
 gi|196185701|gb|EDX80677.1| protein RecA [Brevundimonas sp. BAL3]
          Length = 359

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 234/336 (69%), Positives = 291/336 (86%), Gaps = 1/336 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK +ALEAA++QI R +GKG++M+LG +G + + I  VS+GSLGLD+ALGIGG P+GR++
Sbjct: 15  DKQRALEAAIAQIDRAFGKGSVMKLG-KGGVADVIPSVSTGSLGLDMALGIGGLPRGRVI 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E++GPESSGKTTLALHT+A+ QK GGT AFVDAEHALD  YA+KLGV+L +LL+SQPDTG
Sbjct: 74  EVFGPESSGKTTLALHTVAEVQKAGGTAAFVDAEHALDPGYAQKLGVNLDDLLVSQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVDI+V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SI
Sbjct: 134 EQALEIVDTLVRSGAVDIVVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+S CI++FINQ+R KIGVM+GSPETTTGGNALKFY+SVRLDIRR G+IK++D + GN T
Sbjct: 194 SKSNCIVLFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGAIKNRDEVVGNTT 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++V FDIMYGEGIS  GE+IDLGVKA +++KSG+WFS+   R+GQGR
Sbjct: 254 RVKVVKNKVAPPFREVIFDIMYGEGISKLGEIIDLGVKAGVIEKSGSWFSYDSTRIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           EN + FL++N +IA +IE  +R +   +AD LL  P
Sbjct: 314 ENVREFLKQNPDIAASIEKAVRASTSKIADELLGTP 349


>gi|294013267|ref|YP_003546727.1| recombination protein RecA [Sphingobium japonicum UT26S]
 gi|292676597|dbj|BAI98115.1| recombination protein RecA [Sphingobium japonicum UT26S]
          Length = 357

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 239/351 (68%), Positives = 292/351 (83%), Gaps = 4/351 (1%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           K+   +D+ KALEAALSQI R +GKG+ M+LGS+  I   IE +S+GSLGLDIALGIGG 
Sbjct: 11  KKTGTMDRQKALEAALSQIDRAFGKGSAMKLGSREKIE--IEAISTGSLGLDIALGIGGL 68

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           P+GRIVEIYGPESSGKTTLALH IA++QK GG  AFVDAEHALD  YA+KLGVD+  L++
Sbjct: 69  PRGRIVEIYGPESSGKTTLALHAIAEAQKAGGIAAFVDAEHALDPGYAKKLGVDIDELIV 128

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPDTGEQALEI D LVRS A+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQALR
Sbjct: 129 SQPDTGEQALEIVDTLVRSNAIDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALR 188

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLT SISRS+C+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD++ 
Sbjct: 189 KLTGSISRSRCLVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRED 248

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK+A PFKQVEFDIMYGEG+S  GEL+D+GVKA +V+KSGAWFS+   
Sbjct: 249 IVGNATRVKVVKNKVAPPFKQVEFDIMYGEGVSKIGELLDIGVKAGLVEKSGAWFSYDSV 308

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           R+GQGREN+K +L+E+ E+AE +E  +R     VA+ ++  P    +DD +
Sbjct: 309 RIGQGRENAKTYLKEHPEMAERLEKAIRGKTEEVAEGMMAGP--EAEDDGE 357


>gi|149184397|ref|ZP_01862715.1| recombinase A [Erythrobacter sp. SD-21]
 gi|148831717|gb|EDL50150.1| recombinase A [Erythrobacter sp. SD-21]
          Length = 341

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 231/336 (68%), Positives = 287/336 (85%), Gaps = 2/336 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           D+ KAL+AAL+QI R +GKG+ M+LG + ++   +E +S+GSLGLDIALGIGG PKGR++
Sbjct: 4   DRQKALDAALAQIDRAFGKGSAMKLGQKEAM--NVEAISTGSLGLDIALGIGGLPKGRVI 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGVD+  L++SQPDTG
Sbjct: 62  EVYGPESSGKTTLALHAIAEAQKAGGTAAFVDAEHALDPVYAKKLGVDVDELIVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRS A+DI+V+DSVAAL PRAEIEG+MG+S  G+QARLMSQ+LRKLT SI
Sbjct: 122 EQALEITDTLVRSNAIDILVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQSLRKLTGSI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RSKC+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD+D + GN T
Sbjct: 182 NRSKCMVIFINQLRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRDEVIGNST 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA +V+KSG+WFS+   R+GQGR
Sbjct: 242 RVKVVKNKVAPPFKQVEFDIMYGEGISKIGEILDLGVKAGVVEKSGSWFSYDSVRIGQGR 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           EN+K FL+EN E+   +E+ +R     VA+ ++  P
Sbjct: 302 ENAKTFLKENPEMCAKLEAAIRGKTDEVAEEMMAGP 337


>gi|294083658|ref|YP_003550415.1| RecA DNA recombination protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663230|gb|ADE38331.1| RecA DNA recombination protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 367

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 243/333 (72%), Positives = 295/333 (88%), Gaps = 1/333 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK++ALEAA+ QI++ +GKG++M+LG + S  + ++ +S+GSLGLDI LGIGGFPKGRIV
Sbjct: 14  DKNQALEAAIGQIEKAFGKGSVMKLGQRESAVD-VQSISTGSLGLDIGLGIGGFPKGRIV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALH +A++QK GG CAFVDAEHALD  YA+KLGV++ +LLISQPD G
Sbjct: 73  EIYGPESSGKTTLALHAVAEAQKEGGNCAFVDAEHALDPAYAKKLGVNIDDLLISQPDAG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGA+D++V+DSVAAL PRAE+EG+MG+   G+QARLMSQALRKLTSSI
Sbjct: 133 EQALEIADTLVRSGAIDVLVVDSVAALVPRAELEGEMGDHHVGLQARLMSQALRKLTSSI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RS C+++FINQ+R+KIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IKD+D + GNQT
Sbjct: 193 ARSNCLVIFINQIRLKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKDRDEVVGNQT 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PF+ VEFDIMYGEGIS  GEL+DLGV A IV+KSGAW S+KG RLGQGR
Sbjct: 253 RVKVVKNKVAAPFRTVEFDIMYGEGISKMGELLDLGVAAGIVEKSGAWISYKGDRLGQGR 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           EN+K FLREN EIA  IES +RQNAGLV D++L
Sbjct: 313 ENAKNFLRENTEIANEIESAIRQNAGLVGDAML 345


>gi|149202695|ref|ZP_01879667.1| recombinase A [Roseovarius sp. TM1035]
 gi|149143977|gb|EDM32011.1| recombinase A [Roseovarius sp. TM1035]
          Length = 357

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 238/327 (72%), Positives = 282/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG   ++ + IE  S+GSLGLDIALGIGG PKGRIV
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGGDNAVKD-IEATSTGSLGLDIALGIGGIPKGRIV 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD +YARKLGVDL  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPVYARKLGVDLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV +IV+DSVAALTP++E+EG+MG+S  G+ ARLMSQA+RKLT SI
Sbjct: 135 EQALEIVDTLVRSGAVSMIVVDSVAALTPKSELEGEMGDSSVGVHARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SR+ C ++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIKD+D + GN T
Sbjct: 195 SRTNCTVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIKDRDEVVGNTT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIM+GEGIS  GELID+GVKA +V+KSG+W+S+  QR+GQGR
Sbjct: 255 RVKVVKNKVAPPFKQVEFDIMFGEGISKTGELIDIGVKAGVVEKSGSWYSYGDQRIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K FLR+N  +A  IE  +R + GL
Sbjct: 315 ENTKGFLRDNPAMAIEIEDKIRASHGL 341


>gi|332185210|ref|ZP_08386959.1| protein RecA [Sphingomonas sp. S17]
 gi|332014934|gb|EGI56990.1| protein RecA [Sphingomonas sp. S17]
          Length = 346

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 231/343 (67%), Positives = 294/343 (85%), Gaps = 4/343 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           D+ KAL+AAL+QI R +GKG+ M+LG + ++   +E +S+GSLGLDIALG+GG P+GR++
Sbjct: 7   DRQKALDAALAQIDRAFGKGSAMKLGQKETM--QVEAISTGSLGLDIALGVGGLPRGRVI 64

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YA+KLGV++  L++SQPDTG
Sbjct: 65  EVYGPESSGKTTLALHVIAEAQKMGGTAAFVDAEHALDPVYAKKLGVNIDELIVSQPDTG 124

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRS A+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQ+LRKLT SI
Sbjct: 125 EQALEITDTLVRSNAIDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQSLRKLTGSI 184

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS+C+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD++ ITGN T
Sbjct: 185 SRSRCMVIFINQLRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDREDITGNTT 244

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GE++DLGVKA +V+KSG+WFS+   R+GQGR
Sbjct: 245 RVKVVKNKVAPPFKQVEFDIMYGEGISKIGEILDLGVKAGLVEKSGSWFSYDSVRIGQGR 304

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           EN+K +LREN ++A+ +E  +RQ    VA+ ++  P  + +DD
Sbjct: 305 ENAKNYLRENPDMADRLERAIRQRTEQVAEEMMTGP--DAEDD 345


>gi|254436817|ref|ZP_05050311.1| protein RecA [Octadecabacter antarcticus 307]
 gi|198252263|gb|EDY76577.1| protein RecA [Octadecabacter antarcticus 307]
          Length = 359

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 286/344 (83%), Gaps = 4/344 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM LG  GS  + IE  S+GSLGLDIALGIGG PKGR+V
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMTLG--GSAVQEIESTSTGSLGLDIALGIGGIPKGRVV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH +A+ QK GG CAF+DAEHALD  YA+KLGV+L +LLISQPDTG
Sbjct: 74  EIYGPESSGKTTLTLHCLAEEQKKGGVCAFIDAEHALDPGYAKKLGVNLDDLLISQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGA+ +IV+DSVAALTP++E+EGDMG+   G+ ARLMSQA+RKLT SI
Sbjct: 134 EQALEIVDTLVRSGAISMIVVDSVAALTPKSELEGDMGDHSVGVHARLMSQAMRKLTGSI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SR+KC ++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GS+KD+D I GN T
Sbjct: 194 SRTKCTVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSVKDRDEIVGNST 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK VEFDIMYGEGIS  GEL+D+GVKA IV+KSG+WFS+  +R+GQGR
Sbjct: 254 RVKVVKNKVAPPFKVVEFDIMYGEGISKLGELVDMGVKAGIVEKSGSWFSYGDERIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           EN+K FLREN   A  IE  +R   GL  D   ++P    +DDA
Sbjct: 314 ENAKTFLRENQHFAIEIEDKIRAAHGLDFDGAPKKPG--KEDDA 355


>gi|307295018|ref|ZP_07574860.1| recA protein [Sphingobium chlorophenolicum L-1]
 gi|306879492|gb|EFN10710.1| recA protein [Sphingobium chlorophenolicum L-1]
          Length = 357

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 238/351 (67%), Positives = 292/351 (83%), Gaps = 4/351 (1%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           K+   +D+ KALEAALSQI R +GKG+ M+LGS+  I   IE +S+GSLGLDIALGIGG 
Sbjct: 11  KKTGTMDRQKALEAALSQIDRAFGKGSAMKLGSREKIE--IEAISTGSLGLDIALGIGGL 68

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           P+GRI+EIYGPESSGKTTLALH IA++QKTGG  AFVDAEHALD  YA+KLGVD+  L++
Sbjct: 69  PRGRIIEIYGPESSGKTTLALHAIAEAQKTGGIAAFVDAEHALDPGYAKKLGVDIDELIV 128

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPDTGEQALEI D LVRS A+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQALR
Sbjct: 129 SQPDTGEQALEIVDTLVRSNAIDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALR 188

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLT SISRSKC+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IKD++ 
Sbjct: 189 KLTGSISRSKCMVIFINQVRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKDRED 248

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK+A PFKQVEFDIMYGEG+S  GEL+D+GVK  +V+KSGAWFS+   
Sbjct: 249 IVGNATRVKVVKNKVAPPFKQVEFDIMYGEGVSKIGELLDIGVKTGLVEKSGAWFSYDSV 308

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           R+GQGREN+K +L+E+ E+A+ +E  +R     VA+ ++  P    +DD +
Sbjct: 309 RIGQGRENAKTYLKEHPEMADKLEKAIRGKTEEVAEGMMAGP--EAEDDGE 357


>gi|85703237|ref|ZP_01034341.1| recombinase A [Roseovarius sp. 217]
 gi|85672165|gb|EAQ27022.1| recombinase A [Roseovarius sp. 217]
          Length = 357

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 281/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG +  I + IE  S+GSLGLDIALGIGG PKGRIV
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGGENPIKD-IESTSTGSLGLDIALGIGGIPKGRIV 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTL LH +A+ QK GG CAFVDAEHALD IYARKLGVDL  LLISQPDTG
Sbjct: 75  EVYGPESSGKTTLTLHCVAEEQKKGGVCAFVDAEHALDPIYARKLGVDLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV +IV+DSVAALTP++E+EG+MG+S  G+ ARLMSQA+RKLT SI
Sbjct: 135 EQALEIVDTLVRSGAVSMIVVDSVAALTPKSELEGEMGDSSVGVHARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SR+ C ++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D I GN T
Sbjct: 195 SRTNCTVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKDRDEIVGNAT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+D+GVKA +V+KSG+W+S+  +R+GQGR
Sbjct: 255 RVKVVKNKVAPPFKQVEFDIMYGEGISKTGELVDMGVKAGVVEKSGSWYSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +LR+N   A  IE  +R + GL
Sbjct: 315 ENAKTYLRDNPATALEIEDKIRASHGL 341


>gi|294677288|ref|YP_003577903.1| RecA protein [Rhodobacter capsulatus SB 1003]
 gi|294476108|gb|ADE85496.1| RecA protein [Rhodobacter capsulatus SB 1003]
          Length = 355

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 241/335 (71%), Positives = 284/335 (84%), Gaps = 4/335 (1%)

Query: 6   EMN---IVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIG 62
           EMN     DK KALE+AL+QI+R +GKG+IM+LG      E IE  S+GSLGLDIALGIG
Sbjct: 8   EMNDKGKADKQKALESALAQIERQFGKGSIMKLGGDTPPPE-IEATSTGSLGLDIALGIG 66

Query: 63  GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNL 122
           G PKGRIVEIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA+KLGV L++L
Sbjct: 67  GLPKGRIVEIYGPESSGKTTLTLHCIAEEQKKGGVCAFVDAEHALDPYYAKKLGVSLEDL 126

Query: 123 LISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQA 182
           LISQPDTGEQALEI D LVRSGAV ++V+DSVAALTP+AEIEGDMG++  G QARLMSQA
Sbjct: 127 LISQPDTGEQALEIVDTLVRSGAVSLVVVDSVAALTPKAEIEGDMGDATVGAQARLMSQA 186

Query: 183 LRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDK 242
           +RKLT+SI RS C+++FINQ+RMKIGVMFGSPETT+GGNALKFY+SVRLDIRR G+IKD+
Sbjct: 187 MRKLTASIGRSNCMVIFINQIRMKIGVMFGSPETTSGGNALKFYASVRLDIRRTGAIKDR 246

Query: 243 DSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFK 302
           D + GNQTRVKVVKNK+A PF++VEFDI+YGEGIS  GEL+DLGVKA +V KSGAW+S+ 
Sbjct: 247 DEVIGNQTRVKVVKNKVAPPFREVEFDILYGEGISKVGELVDLGVKAGVVAKSGAWYSYG 306

Query: 303 GQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
            +R+GQGREN+K FLR+N +IA  IE  +R + GL
Sbjct: 307 DERIGQGRENAKQFLRDNPDIAYEIEDKIRASHGL 341


>gi|89054477|ref|YP_509928.1| recombinase A [Jannaschia sp. CCS1]
 gi|88864026|gb|ABD54903.1| recA protein [Jannaschia sp. CCS1]
          Length = 357

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/327 (72%), Positives = 281/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG   ++ + IE  S+GSLGLDIALGIGG PKGR++
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGGD-NVLKDIEATSTGSLGLDIALGIGGLPKGRVI 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YARKLGV+L  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHAIAEEQKKGGVCAFVDAEHALDPQYARKLGVNLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV ++V+DSVAALTP++E+EGDMG+S  G+ ARLMSQA+RKLT SI
Sbjct: 135 EQALEIVDTLVRSGAVSMVVVDSVAALTPKSELEGDMGDSSVGVHARLMSQAMRKLTGSI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RS C++VFINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IKD+D + GN T
Sbjct: 195 NRSGCMVVFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKDRDEVVGNTT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GELID+GVKA IV+KSG+WFS+  +R+GQGR
Sbjct: 255 RVKVVKNKVAPPFKQVEFDIMYGEGISKNGELIDMGVKAGIVEKSGSWFSYGDERVGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K F+R+N  IA  IE  +R   GL
Sbjct: 315 ENAKQFMRDNPAIAYEIEDKIRAAHGL 341


>gi|103487210|ref|YP_616771.1| recombinase A [Sphingopyxis alaskensis RB2256]
 gi|98977287|gb|ABF53438.1| recA protein [Sphingopyxis alaskensis RB2256]
          Length = 360

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/350 (66%), Positives = 293/350 (83%), Gaps = 2/350 (0%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           K +N  D+ KAL+AAL+QI R +GKG++M+LGS+ ++   +E VS+GSLGLDIALG+GG 
Sbjct: 12  KAVNGTDRQKALDAALAQIDRAFGKGSVMKLGSKEAM--QVEAVSTGSLGLDIALGVGGL 69

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           P+GR++EIYGPESSGKTTLALH IA++QK GGT AFVDAEHALD +YARKLGVD+  L++
Sbjct: 70  PRGRVIEIYGPESSGKTTLALHCIAEAQKIGGTAAFVDAEHALDPVYARKLGVDIDELIV 129

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPDTGEQALEI D LVRS A+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQ+LR
Sbjct: 130 SQPDTGEQALEIVDTLVRSNAIDVLVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQSLR 189

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLT SISRS+C+++FINQ+RMKIGVM+G+PETTTGGNALKFY+SVRLDIRR G IK+ D 
Sbjct: 190 KLTGSISRSRCMVIFINQLRMKIGVMYGNPETTTGGNALKFYASVRLDIRRTGQIKNGDE 249

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK+A PFKQVEFDIMYG+GIS  GE++D+GVKA +V+KSGAWFS+   
Sbjct: 250 IVGNTTRVKVVKNKVAPPFKQVEFDIMYGQGISKIGEILDIGVKAGLVEKSGAWFSYDSI 309

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
           R+GQGREN+K FL+EN E+   +E+ +R     VA+ ++  P  +   DA
Sbjct: 310 RIGQGRENAKTFLKENPELMGRLEAAIRGRTDAVAEEMMAGPDDDVGGDA 359


>gi|1172889|sp|P42447|RECA_RHOCA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|558631|emb|CAA57673.1| recA [Rhodobacter capsulatus]
 gi|1581748|prf||2117248A recA gene
          Length = 355

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 241/335 (71%), Positives = 283/335 (84%), Gaps = 4/335 (1%)

Query: 6   EMN---IVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIG 62
           EMN     DK KALE AL+QI+R +GKG+IM+LG      E IE  S+GSLGLDIALGIG
Sbjct: 8   EMNDKGKADKQKALECALAQIERQFGKGSIMKLGGDTPPPE-IEATSTGSLGLDIALGIG 66

Query: 63  GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNL 122
           G PKGRIVEIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA+KLGV L++L
Sbjct: 67  GLPKGRIVEIYGPESSGKTTLTLHCIAEEQKKGGVCAFVDAEHALDPYYAKKLGVSLEDL 126

Query: 123 LISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQA 182
           LISQPDTGEQALEI D LVRSGAV ++V+DSVAALTP+AEIEGDMG++  G QARLMSQA
Sbjct: 127 LISQPDTGEQALEIVDTLVRSGAVSLVVVDSVAALTPKAEIEGDMGDATVGAQARLMSQA 186

Query: 183 LRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDK 242
           +RKLT+SI RS C+++FINQ+RMKIGVMFGSPETT+GGNALKFY+SVRLDIRR G+IKD+
Sbjct: 187 MRKLTASIGRSNCMVIFINQIRMKIGVMFGSPETTSGGNALKFYASVRLDIRRTGAIKDR 246

Query: 243 DSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFK 302
           D + GNQTRVKVVKNK+A PF++VEFDI+YGEGIS  GEL+DLGVKA +V KSGAW+S+ 
Sbjct: 247 DEVIGNQTRVKVVKNKVAPPFREVEFDILYGEGISKVGELVDLGVKAGVVAKSGAWYSYG 306

Query: 303 GQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
            +R+GQGREN+K FLR+N +IA  IE  +R + GL
Sbjct: 307 DERIGQGRENAKQFLRDNPDIAYEIEDKIRASHGL 341


>gi|132219|sp|P16034|RECA_MAGMG RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|38868|emb|CAA35243.1| unnamed protein product [Magnetospirillum magnetotacticum]
          Length = 344

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/340 (69%), Positives = 289/340 (85%), Gaps = 2/340 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +D+ KALEAA+SQI+R +GKG+IM+LG +  + E  EVVS+  LGLD+ALGIGG P+GRI
Sbjct: 1   MDRQKALEAAVSQIERAFGKGSIMKLGGKDQVVE-TEVVSTRILGLDVALGIGGVPRGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +E+YGPESSGKTTLALH IA++QK GGTCAFVDAEHALD  YARKLG  L  LLIS+PD 
Sbjct: 60  IEVYGPESSGKTTLALHIIAEAQKKGGTCAFVDAEHALDPSYARKLGA-LDELLISEPDA 118

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVR GAVD++V+DSVAAL PR E+EG+MG++  G+ ARLMSQALRKLT S
Sbjct: 119 GEQALEIADTLVRPGAVDVLVVDSVAALVPRGELEGEMGDNHMGLHARLMSQALRKLTGS 178

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +S+SK I++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR++IRRVG+IKD+D + GNQ
Sbjct: 179 VSKSKTIVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMEIRRVGAIKDRDEVVGNQ 238

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFK V+FDIMYGEGIS  GELIDLGVKA++V KSGAWFS+   R+GQG
Sbjct: 239 TRVKVVKNKLAPPFKVVDFDIMYGEGISKMGELIDLGVKANVVKKSGAWFSYNSTRIGQG 298

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAIN 349
           REN+K FLR+N  +A  IE  +RQNAGL++++L   P ++
Sbjct: 299 RENAKQFLRDNPAMAAEIEGAIRQNAGLISEALAAVPDLD 338


>gi|330428558|gb|AEC19892.1| hypothetical protein PT7_1352 [Pusillimonas sp. T7-7]
          Length = 355

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 239/353 (67%), Positives = 294/353 (83%), Gaps = 2/353 (0%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +      ++SKAL AALSQI++ +GKG++M+ G   ++   I+VVS+GSLGLD+ALG
Sbjct: 1   MDDKNSKAAGERSKALAAALSQIEKQFGKGSVMRYGDD-TVEHDIQVVSTGSLGLDVALG 59

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           +GG P+GR+VEIYGPESSGKTTL L  IA+ QK GGTCAF+DAEHALD  YA KLGV+L 
Sbjct: 60  VGGLPRGRVVEIYGPESSGKTTLTLQVIAEMQKIGGTCAFIDAEHALDVQYASKLGVNLA 119

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
           +LLISQPDTGEQALEITD LVRSG+VD+IVIDSVAAL P+AEIEGDMG+SLPG+QARLMS
Sbjct: 120 DLLISQPDTGEQALEITDALVRSGSVDLIVIDSVAALVPKAEIEGDMGDSLPGLQARLMS 179

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLT++I R+ C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIK
Sbjct: 180 QALRKLTANIKRANCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIK 239

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
             D I GN+TRVKVVKNK+A PFKQ EFDIMYG GIS  GE+IDLGV+A IVDK+GAWFS
Sbjct: 240 KGDEIVGNETRVKVVKNKVAPPFKQAEFDIMYGGGISREGEIIDLGVQAGIVDKAGAWFS 299

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           + G R+GQG++NS+ +L+E+ E+A  IE+ +R+  G++   +     + T DD
Sbjct: 300 YSGTRIGQGKDNSREYLKEHPEMAFEIENRVREQLGVIP-QVAANKTVQTTDD 351


>gi|119383349|ref|YP_914405.1| recombinase A [Paracoccus denitrificans PD1222]
 gi|119373116|gb|ABL68709.1| recA protein [Paracoccus denitrificans PD1222]
          Length = 356

 Score =  491 bits (1263), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/327 (71%), Positives = 282/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG+   + E IE  S+GSLGLDIALGIGG PKGRI+
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGADNPVAE-IEATSTGSLGLDIALGIGGLPKGRII 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDTG
Sbjct: 75  EIFGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAV ++V+DSVAALTP++EIEGDMG+   G QARLMSQA+RKLT+SI
Sbjct: 135 EQALEIVDTLVRSGAVSLVVVDSVAALTPKSEIEGDMGDMQMGSQARLMSQAMRKLTASI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR GSIKD+D +TGN T
Sbjct: 195 GRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRAGSIKDRDEVTGNAT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QVEFDIMYGEGIS  GELIDLG+KA +V+KSG+W+S+  +R+GQGR
Sbjct: 255 RVKVVKNKVAPPFRQVEFDIMYGEGISKVGELIDLGIKAGVVEKSGSWYSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K FLR++ ++A  IE  +R + GL
Sbjct: 315 ENAKQFLRDHPDMAHAIEDKIRASHGL 341


>gi|117924908|ref|YP_865525.1| recA protein [Magnetococcus sp. MC-1]
 gi|117608664|gb|ABK44119.1| RecA protein [Magnetococcus sp. MC-1]
          Length = 390

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 238/342 (69%), Positives = 290/342 (84%), Gaps = 3/342 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKAL+AAL+QI+R +GKG+IM++ S+G+  + I VVS+GSLGLDIALG+GG P+GRIV
Sbjct: 15  DKSKALDAALAQIERQFGKGSIMRM-SEGAATD-IPVVSTGSLGLDIALGVGGLPRGRIV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTT+ALH  A+ QK GG  AFVDAEHALD IYARKLGV++  L+ISQPDTG
Sbjct: 73  EVYGPESSGKTTMALHVAAEIQKVGGVAAFVDAEHALDPIYARKLGVNVDELIISQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD++V+DSVAALTPRAE+EG+MG+S  G+QARLMSQALRKLT SI
Sbjct: 133 EQALEITDMLVRSGAVDLVVVDSVAALTPRAELEGEMGDSHVGLQARLMSQALRKLTGSI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKDK+ + GN+T
Sbjct: 193 SRSSSLVLFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDKEEVVGNRT 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PF+Q EFDI YG+G+S  GEL+D+GV+  +V+KSGAW+S+ G+R+GQGR
Sbjct: 253 RVKVVKNKMAPPFRQCEFDITYGQGVSLHGELLDMGVEMGVVEKSGAWYSYDGERIGQGR 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA-DSLLQEPAINTK 351
           EN+K ++ EN   A  +E  +R   GL A     Q PA  TK
Sbjct: 313 ENAKRYMAENPSAAMKLEDQIRLKEGLSAKHGAGQSPATETK 354


>gi|114771070|ref|ZP_01448510.1| recombinase A [alpha proteobacterium HTCC2255]
 gi|114548352|gb|EAU51238.1| recombinase A [alpha proteobacterium HTCC2255]
          Length = 362

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 241/353 (68%), Positives = 289/353 (81%), Gaps = 7/353 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KALE+AL QI+R +GKG+IM+LG + +  + IE  S+GSLGLDIALGIGG PKGRI
Sbjct: 14  MDKEKALESALGQIERQFGKGSIMKLGDESARLD-IEATSTGSLGLDIALGIGGLPKGRI 72

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YA++LGVD+  LLISQPD 
Sbjct: 73  IEIYGPESSGKTTLTLHAIAEEQKKGGVCAFVDAEHALDPTYAKRLGVDIDELLISQPDA 132

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEITD LVRSGAV ++V+DSVAALTPRAE+EGDMG+   G QARLMSQA+RKLT S
Sbjct: 133 GEQALEITDTLVRSGAVSMVVVDSVAALTPRAELEGDMGDHQVGAQARLMSQAMRKLTGS 192

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I++S C+++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVRLDIRR+G+IKD+D I GN 
Sbjct: 193 IAKSGCMVIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRLDIRRIGAIKDRDEIVGNH 252

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK++ PFKQVEFDIMYG+GIS  GELIDLGVK   V+KSG+WFS   +R+GQG
Sbjct: 253 TRVKVVKNKVSPPFKQVEFDIMYGQGISKRGELIDLGVKLGFVEKSGSWFSCGDERIGQG 312

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNV 362
           REN+K +L++N ++A  IE  +R   GL  D L  E       DA +DD ++V
Sbjct: 313 RENAKTYLKDNPKMAYEIEDKIRAAHGLDFDDLPPE------SDAPEDDINSV 359


>gi|260574638|ref|ZP_05842641.1| recA protein [Rhodobacter sp. SW2]
 gi|259023055|gb|EEW26348.1| recA protein [Rhodobacter sp. SW2]
          Length = 360

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 235/328 (71%), Positives = 281/328 (85%), Gaps = 1/328 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALE+AL+QI+R +GKG+IM+LG+     + IE  S+GSLGLDIALGIGG PKGRI
Sbjct: 15  MDKAKALESALAQIERQFGKGSIMKLGANSPAMD-IESTSTGSLGLDIALGIGGLPKGRI 73

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDT
Sbjct: 74  IEIYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDT 133

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAV ++VIDSVAAL P++EIEGDMG+   G QARLMSQA+RKLT+S
Sbjct: 134 GEQALEIVDTLVRSGAVSLVVIDSVAALVPKSEIEGDMGDMQMGSQARLMSQAMRKLTAS 193

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C++VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIKD+D + G+ 
Sbjct: 194 IGRSNCMVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKDRDEVVGSS 253

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNK+A PFKQVEFDIMYGEGIS  GELID+GVKA +V+KSG+W+S+  +R+GQG
Sbjct: 254 TRVKVVKNKVAPPFKQVEFDIMYGEGISKTGELIDIGVKAGVVEKSGSWYSYGDERIGQG 313

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGL 337
           REN+K+FL++N  +A  IE  +R   GL
Sbjct: 314 RENAKLFLKQNPAVAMEIEDKIRAANGL 341


>gi|3219852|sp|P95469|RECA_PARDE RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|1825468|gb|AAB51561.1| recA [Paracoccus denitrificans]
          Length = 356

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 281/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG+   + E IE  S+GSLGLDIALGIGG PKGRI+
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGADNPVAE-IEATSTGSLGLDIALGIGGLPKGRII 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDTG
Sbjct: 75  EIFGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LV SGAV ++V+DSVAALTP++EIEGDMG+   G QARLMSQA+RKLT+SI
Sbjct: 135 EQALEIVDTLVASGAVSLVVVDSVAALTPKSEIEGDMGDMQMGSQARLMSQAMRKLTASI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR GSIKD+D +TGN T
Sbjct: 195 GRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRAGSIKDRDEVTGNAT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QVEFDIMYGEGIS  GELIDLG+KA +V+KSG+W+S+  +R+GQGR
Sbjct: 255 RVKVVKNKVAPPFRQVEFDIMYGEGISKVGELIDLGIKAGVVEKSGSWYSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K FLR++ ++A  IE  +R + GL
Sbjct: 315 ENAKQFLRDHPDMAHAIEDKIRASHGL 341


>gi|330813880|ref|YP_004358119.1| RecA protein [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486975|gb|AEA81380.1| RecA protein [Candidatus Pelagibacter sp. IMCC9063]
          Length = 376

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 235/347 (67%), Positives = 293/347 (84%), Gaps = 2/347 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ K+L+AA+SQI   +GKG++M+LG Q  + + IE +S+GSL LDIALGIGG PK RIV
Sbjct: 20  ERQKSLDAAISQIDSNFGKGSVMKLG-QRQVMD-IESISTGSLSLDIALGIGGLPKSRIV 77

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLAL  IA++QK+GGTCAF+DAEHALD  YA+KLGV+  +LLISQPDTG
Sbjct: 78  EIYGPESSGKTTLALQVIAEAQKSGGTCAFIDAEHALDPSYAKKLGVNTTDLLISQPDTG 137

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGA+ ++V+DSVAALTPRAE+EG+MG+   G+QARLMSQALRKLT SI
Sbjct: 138 EQALEITDTLVRSGAISVLVVDSVAALTPRAELEGEMGDHHMGLQARLMSQALRKLTGSI 197

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+S  +++FINQ+RMKIGVMFGSPETT GGNALKFYSSVRLDIRR+G+IKD D I GNQT
Sbjct: 198 SKSNTMVIFINQIRMKIGVMFGSPETTAGGNALKFYSSVRLDIRRIGAIKDGDEIVGNQT 257

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK VEFDIMYG+GIS  GELIDLG KA IV+K+GAW+S+KG+++GQG+
Sbjct: 258 RVKVVKNKVAPPFKVVEFDIMYGKGISKLGELIDLGAKADIVEKAGAWYSYKGEKIGQGK 317

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           ENSK +L  N +I+  IE  +R NAGL++D ++  P+   K + +++
Sbjct: 318 ENSKEYLINNPKISAEIEMAIRANAGLISDKMMGNPSPKEKIETEEN 364


>gi|86138307|ref|ZP_01056881.1| recombinase A [Roseobacter sp. MED193]
 gi|85824832|gb|EAQ45033.1| recombinase A [Roseobacter sp. MED193]
          Length = 354

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/330 (72%), Positives = 283/330 (85%), Gaps = 2/330 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM++G  G+I E IE  S+GSLGLDIALGIGG P GRI+
Sbjct: 14  DKQKALDSALAQIERQFGKGSIMKMGD-GAIQE-IEASSTGSLGLDIALGIGGLPMGRII 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH  A+ QK GG CAFVDAEHALD  YA KLGVDL  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLHCAAEQQKKGGVCAFVDAEHALDPQYAAKLGVDLDELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAV+++++DSVAALTP++E+EGDMG+S  G+QARLMSQA+RKLT SI
Sbjct: 132 EQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGDMGDSNVGVQARLMSQAMRKLTGSI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD+D I GN T
Sbjct: 192 SRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKDRDEIVGNAT 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGV A +V+KSG+WFS+  +R+GQGR
Sbjct: 252 RVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVAAGVVNKSGSWFSYGDERIGQGR 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
           EN+K FLR++  IA +IE  +R   GL  D
Sbjct: 312 ENAKQFLRDHQSIAYDIEDKIRAAHGLEFD 341


>gi|121606843|ref|YP_984172.1| recombination protein RecA [Polaromonas naphthalenivorans CJ2]
 gi|254790441|sp|A1VUC3|RECA_POLNA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|120595812|gb|ABM39251.1| recA protein [Polaromonas naphthalenivorans CJ2]
          Length = 384

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 227/327 (69%), Positives = 286/327 (87%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K++AL  AL+QI++ +GKG IM+LG+ G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKARALAVALAQIEKQFGKGTIMKLGA-GEVIEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGTCAFVDAEHALD  YA+KLGV+L+ LLISQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVIAEMQKIGGTCAFVDAEHALDIQYAQKLGVNLQELLISQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D L RSGAVD+IVIDSVAALTP+AE+EG+MG+SLPG+QARLMSQALRKLT++I
Sbjct: 133 EQALEIVDSLTRSGAVDLIVIDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTATI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KKANCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+ASPFK  EFDI+YGEGIS  GE++DLGV   +V+K+GAW++++G+++GQGR
Sbjct: 253 RVKVVKNKVASPFKMAEFDILYGEGISRLGEVLDLGVANHVVEKAGAWYAYRGEKIGQGR 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +NS+ FL+EN  +A  IE+ +R+  G+
Sbjct: 313 DNSREFLKENPALAIEIENKVREALGI 339


>gi|312797180|ref|YP_004030102.1| RecA protein [Burkholderia rhizoxinica HKI 454]
 gi|312168955|emb|CBW75958.1| RecA protein [Burkholderia rhizoxinica HKI 454]
          Length = 376

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AALSQI++ +GKG+IM+LG  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 36  EKSKALAAALSQIEKQFGKGSIMRLG-HGEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 94

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGTCAF+DAEHALD  YA KLGV+   LLISQPDTG
Sbjct: 95  EIYGPESSGKTTLTLQVIAEMQKIGGTCAFIDAEHALDVQYASKLGVNASELLISQPDTG 154

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 155 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 214

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 215 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 274

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IV+K+GAW+S+ G+++GQG+
Sbjct: 275 RVKVVKNKVSPPFREAIFDILYGEGISRHGEIIDLGVQAKIVEKAGAWYSYNGEKIGQGK 334

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN ++A  IE+ +R++ G+VA
Sbjct: 335 DNAREFLRENPDLAREIENRVRESLGVVA 363


>gi|126726569|ref|ZP_01742410.1| recombinase A [Rhodobacterales bacterium HTCC2150]
 gi|126704432|gb|EBA03524.1| recombinase A [Rhodobacterales bacterium HTCC2150]
          Length = 358

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/327 (70%), Positives = 283/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL++ALSQI+R +GKG+IM+LG  G+  E I   S+GSLGLDIALGIGG PKGR++
Sbjct: 15  NKLKALDSALSQIERQFGKGSIMKLGQDGATQE-ISATSTGSLGLDIALGIGGLPKGRVI 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH+IA+ QK GG CAFVDAEHALD +YA+KLGV+L  LLISQPDTG
Sbjct: 74  EIYGPESSGKTTLTLHSIAEEQKLGGVCAFVDAEHALDPLYAKKLGVNLDELLISQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEIT+ LVRSGAV+++V+DSVAALTP+AE+EGDMG+   G QARLMSQA+RKLT +I
Sbjct: 134 EQALEITETLVRSGAVNMVVVDSVAALTPKAELEGDMGDRQVGAQARLMSQAMRKLTGAI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           ++S C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIKD+D + GN T
Sbjct: 194 NKSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIKDRDEVVGNTT 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDI+YGEGIS  GE+IDLGV A +++KSG+W+S+  +R+GQGR
Sbjct: 254 RVKVVKNKVAPPFKQVEFDIIYGEGISKMGEIIDLGVAAGLIEKSGSWYSYGDERIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN K FL+EN ++A  +E  +R + GL
Sbjct: 314 ENVKKFLKENDKVALELEDKIRASHGL 340


>gi|296114920|ref|ZP_06833567.1| protein recA (recombinase A) [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978521|gb|EFG85252.1| protein recA (recombinase A) [Gluconacetobacter hansenii ATCC
           23769]
          Length = 359

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 246/346 (71%), Positives = 297/346 (85%), Gaps = 6/346 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK KALE ALSQI+R +GKG+IM++G +      ++V+S+GSLGLDI LGIGG P+GRI
Sbjct: 20  IDKGKALEGALSQIERAFGKGSIMRMGERPKTE--VDVISTGSLGLDIGLGIGGLPRGRI 77

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTT+ALH IA++QK GGTCAF+DAEHALD  YARKLGVD+ +LLISQPD 
Sbjct: 78  VEIYGPESSGKTTMALHAIAEAQKKGGTCAFIDAEHALDPGYARKLGVDVDSLLISQPDA 137

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++VIDSVAAL PRAE+EG+MG+S  G+ ARLMSQALRKLT S
Sbjct: 138 GEQALEIADTLVRSGAIDVLVIDSVAALVPRAELEGEMGDSHVGLHARLMSQALRKLTGS 197

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           +SRS  +++F+NQ+R+KIGVMFGSPETTTGGNALKFY+SVR+DIRR+GSIKDKD + GNQ
Sbjct: 198 VSRSNTMMIFLNQIRLKIGVMFGSPETTTGGNALKFYASVRMDIRRIGSIKDKDEVVGNQ 257

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDIMYGEGIS  GELIDLGVKA IV+KSGAWFS   QR+GQG
Sbjct: 258 TRVKVVKNKMAPPFRQVEFDIMYGEGISKMGELIDLGVKAGIVEKSGAWFSCDSQRIGQG 317

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           REN+K FLR++ E+A +IE  +R+ AG+VA+++L  P     DDA+
Sbjct: 318 RENAKQFLRDHPEMAADIERRVREQAGVVAEAMLVGP----DDDAE 359


>gi|67906614|gb|AAY82716.1| predicted recombination protein RecA [uncultured bacterium]
          Length = 370

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/357 (64%), Positives = 297/357 (83%), Gaps = 2/357 (0%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           K++   +K+KAL+AA+SQI   +GKG++M+LG + ++   IE + +GSL LD+ALGIGGF
Sbjct: 15  KDLENKEKNKALDAAISQITDNFGKGSVMKLGQKKAM--DIESIFTGSLSLDLALGIGGF 72

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           PKGRIVEIYGPESSGKTTLAL  +A++QK+GG CAFVDAEHALD +YA+KLGV+ + LLI
Sbjct: 73  PKGRIVEIYGPESSGKTTLALQVVAEAQKSGGICAFVDAEHALDPVYAKKLGVNTEELLI 132

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPD GEQALEI D LV+SG++ +IVIDSVAALTPRAEIEGDMG+   G+Q+RLMSQALR
Sbjct: 133 SQPDAGEQALEIADTLVKSGSISVIVIDSVAALTPRAEIEGDMGDHHVGLQSRLMSQALR 192

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLTSSIS +  +++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVR+DIRR+G+IKDKD+
Sbjct: 193 KLTSSISNTNTMMIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRMDIRRIGAIKDKDA 252

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK++ PFK VEFD+MYG+GIS  GELIDLG KA IV+KSGAW+++KG+
Sbjct: 253 IIGNSTRVKVVKNKVSPPFKVVEFDLMYGKGISKVGELIDLGAKAEIVEKSGAWYAYKGE 312

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDN 361
           ++GQGREN+KI+L +N ++A  IE  +R+ AG++   +   P    K+ ++    D+
Sbjct: 313 KIGQGRENAKIYLEQNPKVAAEIEMAIREKAGVITKKIEGNPLDQEKNRSEPKRRDS 369


>gi|197104451|ref|YP_002129828.1| recombinase A protein [Phenylobacterium zucineum HLK1]
 gi|196477871|gb|ACG77399.1| recombinase A protein [Phenylobacterium zucineum HLK1]
          Length = 361

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 243/345 (70%), Positives = 295/345 (85%), Gaps = 1/345 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K +ALEAAL+QI R +GKG++M+LG +G I E IE VS+GSLGLD+ALGIGG PKGRIV
Sbjct: 15  EKQRALEAALAQIDRAFGKGSVMKLGDKGKIVE-IESVSTGSLGLDMALGIGGLPKGRIV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALH +A+ QK GGT AFVDAEHALD  YA KLGV+L +LL++QPDTG
Sbjct: 74  EIYGPESSGKTTLALHVVAEVQKAGGTAAFVDAEHALDPSYAHKLGVNLDDLLVAQPDTG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRS AVD+IV+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+SI
Sbjct: 134 EQALEITDTLVRSNAVDVIVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTASI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S++K +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR GS+K +D I GN  
Sbjct: 194 SKAKTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSVKQRDEIVGNNV 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++VEFDIMYGEGIS  GE+IDLGVKA +V+K+G+WFSF  QR+GQGR
Sbjct: 254 RVKVVKNKVAPPFREVEFDIMYGEGISKLGEIIDLGVKAGVVEKAGSWFSFNSQRIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           +N + FL++N +IAE IE+ +R     + + LL  P+    D+AD
Sbjct: 314 DNVREFLKQNPDIAEQIEAKVRGAKSAIEEELLVGPSEGEGDEAD 358


>gi|254489873|ref|ZP_05103068.1| protein RecA [Methylophaga thiooxidans DMS010]
 gi|224464958|gb|EEF81212.1| protein RecA [Methylophaga thiooxydans DMS010]
          Length = 347

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/323 (71%), Positives = 281/323 (86%), Gaps = 1/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKGA+M++G  G+  + I  VS+GS+GLD+ALGIGG P+GR++
Sbjct: 4   NKKKALGAALGQIEKQFGKGAVMRMGDAGAARD-IAAVSTGSIGLDVALGIGGLPRGRVI 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GGT AFVDAEHALD +YA KLGVD+ +LL+SQPDTG
Sbjct: 63  EIYGPESSGKTTLTLHAIAEMQKMGGTAAFVDAEHALDPVYAEKLGVDIDDLLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVDI+V+DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEITDMLVRSGAVDIVVVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IK  D I GN+T
Sbjct: 183 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKKGDEILGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGV  ++V+KSGAW+S+ G R+GQG+
Sbjct: 243 RVKVVKNKVAPPFKQVEFDILYGEGISREGELIDLGVSQNLVEKSGAWYSYNGTRIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
           +N + FLREN E+A  IE+ +R+
Sbjct: 303 DNVRAFLRENTEMAAEIEAKIRE 325


>gi|315499501|ref|YP_004088304.1| reca protein [Asticcacaulis excentricus CB 48]
 gi|315417513|gb|ADU14153.1| recA protein [Asticcacaulis excentricus CB 48]
          Length = 356

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 293/336 (87%), Gaps = 1/336 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K +ALE+AL+QI R +GKG++M+LG+ G + E +E +S+GSLGLD+ALGIGG PKGR++
Sbjct: 15  EKQRALESALAQIDRAFGKGSVMKLGNAGKVVE-VESISTGSLGLDMALGIGGLPKGRVI 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALHT+A+ QK GGT AFVDAEHALD +YA KLGV+L +LL+SQPD G
Sbjct: 74  EIYGPESSGKTTLALHTVAEIQKAGGTAAFVDAEHALDPVYAHKLGVNLDDLLVSQPDNG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAVDI+V+DSVAALTP+AEIEGDMG+SLPG+QARLMSQALRKLT+SI
Sbjct: 134 EQALEITDTLVRSGAVDIVVVDSVAALTPKAEIEGDMGDSLPGLQARLMSQALRKLTASI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+SKCI++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIR +G IK +D I GN  
Sbjct: 194 SKSKCIVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRSIGKIKVRDEIVGNNV 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++VEFDI+YGEGIS  GE++DLGVK  +V+K+G+WFSF   R+GQGR
Sbjct: 254 RVKVVKNKVAPPFREVEFDILYGEGISKLGEVLDLGVKGGVVEKAGSWFSFNSIRIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           EN++ FL+ N EIA  IE+L+R+ +  +++ LL  P
Sbjct: 314 ENARDFLKSNPEIAAEIEALVRKKSDAISEELLGTP 349


>gi|254456368|ref|ZP_05069797.1| protein RecA [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083370|gb|EDZ60796.1| protein RecA [Candidatus Pelagibacter sp. HTCC7211]
          Length = 382

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/359 (64%), Positives = 296/359 (82%), Gaps = 7/359 (1%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           +EM+I +K+KAL+AA++QI   +GKG++M+LG + ++   IE VS+GSL LD+ALGIGG 
Sbjct: 15  QEMDIKEKNKALDAAIAQITDNFGKGSVMKLGQKRAM--DIESVSTGSLSLDLALGIGGL 72

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           PKGRIVE+YGPESSGKTTLAL  +A++QK GG CAFVDAEHALD +YA+KLGV+ + LLI
Sbjct: 73  PKGRIVEVYGPESSGKTTLALQVVAEAQKAGGICAFVDAEHALDPVYAKKLGVNTEELLI 132

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPD GEQALEI D LV+SG++ +IVIDSVAALTP+AEIEG+MG+   G+Q+RLMSQALR
Sbjct: 133 SQPDAGEQALEIADTLVKSGSISVIVIDSVAALTPKAEIEGEMGDHHVGLQSRLMSQALR 192

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLTSSIS +  +++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVR+DIRR+G+IKDKD 
Sbjct: 193 KLTSSISNTNTMMIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRMDIRRIGAIKDKDE 252

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK+A PFK VEFD+MYG+GIS  GEL+DLG KA I++KSGAW+++KG+
Sbjct: 253 IIGNSTRVKVVKNKVAPPFKVVEFDLMYGKGISKMGELVDLGSKADIIEKSGAWYAYKGE 312

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE 363
           ++GQGREN+K +L +N ++A  IE  +R+ AG++   +   P      D +K   D +E
Sbjct: 313 KIGQGRENAKTYLAQNPKVAAEIELAIREKAGVIQKKIEGNPL-----DPEKAAKDQIE 366


>gi|311350401|gb|ADP92399.1| recombinase [Burkholderia stabilis]
          Length = 338

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/327 (70%), Positives = 285/327 (87%), Gaps = 1/327 (0%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEI
Sbjct: 1   SKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQ
Sbjct: 60  YGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R
Sbjct: 120 ALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKR 179

Query: 193 SKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRV 252
           + C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRV
Sbjct: 180 TNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRV 239

Query: 253 KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGREN 312
           KVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N
Sbjct: 240 KVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDN 299

Query: 313 SKIFLRENIEIAENIESLLRQNAGLVA 339
           ++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 AREFLRENPEIAREIENRIRESLGVVA 326


>gi|209967935|gb|ACB38233.2| RecA [Burkholderia cepacia]
          Length = 338

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 284/326 (87%), Gaps = 1/326 (0%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEI
Sbjct: 1   SKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQ
Sbjct: 60  YGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R
Sbjct: 120 ALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKR 179

Query: 193 SKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRV 252
           + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRV
Sbjct: 180 TNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRV 239

Query: 253 KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGREN 312
           KVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N
Sbjct: 240 KVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDN 299

Query: 313 SKIFLRENIEIAENIESLLRQNAGLV 338
           ++ FLREN EIA  IE+ +R++ G+V
Sbjct: 300 AREFLRENPEIAREIENRIRESLGVV 325


>gi|272894040|gb|ACZ96546.1| RecA [Burkholderia contaminans]
          Length = 343

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 284/326 (87%), Gaps = 1/326 (0%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEI
Sbjct: 1   SKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQ
Sbjct: 60  YGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R
Sbjct: 120 ALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKR 179

Query: 193 SKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRV 252
           + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRV
Sbjct: 180 TNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRV 239

Query: 253 KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGREN 312
           KVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N
Sbjct: 240 KVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDN 299

Query: 313 SKIFLRENIEIAENIESLLRQNAGLV 338
           ++ FLREN EIA  IE+ +R++ G+V
Sbjct: 300 AREFLRENPEIAREIENRIRESLGVV 325


>gi|160858118|emb|CAP18006.1| DNA recombinase [Burkholderia contaminans]
 gi|160858120|emb|CAP18007.1| DNA recombinase [Burkholderia contaminans]
          Length = 338

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 284/326 (87%), Gaps = 1/326 (0%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEI
Sbjct: 1   SKALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQ
Sbjct: 60  YGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R
Sbjct: 120 ALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKR 179

Query: 193 SKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRV 252
           + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRV
Sbjct: 180 TNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRV 239

Query: 253 KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGREN 312
           KVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N
Sbjct: 240 KVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDN 299

Query: 313 SKIFLRENIEIAENIESLLRQNAGLV 338
           ++ FLREN EIA  IE+ +R++ G+V
Sbjct: 300 AREFLRENPEIAREIENRIRESLGVV 325


>gi|209967941|gb|ACB12745.2| RecA [Burkholderia cepacia]
          Length = 338

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 228/326 (69%), Positives = 284/326 (87%), Gaps = 1/326 (0%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEI
Sbjct: 1   SKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPES+GKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQ
Sbjct: 60  YGPESTGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R
Sbjct: 120 ALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKR 179

Query: 193 SKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRV 252
           + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRV
Sbjct: 180 TNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRV 239

Query: 253 KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGREN 312
           KVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N
Sbjct: 240 KVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDN 299

Query: 313 SKIFLRENIEIAENIESLLRQNAGLV 338
           ++ FLREN EIA  IE+ +R++ G+V
Sbjct: 300 AREFLRENPEIAREIENRIRESLGVV 325


>gi|198283178|ref|YP_002219499.1| recA protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665991|ref|YP_002425407.1| recA protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226723623|sp|B5EQ47|RECA_ACIF5 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|226737749|sp|B7J7A9|RECA_ACIF2 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|198247699|gb|ACH83292.1| recA protein [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518204|gb|ACK78790.1| recA protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 345

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/324 (70%), Positives = 278/324 (85%), Gaps = 1/324 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           +SKAL AALSQI + +GKGA+M+LG   +I + IEV S+GSLGLD+ALG+GG P+GR+VE
Sbjct: 5   RSKALSAALSQIDKQFGKGAVMRLGDHNAI-KDIEVYSTGSLGLDLALGVGGLPRGRVVE 63

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTL LH IA  Q  GGT AF+DAEHALD  YA KLGVDL+NLLISQPDTGE
Sbjct: 64  IYGPESSGKTTLTLHAIASCQAAGGTAAFIDAEHALDPGYAHKLGVDLENLLISQPDTGE 123

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEI DMLVRSGAVD+IVIDSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT++IS
Sbjct: 124 QALEIADMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTANIS 183

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
           R+  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK  D + GN TR
Sbjct: 184 RTNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKKSDEVVGNDTR 243

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNK+A PF++ EF I YGEGIS   EL+DLGVK  IV+KSGAW+S++G+R+GQG++
Sbjct: 244 VKVVKNKVAPPFREAEFAIYYGEGISRLSELVDLGVKFDIVEKSGAWYSYQGERIGQGKD 303

Query: 312 NSKIFLRENIEIAENIESLLRQNA 335
           N++ +L+E+ E+A NIE  +R  A
Sbjct: 304 NARQYLKEHPELAANIEQRIRAAA 327


>gi|90416732|ref|ZP_01224662.1| recombinase A [marine gamma proteobacterium HTCC2207]
 gi|90331485|gb|EAS46721.1| recombinase A [marine gamma proteobacterium HTCC2207]
          Length = 340

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 275/323 (85%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKALEAAL QI+R +GKG +M++G      + I  +S+GSLGLDIALGIGG PKGRIV
Sbjct: 4   NKSKALEAALGQIERQFGKGTVMRMGE--GTRQAIPAISTGSLGLDIALGIGGLPKGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK GGTCAF+DAEHALD +YA KLGV + +L++SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKAGGTCAFIDAEHALDPVYAEKLGVSVDDLIVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALE+TDMLVRSGA D++V+DSVAALTPRAEIEGDMG+   G+QARLMSQALRKLT +I
Sbjct: 122 EQALEVTDMLVRSGACDVLVVDSVAALTPRAEIEGDMGDHHVGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G++KD D I GN+T
Sbjct: 182 KNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAVKDGDEIVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ EF I+YG GI+  GEL+DLGVK  ++DKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVAPPFKQTEFQILYGRGINRNGELVDLGVKNGLIDKSGAWYAYKGSKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N  I+L EN EIA  IE+++R+
Sbjct: 302 ANVGIYLTENPEIAAEIEAMIRE 324


>gi|25991655|gb|AAN76868.1| RecA [Burkholderia ambifaria]
 gi|25991657|gb|AAN76869.1| RecA [Burkholderia cepacia]
 gi|25991659|gb|AAN76870.1| RecA [Burkholderia ambifaria]
 gi|25991663|gb|AAN76872.1| RecA [Burkholderia ambifaria]
 gi|54633824|gb|AAV36022.1| RecA [Burkholderia sp. KBC-6]
 gi|54633826|gb|AAV36023.1| RecA [Burkholderia sp. KBC-7]
          Length = 336

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/340 (67%), Positives = 289/340 (85%), Gaps = 4/340 (1%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
            FLREN EIA  IE+ +R++ G+V    + E A    D+A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVT---MPEGAAAVHDEA 336


>gi|25991665|gb|AAN76873.1| RecA [Burkholderia cepacia]
 gi|25991671|gb|AAN76876.1| RecA [Burkholderia cepacia]
 gi|25991687|gb|AAN76884.1| RecA [Burkholderia cepacia]
 gi|25991769|gb|AAN76925.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|66275520|gb|AAY44023.1| RecA [Burkholderia vietnamiensis]
 gi|70904905|gb|AAZ14030.1| RecA [Burkholderia vietnamiensis]
          Length = 328

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 284/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991739|gb|AAN76910.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 284/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991703|gb|AAN76892.1| RecA [Burkholderia vietnamiensis]
 gi|25991705|gb|AAN76893.1| RecA [Burkholderia vietnamiensis]
          Length = 333

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 284/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991731|gb|AAN76906.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 284/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|70904847|gb|AAZ14003.1| RecA [Burkholderia cepacia]
          Length = 326

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991683|gb|AAN76882.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991681|gb|AAN76881.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALPAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991667|gb|AAN76874.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|54633822|gb|AAV36021.1| RecA [Burkholderia sp. KBC-5]
          Length = 336

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/340 (67%), Positives = 289/340 (85%), Gaps = 4/340 (1%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
            FLREN EIA  IE+ +R++ G+V    + E A    D+A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVT---MPEGAAAVYDEA 336


>gi|224551681|gb|ACN54240.1| RecA [Burkholderia sp. LWAT21]
          Length = 325

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|319431773|gb|ADP92383.2| recombinase [Burkholderia multivorans]
          Length = 333

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/326 (69%), Positives = 284/326 (87%), Gaps = 1/326 (0%)

Query: 14  KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73
           KAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIY
Sbjct: 1   KALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIY 59

Query: 74  GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133
           GPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQA
Sbjct: 60  GPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQA 119

Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193
           LEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+
Sbjct: 120 LEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRT 179

Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253
            C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVK
Sbjct: 180 NCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVK 239

Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313
           VVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N+
Sbjct: 240 VVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNA 299

Query: 314 KIFLRENIEIAENIESLLRQNAGLVA 339
           + FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 REFLRENPEIAREIENRIRESLGVAA 325


>gi|224551679|gb|ACN54239.1| RecA [Burkholderia sp. LWAT18]
          Length = 334

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|70904853|gb|AAZ14006.1| RecA [Burkholderia cepacia]
          Length = 326

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GDATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991751|gb|AAN76916.1| RecA [Burkholderia cenocepacia]
          Length = 333

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991661|gb|AAN76871.1| RecA [Burkholderia ambifaria]
          Length = 336

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 229/340 (67%), Positives = 289/340 (85%), Gaps = 4/340 (1%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA K+GV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKVGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
            FLREN EIA  IE+ +R++ G+V    + E A    D+A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVT---MPEGAAAVHDEA 336


>gi|163746279|ref|ZP_02153637.1| recombinase A [Oceanibulbus indolifex HEL-45]
 gi|161380164|gb|EDQ04575.1| recombinase A [Oceanibulbus indolifex HEL-45]
          Length = 356

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 241/355 (67%), Positives = 296/355 (83%), Gaps = 11/355 (3%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K     +K KAL++AL+QI+R +GKG+IM+LG++G++ + I   S+GSLGLDIALG
Sbjct: 9   MDSKK---TAEKQKALDSALAQIERQFGKGSIMKLGAEGAV-QDIRASSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG P GRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGVD+ 
Sbjct: 65  IGGLPMGRIIEIYGPESSGKTTLTLHCVAEQQKAGGVCAFVDAEHALDPQYAKKLGVDID 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEITD LVRSGAV+++++DSVAALTP++E+EG+MG+S  G+QARLMS
Sbjct: 125 ELLISQPDTGEQALEITDTLVRSGAVNMVIVDSVAALTPKSELEGEMGDSSVGVQARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++K
Sbjct: 185 QAMRKLTGSISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGALK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D + GN T+VKVVKNK+A PFKQVEFDIMYGEGIS  GEL+DLGVKA +VDKSG+WFS
Sbjct: 245 DRDEVVGNATKVKVVKNKVAPPFKQVEFDIMYGEGISKMGELLDLGVKAGVVDKSGSWFS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           +  +R+GQGREN+K FL+EN  +A  IE  +R   GL       + A   +DDAD
Sbjct: 305 YGDERIGQGRENAKNFLKENTAMAAEIEDKIRAAHGL-------DSAGPGRDDAD 352


>gi|25229187|gb|AAN74663.1| RecA [Burkholderia pyrrocinia]
          Length = 333

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 284/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991721|gb|AAN76901.1| RecA [Burkholderia cenocepacia]
          Length = 333

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVS 324


>gi|91762224|ref|ZP_01264189.1| recA protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718026|gb|EAS84676.1| recA protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 383

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/365 (62%), Positives = 295/365 (80%), Gaps = 16/365 (4%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL+AA+SQI   +GKG++M+LG + ++   +E +S+GSL LD+ALGIGG PKGR++
Sbjct: 21  EKNKALDAAMSQIIDNFGKGSVMKLGQRRAM--DVESISTGSLSLDVALGIGGLPKGRVI 78

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTLAL  +A++QK GG CAF+DAEHALD IYA+KLGVD + LLISQPDTG
Sbjct: 79  EVYGPESSGKTTLALQVLAEAQKAGGICAFIDAEHALDPIYAKKLGVDTEELLISQPDTG 138

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LV+SG++ +IVIDSVAALTPRAEIEG+MG+   G+Q+RLMSQALRKLT SI
Sbjct: 139 EQALEIADTLVKSGSISVIVIDSVAALTPRAEIEGEMGDHHVGLQSRLMSQALRKLTGSI 198

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S +  +++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVR+DIRR+G+IK+ D I GN T
Sbjct: 199 SSTNTMMIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRMDIRRIGAIKNGDEIIGNST 258

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK VEFD+MYG+GIS  GEL+DLG KA IV+K+GAW+++KG+++GQGR
Sbjct: 259 RVKVVKNKVAPPFKVVEFDLMYGKGISKVGELVDLGAKADIVEKAGAWYAYKGEKIGQGR 318

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSL--------------LQEPAINTKDDADK 356
           EN+KI+L +N +IA  IE  +R+ AG++A  +              ++EP + TK++   
Sbjct: 319 ENAKIYLEQNPQIAAEIEMAIREKAGVIAKKIEGNPLDPEKAAKDQIEEPKLETKEEVTP 378

Query: 357 DDTDN 361
               N
Sbjct: 379 PSKKN 383


>gi|25991713|gb|AAN76897.1| RecA [Burkholderia cepacia]
 gi|25991737|gb|AAN76909.1| RecA [Burkholderia cepacia]
 gi|25991759|gb|AAN76920.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991757|gb|AAN76919.1| RecA [Burkholderia cenocepacia]
          Length = 333

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVS 324


>gi|150171054|emb|CAO01510.1| DNA recombination protein [Burkholderia seminalis]
          Length = 338

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/327 (69%), Positives = 284/327 (86%), Gaps = 1/327 (0%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEI
Sbjct: 1   SKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQ
Sbjct: 60  YGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R
Sbjct: 120 ALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKR 179

Query: 193 SKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRV 252
           + C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRV
Sbjct: 180 TNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRV 239

Query: 253 KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGREN 312
           KVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N
Sbjct: 240 KVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDN 299

Query: 313 SKIFLRENIEIAENIESLLRQNAGLVA 339
           ++ FLREN EIA  IE+ +R++ G+ +
Sbjct: 300 AREFLRENPEIAREIENRIRESLGVAS 326


>gi|25991693|gb|AAN76887.1| RecA [Burkholderia cenocepacia]
 gi|25991697|gb|AAN76889.1| RecA [Burkholderia cenocepacia]
 gi|25991699|gb|AAN76890.1| RecA [Burkholderia cenocepacia]
 gi|25991741|gb|AAN76911.1| RecA [Burkholderia cenocepacia]
          Length = 333

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVS 324


>gi|329849340|ref|ZP_08264186.1| protein RecA [Asticcacaulis biprosthecum C19]
 gi|328841251|gb|EGF90821.1| protein RecA [Asticcacaulis biprosthecum C19]
          Length = 360

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 238/345 (68%), Positives = 290/345 (84%), Gaps = 1/345 (0%)

Query: 8   NIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKG 67
           N  +K +ALEAAL+QI R +GKG++M+LG  G I E +E +S+GSLGLDIALGIGG PKG
Sbjct: 12  NESEKQRALEAALAQIDRAFGKGSVMRLGVGGKIAE-VESISTGSLGLDIALGIGGLPKG 70

Query: 68  RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQP 127
           R++EIYGPESSGKTTLALHT+A+ QK GGT AFVDAEHALD  YA KLGV+L+ LL+SQP
Sbjct: 71  RVIEIYGPESSGKTTLALHTVAEIQKAGGTAAFVDAEHALDPTYAGKLGVNLEELLVSQP 130

Query: 128 DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLT 187
           D GEQALEITD LVRSGAVDI+V+DSVAALTPRAEIEGDMG+SLPG+QARLMSQALRKLT
Sbjct: 131 DNGEQALEITDTLVRSGAVDIVVVDSVAALTPRAEIEGDMGDSLPGLQARLMSQALRKLT 190

Query: 188 SSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITG 247
            SIS+SKCI++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIR +G IK +D I G
Sbjct: 191 GSISKSKCIVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRSIGKIKVRDEIIG 250

Query: 248 NQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLG 307
           N  +VKVVKNK+A PF++VEFDI+YG+GIS  GE+ID+GVKASI++K+G+WFS+   R+G
Sbjct: 251 NNVKVKVVKNKVAPPFREVEFDILYGQGISKLGEIIDMGVKASIIEKAGSWFSYNSTRIG 310

Query: 308 QGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKD 352
           QGREN++ FL+ N E+   IE  +R     +++ LL  P  +  D
Sbjct: 311 QGRENARDFLKANPEMTAEIEKAIRNKTDKLSEELLGTPEPDAND 355


>gi|145590013|ref|YP_001156610.1| recA protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145048419|gb|ABP35046.1| RecA protein [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 363

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/327 (69%), Positives = 280/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL AAL+QI++ +GKG+IM+LG    I + I+VVSSGSLGLDIALG+GG  +GR++
Sbjct: 20  DKQKALTAALAQIEKQFGKGSIMRLG-DAEISQDIQVVSSGSLGLDIALGVGGLARGRVI 78

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GGTCAF+DAEHALD  YA +LGVD+ NLLISQPDTG
Sbjct: 79  EIYGPESSGKTTLTLHAIAEMQKLGGTCAFIDAEHALDVQYASRLGVDVNNLLISQPDTG 138

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL PRAEIEGDMG+SLPG+QARLMSQALRKLT +I
Sbjct: 139 EQALEIADALVRSGSIDLIVIDSVAALVPRAEIEGDMGDSLPGLQARLMSQALRKLTGAI 198

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+   ++FINQ+RMKIGVMFGSPETTTGGNALKFY+S+RLDIRR+GSIK  D + GN+T
Sbjct: 199 KRTNTTVIFINQIRMKIGVMFGSPETTTGGNALKFYASMRLDIRRIGSIKKGDEVVGNET 258

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDIMYG GIS  GE+ID+GV+A IVDKSG+W+S+ G R+GQG+
Sbjct: 259 RVKVVKNKVSPPFREAIFDIMYGAGISREGEIIDMGVEADIVDKSGSWYSYNGDRIGQGK 318

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +N + FL+EN  IA++IE+ +R+  G+
Sbjct: 319 DNVREFLKENPAIAKDIEAKIREKLGV 345


>gi|119713373|gb|ABL97436.1| recA DNA recombination protein [uncultured marine bacterium
           EB80_69G07]
          Length = 382

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 223/342 (65%), Positives = 289/342 (84%), Gaps = 2/342 (0%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           +E++I +K+KAL+AA+SQI   +GKG++M+LG + ++   IE +S+GSL LD+ALGIGG 
Sbjct: 15  QELDIKEKNKALDAAISQITDNFGKGSVMKLGEKRAM--DIESISTGSLSLDLALGIGGL 72

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           PKGRI+E+YGPESSGKTTLAL  +A++QK GG CAFVDAEHALD +YA+KLGV+ + LLI
Sbjct: 73  PKGRIIEVYGPESSGKTTLALQVVAEAQKAGGICAFVDAEHALDPVYAKKLGVNTEELLI 132

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPD GEQALEI D LV+SG++ +IVIDSVAALTP+AEIEG+MG+   G+Q+RLMSQALR
Sbjct: 133 SQPDAGEQALEIADTLVKSGSISVIVIDSVAALTPKAEIEGEMGDHHVGLQSRLMSQALR 192

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLT SIS +  +++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVR+DIRR+G+IKDKD 
Sbjct: 193 KLTGSISNTNTMMIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRMDIRRIGAIKDKDE 252

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           I GN TRVKVVKNK+A PFK VEFD+MYG GIS  GEL+DLG KA I++KSGAW+++KG+
Sbjct: 253 IIGNTTRVKVVKNKVAPPFKVVEFDLMYGRGISKMGELVDLGAKADIIEKSGAWYAYKGE 312

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
           ++GQGREN+K +L +N ++A  IE  +R+ AG+++  +   P
Sbjct: 313 KIGQGRENAKTYLAQNPKVAAEIEMAIREKAGVISKKIEGNP 354


>gi|25991727|gb|AAN76904.1| RecA [Burkholderia cenocepacia]
          Length = 333

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|70904894|gb|AAZ14025.1| RecA [Burkholderia cenocepacia]
          Length = 332

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVS 324


>gi|54633814|gb|AAV36017.1| RecA [Burkholderia sp. KBC-1]
          Length = 328

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 283/324 (87%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|119468993|ref|ZP_01612018.1| RecA protein (Recombinase A) [Alteromonadales bacterium TW-7]
 gi|119447645|gb|EAW28912.1| RecA protein (Recombinase A) [Alteromonadales bacterium TW-7]
          Length = 347

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 236/352 (67%), Positives = 286/352 (81%), Gaps = 11/352 (3%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AALSQI+R +GKG+IM+LG   ++   I+ VS+GSLG+DIALGIGG P GRIV
Sbjct: 4   NKQKALDAALSQIERQFGKGSIMKLGDNKAL--NIDAVSTGSLGIDIALGIGGLPMGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTL L  IAQ+QK G TCAFVDAEHALD +YA+KLGV++  LL+SQPDTG
Sbjct: 62  EVYGPESSGKTTLTLQVIAQAQKEGKTCAFVDAEHALDPVYAQKLGVNIDELLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRS AVD++++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT +I
Sbjct: 122 EQALEICDMLVRSSAVDVVIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR+DIRR+GS+K+ D + GN+T
Sbjct: 182 KRSNTLCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRIDIRRIGSVKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVK+VKNK+A PFKQ EF IMYGEGIS  GELIDLGVK  IV+K+GAW+S+ G ++GQG+
Sbjct: 242 RVKIVKNKVAPPFKQAEFIIMYGEGISKQGELIDLGVKHKIVEKAGAWYSYNGNKVGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD--KDDTD 360
            NS  FL+EN+EIA  IE  LR       D LL +  I  +D  D   DD D
Sbjct: 302 NNSIKFLKENVEIANEIEGKLR-------DMLLLKATIEPEDGEDVLGDDAD 346


>gi|242133652|gb|ACS87937.1| RecA [Burkholderia cepacia]
 gi|242133654|gb|ACS87938.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991729|gb|AAN76905.1| RecA [Burkholderia cenocepacia]
          Length = 333

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVS 324


>gi|25991685|gb|AAN76883.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALPAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|25991669|gb|AAN76875.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|25229197|gb|AAN74668.1| RecA [Burkholderia cepacia]
 gi|25229199|gb|AAN74669.1| RecA [Burkholderia cepacia]
 gi|25991695|gb|AAN76888.1| RecA [Burkholderia cepacia]
 gi|25991755|gb|AAN76918.1| RecA [Burkholderia cepacia]
 gi|54633818|gb|AAV36019.1| RecA [Burkholderia sp. KBC-3]
          Length = 333

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|30313402|gb|AAM55295.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|70904892|gb|AAZ14024.1| RecA [Burkholderia cenocepacia]
          Length = 330

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVS 324


>gi|25991745|gb|AAN76913.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 229/333 (68%), Positives = 287/333 (86%), Gaps = 3/333 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GDATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA--DSLLQE 345
            FLREN EIA  IE+ +R++ G+V+  D ++ E
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVSMPDGVVHE 332


>gi|25991763|gb|AAN76922.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|89092117|ref|ZP_01165072.1| recombinase A [Oceanospirillum sp. MED92]
 gi|89083852|gb|EAR63069.1| recombinase A [Oceanospirillum sp. MED92]
          Length = 346

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/353 (66%), Positives = 285/353 (80%), Gaps = 12/353 (3%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL+AALSQI+R +GKGA+M++G Q    E I  VS+GSLGLDIALGIGG P GRIV
Sbjct: 4   NRKKALDAALSQIERQFGKGAVMRMGDQPR--EAIPSVSTGSLGLDIALGIGGLPYGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A++QK G TCAFVDAEHALD IYA KLGVD+ +LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVVAEAQKQGKTCAFVDAEHALDPIYAEKLGVDVDSLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRS AVD+I++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT ++
Sbjct: 122 EQALEITDMLVRSNAVDVIIVDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTGNV 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             S C+LVFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR G+IK  D + GN+T
Sbjct: 182 KSSNCLLVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGAIKQGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF+Q EF IMYG+GI   GE+IDLGVK  +VDKSGAW+++ G ++GQG+
Sbjct: 242 RVKVVKNKVSPPFRQAEFQIMYGQGIYHMGEVIDLGVKEGLVDKSGAWYAYNGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE 363
            N+  FL EN +IA  IE+ LR         LL  P       A++D+++N++
Sbjct: 302 ANASKFLEENPQIANEIETELRSR-------LLSNP---LDKPAEEDESENLD 344


>gi|25229185|gb|AAN74662.1| RecA [Burkholderia stabilis]
 gi|25991733|gb|AAN76907.1| RecA [Burkholderia stabilis]
          Length = 333

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|319431775|gb|ADP92391.2| recombinase [Burkholderia cepacia]
          Length = 329

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991711|gb|AAN76896.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25229189|gb|AAN74664.1| RecA [Burkholderia cepacia]
 gi|25229191|gb|AAN74665.1| RecA [Burkholderia cepacia]
 gi|25229193|gb|AAN74666.1| RecA [Burkholderia cepacia]
 gi|25229195|gb|AAN74667.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991689|gb|AAN76885.1| RecA [Burkholderia cepacia]
 gi|204342697|gb|ACI01436.1| RecA [Burkholderia sp. MS14]
          Length = 334

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|54633820|gb|AAV36020.1| RecA [Burkholderia sp. KBC-4]
          Length = 333

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|78485933|ref|YP_391858.1| recA protein [Thiomicrospira crunogena XCL-2]
 gi|123741557|sp|Q31F89|RECA_THICR RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|78364219|gb|ABB42184.1| RecA protein [Thiomicrospira crunogena XCL-2]
          Length = 347

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 229/341 (67%), Positives = 290/341 (85%), Gaps = 7/341 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KALEAAL QI++ +GKG+IM++G +G+I + I+ VS+GSLGLD+ALGIGG P+GR+V
Sbjct: 4   NKKKALEAALGQIEKQFGKGSIMRMGDKGAIRD-IDSVSTGSLGLDVALGIGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GGT AFVDAEHALD IYA KLGVD+ NLL+SQPDTG
Sbjct: 63  EIYGPESSGKTTLTLHAIAEMQKMGGTAAFVDAEHALDPIYAEKLGVDIDNLLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAVDI+++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEITDSLVRSGAVDIVIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+  +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G+IK  D I GN+T
Sbjct: 183 KRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEILGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQVEF+I+YG+GIS  GE+IDLGVK  +++K+GAW+S++GQ++GQG+
Sbjct: 243 RVKVVKNKVSPPFKQVEFEILYGQGISREGEVIDLGVKEKLIEKAGAWYSYQGQKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQ------NAGLVADSLLQE 345
           +N + FL++N +I E ++  +++      NA    D  L E
Sbjct: 303 DNVRQFLKDNPDIYETLQVQIKERLMPKPNAPKATDEALDE 343


>gi|25229183|gb|AAN74661.1| RecA [Burkholderia dolosa]
 gi|25991707|gb|AAN76894.1| RecA [Burkholderia dolosa]
 gi|25991709|gb|AAN76895.1| RecA [Burkholderia dolosa]
 gi|34223993|gb|AAQ63160.1| RecA [Burkholderia dolosa]
 gi|56849543|gb|AAW31631.1| RecA [Burkholderia dolosa]
          Length = 333

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVAA 324


>gi|25991679|gb|AAN76880.1| RecA [Burkholderia cepacia]
 gi|25991765|gb|AAN76923.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 282/325 (86%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVAA 324


>gi|25991673|gb|AAN76877.1| RecA [Burkholderia multivorans]
 gi|25991675|gb|AAN76878.1| RecA [Burkholderia multivorans]
 gi|25991677|gb|AAN76879.1| RecA [Burkholderia multivorans]
          Length = 334

 Score =  477 bits (1228), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVAA 324


>gi|25991753|gb|AAN76917.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  477 bits (1228), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GDATEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|25991701|gb|AAN76891.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 282/325 (86%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVAA 324


>gi|242133650|gb|ACS87936.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ Q+ GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQRIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|70904911|gb|AAZ14033.1| RecA [Burkholderia ambifaria]
          Length = 328

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/323 (69%), Positives = 282/323 (87%), Gaps = 1/323 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVVAKLQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLV 338
           FLREN EIA  IE+ +R++ G+V
Sbjct: 300 FLRENPEIAREIENRIRESLGVV 322


>gi|25991761|gb|AAN76921.1| RecA [Burkholderia cepacia]
 gi|25991767|gb|AAN76924.1| RecA [Burkholderia cepacia]
          Length = 334

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 282/325 (86%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 EFLRENPEIAREIENRIRESLGVAA 324


>gi|25991735|gb|AAN76908.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/325 (69%), Positives = 283/325 (87%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QA LMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQALLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVA 324


>gi|304570555|ref|YP_266064.2| recA protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 383

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/365 (61%), Positives = 294/365 (80%), Gaps = 16/365 (4%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL+AA+SQI   +GKG++M+LG + ++   +E +S+GSL LD+ALGIGG PKGR++
Sbjct: 21  EKNKALDAAMSQIIDNFGKGSVMKLGQRRAM--DVESISTGSLSLDVALGIGGLPKGRVI 78

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTLAL  +A++QK GG CAF+DAEHALD IYA+KLGVD + LLISQPDTG
Sbjct: 79  EVYGPESSGKTTLALQVLAEAQKAGGICAFIDAEHALDPIYAKKLGVDTEELLISQPDTG 138

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LV+SG++ +IVIDSVAALTPRAEIEG+MG+   G+Q+RLMSQALRKLT SI
Sbjct: 139 EQALEIADTLVKSGSISVIVIDSVAALTPRAEIEGEMGDHHVGLQSRLMSQALRKLTGSI 198

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S +  +++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVR+DIRR+G+IK+ D I GN T
Sbjct: 199 SSTNTMMIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRMDIRRIGAIKNGDEIIGNST 258

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK VEFD+MYG+GIS  GEL+DLG KA IV+K+GAW+++KG+++GQGR
Sbjct: 259 RVKVVKNKVAPPFKVVEFDLMYGKGISKVGELVDLGSKADIVEKAGAWYAYKGEKIGQGR 318

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSL--------------LQEPAINTKDDADK 356
           EN+K +L +N +IA  IE  +R+ AG++A  +              ++EP + TK++   
Sbjct: 319 ENAKTYLEQNPKIAAEIEMAIREKAGVIAKKIEGNPLDPEKAAKDQIEEPKLETKEEVTP 378

Query: 357 DDTDN 361
               N
Sbjct: 379 PSKKN 383


>gi|157326963|gb|ABV44594.1| RecA [Burkholderia cenocepacia]
          Length = 325

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLVA 339
           FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 FLRENPEIAREIENRIRESLGVVS 323


>gi|224551677|gb|ACN54238.1| RecA [Burkholderia sp. LWAT8]
          Length = 331

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 281/322 (87%), Gaps = 1/322 (0%)

Query: 18  AALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPES 77
           AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPES
Sbjct: 2   AALAQIEKQFGKGSIMRMGD-GDATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPES 60

Query: 78  SGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEIT 137
           SGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEIT
Sbjct: 61  SGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEIT 120

Query: 138 DMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCIL 197
           D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C++
Sbjct: 121 DALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLV 180

Query: 198 VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN 257
           +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKN
Sbjct: 181 IFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKN 240

Query: 258 KMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFL 317
           K++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FL
Sbjct: 241 KVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFL 300

Query: 318 RENIEIAENIESLLRQNAGLVA 339
           REN EIA  IE+ +R++ G+VA
Sbjct: 301 RENPEIAREIENRIRESLGVVA 322


>gi|28460070|emb|CAD67594.1| RecA protein [Burkholderia anthina]
          Length = 332

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLVA 339
           FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 FLRENPEIAREIENRIRESLGVVA 323


>gi|150171047|emb|CAO01507.1| DNA recombination protein [Burkholderia metallica]
          Length = 334

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 281/324 (86%), Gaps = 1/324 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G      E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-AEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLV 338
            FLREN EIA  IE+ +R++ G+V
Sbjct: 300 EFLRENPEIAREIENRIRESLGVV 323


>gi|70904890|gb|AAZ14023.1| RecA [Burkholderia cenocepacia]
          Length = 332

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNA+KFYSSVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNAVKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLVA 339
           FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 FLRENPEIAREIENRIRESLGVVA 323


>gi|70904915|gb|AAZ14035.1| RecA [Burkholderia ambifaria]
          Length = 328

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 224/321 (69%), Positives = 281/321 (87%), Gaps = 1/321 (0%)

Query: 18  AALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPES 77
           AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPES
Sbjct: 3   AALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPES 61

Query: 78  SGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEIT 137
           SGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEIT
Sbjct: 62  SGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEIT 121

Query: 138 DMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCIL 197
           D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C++
Sbjct: 122 DALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLV 181

Query: 198 VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN 257
           +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKN
Sbjct: 182 IFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKN 241

Query: 258 KMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFL 317
           K++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FL
Sbjct: 242 KVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFL 301

Query: 318 RENIEIAENIESLLRQNAGLV 338
           REN EIA  IE+ +R++ G+V
Sbjct: 302 RENPEIAREIENRIRESLGVV 322


>gi|30313400|gb|AAM55292.1| RecA [Burkholderia cepacia]
          Length = 347

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|33593529|ref|NP_881173.1| recombinase A [Bordetella pertussis Tohama I]
 gi|33597213|ref|NP_884856.1| recombinase A [Bordetella parapertussis 12822]
 gi|33601059|ref|NP_888619.1| recombinase A [Bordetella bronchiseptica RB50]
 gi|61230226|sp|P0A448|RECA_BORPE RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|61230227|sp|P0A449|RECA_BORBR RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|61230228|sp|P0A450|RECA_BORPA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|33572885|emb|CAE42821.1| RecA protein [Bordetella pertussis Tohama I]
 gi|33573640|emb|CAE37925.1| RecA protein [Bordetella parapertussis]
 gi|33575494|emb|CAE32572.1| RecA protein [Bordetella bronchiseptica RB50]
          Length = 353

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 278/319 (87%), Gaps = 1/319 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           SQI++ +GKG+IM+ G    +   I+VVS+GSLGLDIALG+GG P+GR++E+YGPESSGK
Sbjct: 22  SQIEKQFGKGSIMRYGDN-EVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEVYGPESSGK 80

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  IA+ QK GGTCAFVDAEHALD  YA KLGV+L +LLISQPDTGEQALEITD L
Sbjct: 81  TTLTLQVIAEMQKLGGTCAFVDAEHALDVQYASKLGVNLTDLLISQPDTGEQALEITDAL 140

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT++I R+ C+++FI
Sbjct: 141 VRSGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFI 200

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G+IK  D + GN+TRVKVVKNK+A
Sbjct: 201 NQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEVVGNETRVKVVKNKVA 260

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PFKQ EFDIMYG GIS  GE+IDLGV+A++VDKSGAW+S+ G R+GQG++N + +L+E+
Sbjct: 261 PPFKQAEFDIMYGSGISREGEIIDLGVQANVVDKSGAWYSYSGNRIGQGKDNVREYLKEH 320

Query: 321 IEIAENIESLLRQNAGLVA 339
            E+A  IE+ +R+N G+V+
Sbjct: 321 KEMAIEIENKVRENQGIVS 339


>gi|86278347|gb|ABC88427.1| RecA [Burkholderia pyrrocinia]
 gi|116119162|gb|ABJ74751.1| RecA [Burkholderia sp. M301]
          Length = 347

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|10121194|gb|AAG13109.1|AF143794_1 RecA [Burkholderia pyrrocinia]
          Length = 347

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ GLVA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGLVA 331


>gi|239840193|gb|ACS31901.1| RecA [Burkholderia pyrrocinia]
          Length = 346

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|254575572|gb|ACT68300.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|329906521|ref|ZP_08274403.1| RecA protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327547277|gb|EGF32123.1| RecA protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 370

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/337 (67%), Positives = 291/337 (86%), Gaps = 1/337 (0%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K ++  DKSKAL AAL+QI++ +GKG++M++ + G++ E ++VVS+GSLGLDIALG
Sbjct: 1   MDDKKAVSGSDKSKALAAALAQIEKQFGKGSVMRM-ADGAVVEEVQVVSTGSLGLDIALG 59

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           +GG P+GR+VEIYGPESSGKTTL L TIA+ QK GGTCAF+DAEHALD  YA+KLG++L 
Sbjct: 60  VGGLPRGRVVEIYGPESSGKTTLTLQTIAEMQKLGGTCAFIDAEHALDVGYAQKLGINLS 119

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEITD LVRSG VD+IVIDSVAALTPRAEIEGDMG+SLPG+QARLMS
Sbjct: 120 ELLISQPDTGEQALEITDALVRSGGVDLIVIDSVAALTPRAEIEGDMGDSLPGLQARLMS 179

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLT SI+R+  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR GSIK
Sbjct: 180 QALRKLTGSINRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIK 239

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
             D + GN+T+VKVVKNK+A PF++  FDI+YGEG+S  GE++DLG  A IV+K+GAW+S
Sbjct: 240 SGDEVIGNETKVKVVKNKIAPPFREAHFDILYGEGVSREGEILDLGADAKIVEKAGAWYS 299

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           + G+R+GQG++N++ FL+E  E+A  IE+ +R + G+
Sbjct: 300 YNGERIGQGKDNARTFLKERPELAREIENKVRVSLGV 336


>gi|255021553|ref|ZP_05293596.1| RecA protein [Acidithiobacillus caldus ATCC 51756]
 gi|254968941|gb|EET26460.1| RecA protein [Acidithiobacillus caldus ATCC 51756]
          Length = 347

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 280/324 (86%), Gaps = 1/324 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           +SKAL AALSQI + +GKGAIM+LG Q ++ + I+V S+GSLGLD+ALG+GG P+GR+VE
Sbjct: 5   RSKALAAALSQIDKQFGKGAIMRLGEQSAV-KDIQVYSTGSLGLDLALGVGGLPRGRVVE 63

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTL LH IA  Q +GGT AF+DAEHALD  YA+KLGVDL+NLLISQPDTGE
Sbjct: 64  IYGPESSGKTTLTLHAIASCQASGGTAAFIDAEHALDPSYAQKLGVDLENLLISQPDTGE 123

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEI DMLVRSGAVD+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++IS
Sbjct: 124 QALEIADMLVRSGAVDLIVVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANIS 183

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
           R+  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK  D I G+ TR
Sbjct: 184 RTNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGTIKKGDEILGSDTR 243

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNK+A PF++ EF I YGEGIS   EL+DLGVK  I++KSGAW+S+KG+R+GQG++
Sbjct: 244 VKVVKNKVAPPFREAEFAIYYGEGISRLSELVDLGVKFDIIEKSGAWYSYKGERIGQGKD 303

Query: 312 NSKIFLRENIEIAENIESLLRQNA 335
           N++ FL+E  E+A+ IE  +R  A
Sbjct: 304 NARQFLKERPEMAKEIEERVRAAA 327


>gi|171464132|ref|YP_001798245.1| recA protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171193670|gb|ACB44631.1| recA protein [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 362

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/331 (68%), Positives = 282/331 (85%), Gaps = 1/331 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL AAL+QI++ +GKG+IM+LG    I E I+VVSSGSLGLDIALG+GG  +GR++
Sbjct: 20  DKQKALTAALAQIEKQFGKGSIMRLG-DAEISEDIQVVSSGSLGLDIALGVGGLARGRVI 78

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GGTCAF+DAEHALD  YA KLGVD+ NLLISQPDTG
Sbjct: 79  EIYGPESSGKTTLTLHAIAEMQKLGGTCAFIDAEHALDVQYAGKLGVDVNNLLISQPDTG 138

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEGDMG+SLPG+QARLMSQALRKLT +I
Sbjct: 139 EQALEIADALVRSGSIDLIVIDSVAALVPKAEIEGDMGDSLPGLQARLMSQALRKLTGAI 198

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+   ++FINQ+RMKIGV+FGSPETTTGGNALKFY+S+RLDIRR+GSIK  D + GN+T
Sbjct: 199 KRTNTTVIFINQIRMKIGVIFGSPETTTGGNALKFYASMRLDIRRIGSIKKGDEVVGNET 258

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDIMYG GIS  GE+ID+GV+A +++KSG+W+S+ G R+GQG+
Sbjct: 259 RVKVVKNKVSPPFREAIFDIMYGAGISREGEIIDMGVEADLIEKSGSWYSYNGDRIGQGK 318

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADS 341
           +N + FLREN  IA++IE+ +R+  G+ + S
Sbjct: 319 DNVREFLRENPAIAKDIEAKIREKLGVKSGS 349


>gi|25991691|gb|AAN76886.1| RecA [Burkholderia cepacia]
 gi|25991715|gb|AAN76898.1| RecA [Burkholderia cepacia]
 gi|25991717|gb|AAN76899.1| RecA [Burkholderia cepacia]
 gi|25991719|gb|AAN76900.1| RecA [Burkholderia cepacia]
 gi|25991723|gb|AAN76902.1| RecA [Burkholderia cepacia]
 gi|25991725|gb|AAN76903.1| RecA [Burkholderia cepacia]
 gi|25991747|gb|AAN76914.1| RecA [Burkholderia cepacia]
 gi|25991749|gb|AAN76915.1| RecA [Burkholderia cepacia]
 gi|298113121|gb|ADI58688.1| RecA [Burkholderia sp. CCUG 57241]
          Length = 333

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 282/325 (86%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAKEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 EFLRENPEIALEIENRIRESLGVAA 324


>gi|91790514|ref|YP_551466.1| recombination protein RecA [Polaromonas sp. JS666]
 gi|91699739|gb|ABE46568.1| RecA protein [Polaromonas sp. JS666]
          Length = 377

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 278/315 (88%), Gaps = 1/315 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG IM+LG+ G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 34  IEKQFGKGTIMKLGA-GEVIEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 92

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGTCAFVDAEHALD  YA+KLGV+L++LLISQPDTGEQALEI D L R
Sbjct: 93  LTLQVIAEMQKLGGTCAFVDAEHALDIQYAQKLGVNLQDLLISQPDTGEQALEIVDSLTR 152

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SGAVD+IV+DSVAALTP+AE+EG+MG+SLPG+QARLMSQALRKLT++I ++ C+++FINQ
Sbjct: 153 SGAVDLIVVDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTATIKKANCMVIFINQ 212

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  + + GN+TRVKVVKNK+ASP
Sbjct: 213 IRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEVIGNETRVKVVKNKVASP 272

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           FK  EFDI+YGEGIS  GE++DLGV   IV+K+GAW++F G+++GQGR+NS+ FL+EN +
Sbjct: 273 FKTAEFDILYGEGISRLGEVLDLGVAGHIVEKAGAWYAFNGEKIGQGRDNSREFLKENPD 332

Query: 323 IAENIESLLRQNAGL 337
           +A  IE+ +R++ G+
Sbjct: 333 LAIEIENKVRESLGV 347


>gi|206559346|ref|YP_002230107.1| recombinase A [Burkholderia cenocepacia J2315]
 gi|205556004|sp|P0C7V2|RECA_BURCE RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|238693105|sp|B4EBY3|RECA_BURCJ RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|10121168|gb|AAG13096.1|AF143781_1 RecA [Burkholderia cepacia]
 gi|10121170|gb|AAG13097.1|AF143782_1 RecA [Burkholderia cepacia]
 gi|216911|dbj|BAA14148.1| RecA protein [Burkholderia cepacia]
 gi|47054184|gb|AAT09202.1| recombination protein A [Burkholderia cepacia]
 gi|198035384|emb|CAR51260.1| putative recombinase A [Burkholderia cenocepacia J2315]
          Length = 347

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|10121188|gb|AAG13106.1|AF143791_1 RecA [Burkholderia vietnamiensis]
 gi|10121192|gb|AAG13108.1|AF143793_1 RecA [Burkholderia vietnamiensis]
 gi|14572548|gb|AAK64608.1| RecA [Burkholderia cepacia]
 gi|116119168|gb|ABJ74754.1| RecA [Burkholderia sp. R398]
          Length = 347

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|332037713|gb|EGI74164.1| protein RecA [Pseudoalteromonas haloplanktis ANT/505]
          Length = 347

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 235/352 (66%), Positives = 287/352 (81%), Gaps = 11/352 (3%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AALSQI+R +GKG+IM+LG   ++   IE VS+GSLG+DIALGIGG P GRIV
Sbjct: 4   NKQKALDAALSQIERQFGKGSIMKLGDNKAL--NIESVSTGSLGIDIALGIGGLPMGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTL L  IA++QK G TCAF+DAEHALD +YA+KLGV++ +L +SQPDTG
Sbjct: 62  EVYGPESSGKTTLTLQVIAEAQKEGKTCAFIDAEHALDPVYAQKLGVNIDDLFVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRS AVD+++IDSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT +I
Sbjct: 122 EQALEICDMLVRSSAVDVVIIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR+DIRR+GS+K+ D + GN+T
Sbjct: 182 KRSNTLCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRIDIRRIGSVKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVK+VKNK+A PFKQ EF IMYGEGIS  GELIDLGVK  IV+K+GAW+S+ G ++GQG+
Sbjct: 242 RVKIVKNKVAPPFKQAEFIIMYGEGISKQGELIDLGVKHKIVEKAGAWYSYSGNKVGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK--DDTD 360
            NS  FL+EN EIA+ IE  LR+        LL +  I  +D  DK  DD D
Sbjct: 302 SNSIKFLKENPEIADEIEGKLRE-------MLLLKATIEPEDGEDKLGDDPD 346


>gi|25991743|gb|AAN76912.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 228/333 (68%), Positives = 285/333 (85%), Gaps = 3/333 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GDATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IV DSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVNDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA--DSLLQE 345
            FLREN EIA  IE+ +R++ G+V   D ++ E
Sbjct: 300 EFLRENPEIAREIENRIRESLGVVTMPDGVVHE 332


>gi|116119152|gb|ABJ74746.1| RecA [Burkholderia sp. M279]
          Length = 347

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/348 (66%), Positives = 296/348 (85%), Gaps = 4/348 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           +N++ FLREN EIA  IE+ +R++ G+VA   + +  +N  +  D+++
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA---MPDGVVNEAEAMDEEE 347


>gi|51100544|emb|CAH10075.1| RecA protein [Burkholderia cenocepacia]
          Length = 347

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG+P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGWPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVS 331


>gi|242133648|gb|ACS87935.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/325 (69%), Positives = 282/325 (86%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
            FL EN EIA  IE+ +R++ G+VA
Sbjct: 300 EFLLENPEIAREIENRIRESLGVVA 324


>gi|78067448|ref|YP_370217.1| recombinase A [Burkholderia sp. 383]
 gi|123756106|sp|Q39D93|RECA_BURS3 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|77968193|gb|ABB09573.1| RecA DNA recombination protein [Burkholderia sp. 383]
          Length = 348

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|254575576|gb|ACT68302.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGAI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|242133680|gb|ACS87951.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|254575564|gb|ACT68296.1| RecA [Burkholderia cepacia]
 gi|254575578|gb|ACT68303.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|134296854|ref|YP_001120589.1| recombinase A [Burkholderia vietnamiensis G4]
 gi|134140011|gb|ABO55754.1| recA protein [Burkholderia vietnamiensis G4]
          Length = 356

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVVA 340


>gi|242133664|gb|ACS87943.1| RecA [Burkholderia cepacia]
 gi|242133668|gb|ACS87945.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|254247311|ref|ZP_04940632.1| RecA/RadA recombinase [Burkholderia cenocepacia PC184]
 gi|124872087|gb|EAY63803.1| RecA/RadA recombinase [Burkholderia cenocepacia PC184]
          Length = 356

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVVS 340


>gi|10121164|gb|AAG13094.1|AF143779_1 RecA [Burkholderia cepacia]
          Length = 347

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKSDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|116119174|gb|ABJ74757.1| RecA [Burkholderia sp. R430]
          Length = 347

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDTIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|107023588|ref|YP_621915.1| recombinase A [Burkholderia cenocepacia AU 1054]
 gi|116690672|ref|YP_836295.1| recombinase A [Burkholderia cenocepacia HI2424]
 gi|105893777|gb|ABF76942.1| recA protein [Burkholderia cenocepacia AU 1054]
 gi|116648761|gb|ABK09402.1| recA protein [Burkholderia cenocepacia HI2424]
          Length = 356

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVVS 340


>gi|209967937|gb|ACB38234.2| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 290/337 (86%), Gaps = 3/337 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA--DSLLQE 345
           +N++ FLREN EIA  IE+ +R++ G+V+  D L  E
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVSMPDGLANE 338


>gi|118594481|ref|ZP_01551828.1| recombinase A [Methylophilales bacterium HTCC2181]
 gi|118440259|gb|EAV46886.1| recombinase A [Methylophilales bacterium HTCC2181]
          Length = 348

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/330 (67%), Positives = 286/330 (86%), Gaps = 1/330 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AALSQI + +GKG+IM++     + EGI+ VS+GSLGLDIALGIGG P+GR++
Sbjct: 4   NKRKALDAALSQIDKQFGKGSIMRM-DDSQVIEGIQAVSTGSLGLDIALGIGGLPRGRVI 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKT+L+L T+AQ QKTGGT AF+DAEHALD  YA KLGV+++ LL+SQPDTG
Sbjct: 63  EIYGPESSGKTSLSLSTVAQLQKTGGTAAFIDAEHALDIQYAAKLGVNIEELLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSG+VDI+VIDSVAALTPRAEIEGDMG+S  G+QARLMSQALRKLTS+I
Sbjct: 123 EQALEIADMLVRSGSVDIVVIDSVAALTPRAEIEGDMGDSHMGLQARLMSQALRKLTSNI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IK  D + G +T
Sbjct: 183 KKTNTMVIFINQLRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKKGDEVIGAET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++ EFD++YGEGIS  GE+ID GV   IV+KSG+W+S+KG+++GQG+
Sbjct: 243 RVKVVKNKVAPPFRKAEFDVLYGEGISLEGEIIDQGVLLDIVEKSGSWYSYKGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
           +N++IFL++N +I+  IE L+R N+ + A+
Sbjct: 303 DNARIFLKDNPKISNEIEQLVRDNSSITAE 332


>gi|242133670|gb|ACS87946.1| RecA [Burkholderia cepacia]
          Length = 345

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|115352750|ref|YP_774589.1| recombinase A [Burkholderia ambifaria AMMD]
 gi|172061614|ref|YP_001809266.1| recombinase A [Burkholderia ambifaria MC40-6]
 gi|115282738|gb|ABI88255.1| recA protein [Burkholderia ambifaria AMMD]
 gi|171994131|gb|ACB65050.1| recA protein [Burkholderia ambifaria MC40-6]
          Length = 359

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/328 (69%), Positives = 287/328 (87%), Gaps = 1/328 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLV 338
           +N++ FLREN EIA  IE+ +R++ G+V
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVV 339


>gi|91785109|ref|YP_560315.1| recombinase A [Burkholderia xenovorans LB400]
 gi|296157299|ref|ZP_06840135.1| recA protein [Burkholderia sp. Ch1-1]
 gi|29788007|emb|CAD67591.1| RecA protein [Burkholderia fungorum]
 gi|91689063|gb|ABE32263.1| RecA DNA recombination protein [Burkholderia xenovorans LB400]
 gi|295892635|gb|EFG72417.1| recA protein [Burkholderia sp. Ch1-1]
          Length = 358

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 228/348 (65%), Positives = 299/348 (85%), Gaps = 3/348 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLGA-GEVIEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVIAEMQKIGGTAAFIDAEHALDIQYASKLGVNVNDLLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           +N++ FLREN +IA  IE+ +R++ G+  +++ +   + + + AD+++
Sbjct: 313 DNAREFLRENPDIAREIENRIRESLGV--NAMAEAATVASAEVADEEE 358


>gi|70904901|gb|AAZ14028.1| RecA [Burkholderia pyrrocinia]
          Length = 323

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 224/321 (69%), Positives = 281/321 (87%), Gaps = 1/321 (0%)

Query: 19  ALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESS 78
           AL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESS
Sbjct: 1   ALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESS 59

Query: 79  GKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITD 138
           GKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD
Sbjct: 60  GKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITD 119

Query: 139 MLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILV 198
            LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++
Sbjct: 120 ALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVI 179

Query: 199 FINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNK 258
           FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK
Sbjct: 180 FINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNK 239

Query: 259 MASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLR 318
           ++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLR
Sbjct: 240 VSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLR 299

Query: 319 ENIEIAENIESLLRQNAGLVA 339
           EN EIA  IE+ +R++ G+VA
Sbjct: 300 ENPEIAREIENRIRESLGVVA 320


>gi|157326957|gb|ABV44591.1| RecA [Burkholderia cenocepacia]
          Length = 325

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/324 (69%), Positives = 281/324 (86%), Gaps = 1/324 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L A L+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAPLAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLVA 339
           FLREN EIA  IE+ +R++ G+V+
Sbjct: 300 FLRENPEIAREIENRIRESLGVVS 323


>gi|85712116|ref|ZP_01043169.1| RecA recombinase [Idiomarina baltica OS145]
 gi|85694106|gb|EAQ32051.1| RecA recombinase [Idiomarina baltica OS145]
          Length = 360

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/348 (66%), Positives = 284/348 (81%), Gaps = 9/348 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           D+SKAL+AALSQI+R +GKG+IM+LG   ++   I  VS+GSLGLD+ALGIGG P GR+V
Sbjct: 4   DRSKALDAALSQIERQFGKGSIMRLGDNQTM--DIASVSTGSLGLDVALGIGGLPFGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAFVDAEHALD IYA  LGV + +LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKAGKTCAFVDAEHALDPIYAEALGVRVDDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLTS+I
Sbjct: 122 EQALEICDMLVRSGAVDVVIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTSNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            +S  + +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR G++K+ D + GN+T
Sbjct: 182 KKSNSLCIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGALKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK+  F IMYG GIS  GEL+DLGVK  +VDK+GAW+S+ G ++GQG+
Sbjct: 242 RVKVVKNKVAPPFKEANFQIMYGRGISKEGELVDLGVKHKLVDKAGAWYSYNGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
            N+  FL+EN  IAE IES LR+        LL +PA   K++A  DD
Sbjct: 302 ANAMKFLQENSSIAEEIESKLRE-------LLLVKPAKKDKNEAAADD 342


>gi|110339314|gb|ABG67918.1| RecA [Burkholderia cenocepacia]
 gi|110339318|gb|ABG67920.1| RecA [Burkholderia cenocepacia]
 gi|209967939|gb|ACB12744.2| RecA [Burkholderia cepacia]
 gi|254575554|gb|ACT68291.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|110339316|gb|ABG67919.1| RecA [Burkholderia cenocepacia]
          Length = 346

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|13021984|gb|AAK11600.1| RecA [Burkholderia ambifaria]
          Length = 350

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/328 (69%), Positives = 287/328 (87%), Gaps = 1/328 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLV 338
           +N++ FLREN EIA  IE+ +R++ G+V
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVV 330


>gi|150171064|emb|CAO01515.1| DNA recombination protein [Burkholderia diffusa]
          Length = 333

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 280/324 (86%), Gaps = 1/324 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI + +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIDKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLVA 339
           FLREN EIA  IE+ +R++ G+ A
Sbjct: 300 FLRENPEIAREIENRIRESLGVAA 323


>gi|10121172|gb|AAG13098.1|AF143783_1 RecA [Burkholderia cepacia]
 gi|10121176|gb|AAG13100.1|AF143785_1 RecA [Burkholderia cepacia]
 gi|10121200|gb|AAG13112.1|AF143797_1 RecA [Burkholderia cepacia]
          Length = 347

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVS 331


>gi|10121174|gb|AAG13099.1|AF143784_1 RecA [Burkholderia cepacia]
          Length = 347

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVS 331


>gi|10121196|gb|AAG13110.1|AF143795_1 RecA [Burkholderia cepacia]
 gi|10121198|gb|AAG13111.1|AF143796_1 RecA [Burkholderia cepacia]
          Length = 350

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/328 (69%), Positives = 287/328 (87%), Gaps = 1/328 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLV 338
           +N++ FLREN EIA  IE+ +R++ G+V
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVV 330


>gi|317402893|gb|EFV83435.1| RecA protein [Achromobacter xylosoxidans C54]
          Length = 354

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/319 (69%), Positives = 277/319 (86%), Gaps = 1/319 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           SQI++ +GKG+IM+ G    +   I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGK
Sbjct: 22  SQIEKQFGKGSIMRYGDN-EVSHDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGK 80

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  +A+ QK GGTCAFVDAEHALD  YA KLGV+L +LLISQPDTGEQALEITD L
Sbjct: 81  TTLTLQVVAEMQKLGGTCAFVDAEHALDVQYASKLGVNLSDLLISQPDTGEQALEITDAL 140

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG+VD+IV+DSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT++I ++ C+++FI
Sbjct: 141 VRSGSVDLIVVDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKKTNCMVIFI 200

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK+A
Sbjct: 201 NQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKGDEVVGNETRVKVVKNKVA 260

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PFKQ EFDIMYG GIS  GE+IDLGV A++VDKSGAW+S+ G R+GQG++N + +L+E+
Sbjct: 261 PPFKQAEFDIMYGAGISREGEIIDLGVAANVVDKSGAWYSYNGNRIGQGKDNVREYLKEH 320

Query: 321 IEIAENIESLLRQNAGLVA 339
            E+A  IE+ +R+N G+V+
Sbjct: 321 KELAIEIENRVRENQGIVS 339


>gi|10121178|gb|AAG13101.1|AF143786_1 RecA [Burkholderia cepacia ATCC 25416]
          Length = 347

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/338 (68%), Positives = 290/338 (85%), Gaps = 3/338 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA--DSLLQEP 346
           +N++ FLREN EIA  IE+ +R++ G+VA  D    EP
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVAMPDGAGNEP 340


>gi|116119166|gb|ABJ74753.1| RecA [Burkholderia sp. M318]
          Length = 347

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVVGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IV+K+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVNKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|10121180|gb|AAG13102.1|AF143787_1 RecA [Burkholderia cepacia]
 gi|10121182|gb|AAG13103.1|AF143788_1 RecA [Burkholderia cepacia]
 gi|116119160|gb|ABJ74750.1| RecA [Burkholderia sp. M297]
 gi|126256480|gb|ABO09805.1| RecA [Burkholderia sp. Y6]
          Length = 347

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|170734016|ref|YP_001765963.1| recombinase A [Burkholderia cenocepacia MC0-3]
 gi|169817258|gb|ACA91841.1| recA protein [Burkholderia cenocepacia MC0-3]
          Length = 356

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVVS 340


>gi|116119170|gb|ABJ74755.1| RecA [Burkholderia sp. R419]
          Length = 347

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI+  +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEEQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|237908827|gb|ACR33789.1| RecA [Burkholderia hospita]
          Length = 319

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 222/319 (69%), Positives = 279/319 (87%), Gaps = 1/319 (0%)

Query: 18  AALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPES 77
           AAL+QI++ +GKG++M+LG QG   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPES
Sbjct: 2   AALAQIEKQFGKGSVMRLG-QGEAVEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPES 60

Query: 78  SGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEIT 137
           SGKTTL L  +A+ QK GGT AF+DAEHALD  YA+KLGVD+ +LL+SQPDTGEQ LEI 
Sbjct: 61  SGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAQKLGVDVSDLLVSQPDTGEQTLEIA 120

Query: 138 DMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCIL 197
           D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C++
Sbjct: 121 DALVRSGSIDMIVIDSVAALAPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLV 180

Query: 198 VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN 257
           +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKN
Sbjct: 181 IFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKN 240

Query: 258 KMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFL 317
           K+A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG++N++ FL
Sbjct: 241 KVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGERIGQGKDNAREFL 300

Query: 318 RENIEIAENIESLLRQNAG 336
           REN +IA  IE+ +R++ G
Sbjct: 301 RENPDIAREIENRIRESLG 319


>gi|126256484|gb|ABO09807.1| RecA [Burkholderia sp. Y20]
          Length = 347

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVD++GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDRAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|167561698|ref|ZP_02354614.1| recombinase A [Burkholderia oklahomensis EO147]
 gi|167568934|ref|ZP_02361808.1| recombinase A [Burkholderia oklahomensis C6786]
          Length = 359

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM+LG  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRLGD-GEVVEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG++LPG+QARLMSQALRKLT SI
Sbjct: 132 EQALEIVDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTGSI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE++DLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIVDLGVQAKIVDKAGAWYSYSGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENSEIAREIENRIRESLGVAA 340


>gi|10121190|gb|AAG13107.1|AF143792_1 RecA [Burkholderia vietnamiensis]
          Length = 347

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI + +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIDKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|242133674|gb|ACS87948.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|186475208|ref|YP_001856678.1| recombinase A [Burkholderia phymatum STM815]
 gi|184191667|gb|ACC69632.1| recA protein [Burkholderia phymatum STM815]
          Length = 358

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/347 (67%), Positives = 296/347 (85%), Gaps = 7/347 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG QG   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLG-QGEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA+KLGV++ +LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAQKLGVNVSDLLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
           +N++ FLREN +IA  IE+ +R++ G+ A      PA N   DAD++
Sbjct: 313 DNAREFLRENADIAREIENRIRESLGVNA-----MPA-NAVVDADEE 353


>gi|242133662|gb|ACS87942.1| RecA [Burkholderia cepacia]
 gi|254575560|gb|ACT68294.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/348 (66%), Positives = 296/348 (85%), Gaps = 4/348 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           +N++ FLREN EIA  IE+ +R++ G+VA   + +  +N  +  D+++
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA---MPDGVVNEAEAMDEEE 346


>gi|242133660|gb|ACS87941.1| RecA [Burkholderia cepacia]
          Length = 345

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|170703541|ref|ZP_02894296.1| recA protein [Burkholderia ambifaria IOP40-10]
 gi|171319347|ref|ZP_02908458.1| recA protein [Burkholderia ambifaria MEX-5]
 gi|170131553|gb|EDT00126.1| recA protein [Burkholderia ambifaria IOP40-10]
 gi|171095454|gb|EDT40424.1| recA protein [Burkholderia ambifaria MEX-5]
          Length = 359

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/328 (69%), Positives = 287/328 (87%), Gaps = 1/328 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLV 338
           +N++ FLREN EIA  IE+ +R++ G+V
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVV 339


>gi|10121184|gb|AAG13104.1|AF143789_1 RecA [Burkholderia cepacia]
 gi|10121186|gb|AAG13105.1|AF143790_1 RecA [Burkholderia cepacia]
          Length = 347

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/348 (66%), Positives = 296/348 (85%), Gaps = 4/348 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           +N++ FLREN EIA  IE+ +R++ G+VA   + +  +N  +  D+++
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA---MPDGVVNEAEAMDEEE 347


>gi|254575574|gb|ACT68301.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSI+  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIRKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|297614593|gb|ACS87947.2| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|261291943|gb|ACX69976.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|293604305|ref|ZP_06686712.1| recombination protein A [Achromobacter piechaudii ATCC 43553]
 gi|292817182|gb|EFF76256.1| recombination protein A [Achromobacter piechaudii ATCC 43553]
          Length = 353

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 276/318 (86%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM+ G    +   I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 23  QIEKQFGKGSIMRYGDN-EVSHDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 81

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGTCAFVDAEHALD  YA KLGV+L +LLISQPDTGEQALEITD LV
Sbjct: 82  TLTLQVIAEMQKIGGTCAFVDAEHALDVQYANKLGVNLTDLLISQPDTGEQALEITDALV 141

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT++I R+ C+++FIN
Sbjct: 142 RSGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFIN 201

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK+A 
Sbjct: 202 QIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKGDEVVGNETRVKVVKNKVAP 261

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PFKQ EFDIMYG GIS  GE+IDLGV A++VDKSGAW+S+ G R+GQG++N + +L+E+ 
Sbjct: 262 PFKQAEFDIMYGAGISREGEIIDLGVAANVVDKSGAWYSYNGNRIGQGKDNVREYLKEHR 321

Query: 322 EIAENIESLLRQNAGLVA 339
           ++A  IE+ +R+N G+V+
Sbjct: 322 DMAIEIENRVRENQGIVS 339


>gi|254251505|ref|ZP_04944823.1| RecA/RadA recombinase [Burkholderia dolosa AUO158]
 gi|124894114|gb|EAY67994.1| RecA/RadA recombinase [Burkholderia dolosa AUO158]
          Length = 356

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVAA 340


>gi|88813101|ref|ZP_01128342.1| recA protein [Nitrococcus mobilis Nb-231]
 gi|88789585|gb|EAR20711.1| recA protein [Nitrococcus mobilis Nb-231]
          Length = 351

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/345 (67%), Positives = 285/345 (82%), Gaps = 9/345 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL  AL QI++ +GKG +M++G   ++ + + V+S+GSL LDIALGIGG P+GR+V
Sbjct: 6   NRKKALNLALGQIEKQFGKGTVMRMGDMQAVRD-VPVISTGSLSLDIALGIGGLPRGRVV 64

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L TIA++QK GG  AFVDAEHALD  YA+KLGVD+  LL+SQPDTG
Sbjct: 65  EIYGPESSGKTTLTLQTIAEAQKAGGIAAFVDAEHALDPDYAQKLGVDINELLLSQPDTG 124

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVDIIV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 125 EQALEITDMLVRSGAVDIIVVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 184

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G+IK  D I GNQT
Sbjct: 185 KRSHSLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEIIGNQT 244

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PFKQ EF+I+YGEGIS  GELI+LGV+  IV+K+GAW+S+ G+R+GQG+
Sbjct: 245 RVKVVKNKMAPPFKQAEFEILYGEGISRQGELIELGVREGIVEKAGAWYSYAGERIGQGK 304

Query: 311 ENSKIFLRENIEIAENIESLLRQ--------NAGLVADSLLQEPA 347
           +N + FL+   E+A  IES LR+        +AG VADS    PA
Sbjct: 305 DNVRSFLKAQPEVAVQIESRLREQLFSKPASSAGEVADSARTPPA 349


>gi|13021987|gb|AAK11601.1|AF323971_1 RecA [Burkholderia dolosa]
          Length = 347

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVAA 331


>gi|272894042|gb|ACZ96547.1| RecA [Burkholderia contaminans]
          Length = 348

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 286/328 (87%), Gaps = 1/328 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLV 338
           +N++ FLREN EIA  IE+ +R++ G+V
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVV 330


>gi|149928250|ref|ZP_01916494.1| recombinase A [Limnobacter sp. MED105]
 gi|149823056|gb|EDM82297.1| recombinase A [Limnobacter sp. MED105]
          Length = 359

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 228/346 (65%), Positives = 288/346 (83%), Gaps = 4/346 (1%)

Query: 2   DYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGI 61
           D R +    +K KAL AALSQI++ +GKG+IM+ G +  I + I+ VS+GSLGLDIALGI
Sbjct: 3   DLRTKNQSSEKVKALAAALSQIEKQFGKGSIMRFG-ENEIIDDIQSVSTGSLGLDIALGI 61

Query: 62  GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKN 121
           GG P+GR+VEIYGPESSGKTTL L  IA+ QK GGTCAF+DAEHALD  YA KLGV+L +
Sbjct: 62  GGLPRGRVVEIYGPESSGKTTLTLQVIAEMQKLGGTCAFIDAEHALDVQYAAKLGVNLPD 121

Query: 122 LLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQ 181
           LLISQPDTGEQALEI D LVRSG+VD++++DSVAALTP+AEIEGDMG+SLPG+QARLMSQ
Sbjct: 122 LLISQPDTGEQALEIVDALVRSGSVDLVIVDSVAALTPKAEIEGDMGDSLPGLQARLMSQ 181

Query: 182 ALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKD 241
           ALRKLT++I R+ C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GSIK 
Sbjct: 182 ALRKLTANIKRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSIKK 241

Query: 242 KDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSF 301
            + + G++TRVKVVKNK++ PFKQ EFDI+YG+G S  GE++DLGV    VDK+GAW+S+
Sbjct: 242 GEEVIGSETRVKVVKNKVSPPFKQAEFDILYGQGTSREGEVVDLGVLHGFVDKAGAWYSY 301

Query: 302 KGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPA 347
            G+++GQG++N++ FL+ N  +A  IE+ +R+  G+    LL+E A
Sbjct: 302 NGEKIGQGKDNARDFLKANPVMAAEIENKIREKLGV---RLLEEAA 344


>gi|30313404|gb|AAM55294.1| RecA [Burkholderia cepacia]
          Length = 333

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 1   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 59

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 60  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 119

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 120 EQALEITDALVRSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 179

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 180 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 239

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 240 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 299

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 DNAREFLRENPEIAREIENRIRESLGVVA 328


>gi|70904898|gb|AAZ14027.1| RecA [Burkholderia cenocepacia]
          Length = 328

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 281/325 (86%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+ MKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIPMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
             LREN EIA  IE+ +R++ G+V+
Sbjct: 300 ELLRENPEIAREIENRIRESLGVVS 324


>gi|132241|sp|P16238|RECA_THIFE RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|154653|gb|AAA27385.1| recA protein [Acidithiobacillus ferrooxidans]
          Length = 346

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 274/324 (84%), Gaps = 1/324 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           +SK L AALSQI + +GKGA+M+LG   +I + IEV S+GSLGLD+ALG+GG P+GR+VE
Sbjct: 5   RSKGLSAALSQIDKQFGKGAVMRLGDHNAI-KDIEVYSTGSLGLDLALGVGGLPRGRVVE 63

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTL LH IA  Q  GGT AF+DAEHALD  YA KLGVDL+NLLISQPDTGE
Sbjct: 64  IYGPESSGKTTLTLHAIASCQAAGGTAAFIDAEHALDPGYAHKLGVDLENLLISQPDTGE 123

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEI DMLVRSGAVD+IVIDSVAALTP+AEIEG+MG+S  G+QARLMSQALR LT++IS
Sbjct: 124 QALEIADMLVRSGAVDLIVIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRNLTANIS 183

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
           RS  +++FINQ+RMKIGVM+GSPETTTGGNALKFY+SVRLDIRR+G+IK  D + GN TR
Sbjct: 184 RSNTLVIFINQIRMKIGVMYGSPETTTGGNALKFYASVRLDIRRIGAIKKSDEVVGNDTR 243

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNK+A PF++ EF I YGEGIS   EL+DLGVK  IV+KSGAW+S++G R+GQG++
Sbjct: 244 VKVVKNKVAPPFREAEFAIYYGEGISRLSELVDLGVKFDIVEKSGAWYSYQGHRIGQGKD 303

Query: 312 NSKIFLRENIEIAENIESLLRQNA 335
           N++ +L+ + E+A NIE  +R  A
Sbjct: 304 NARQYLKVHPELAANIEQRIRAAA 327


>gi|116119172|gb|ABJ74756.1| RecA [Burkholderia sp. R425]
          Length = 347

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQ LEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQTLEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|242133678|gb|ACS87950.1| RecA [Burkholderia cepacia]
 gi|242133682|gb|ACS87952.1| RecA [Burkholderia cepacia]
          Length = 336

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|157326967|gb|ABV44596.1| RecA [Burkholderia multivorans]
          Length = 319

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/320 (70%), Positives = 280/320 (87%), Gaps = 1/320 (0%)

Query: 18  AALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPES 77
           AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPES
Sbjct: 1   AALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPES 59

Query: 78  SGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEIT 137
           SGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEIT
Sbjct: 60  SGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEIT 119

Query: 138 DMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCIL 197
           D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C++
Sbjct: 120 DALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLV 179

Query: 198 VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN 257
           +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKN
Sbjct: 180 IFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKN 239

Query: 258 KMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFL 317
           K++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FL
Sbjct: 240 KVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFL 299

Query: 318 RENIEIAENIESLLRQNAGL 337
           REN EIA  IE+ +R++ G+
Sbjct: 300 RENPEIAREIENRIRESLGV 319


>gi|167585552|ref|ZP_02377940.1| recombinase A [Burkholderia ubonensis Bu]
          Length = 356

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVAA 340


>gi|157326971|gb|ABV44598.1| RecA [Burkholderia multivorans]
          Length = 321

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 225/322 (69%), Positives = 280/322 (86%), Gaps = 1/322 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+ SLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTSSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAG 336
            FLREN EIA  IE+ +R++ G
Sbjct: 300 EFLRENPEIAREIENRIRESLG 321


>gi|239995698|ref|ZP_04716222.1| recombinase A [Alteromonas macleodii ATCC 27126]
          Length = 348

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/343 (66%), Positives = 284/343 (82%), Gaps = 3/343 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AA+ QI++ +GKGAIM+LG   ++   IE +S+GSL +DIALGIGG P GR+V
Sbjct: 4   NKSKALTAAVGQIEKQFGKGAIMRLGDNQAM--DIEAISTGSLTIDIALGIGGLPCGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++Q+ G TCAFVDAEHALD +YA KLGV++  LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQRKGKTCAFVDAEHALDPVYAEKLGVNIDELLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT++I
Sbjct: 122 EQALEICDMLVRSGAVDVVIVDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTANI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G++K+ D + GN+T
Sbjct: 182 KRSNTLCIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAVKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ EF I YGEGIS   ELIDLGVK  +VDK+GAW+S+KG R+GQG+
Sbjct: 242 RVKVVKNKVAPPFKQAEFMIRYGEGISKEAELIDLGVKQKLVDKAGAWYSYKGDRIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
            N   FL+EN EIA  IE+ +RQ   L++ ++  E A+  ++D
Sbjct: 302 ANVMKFLKENPEIANEIETKIRQEL-LLSKTMKAEEAVPQQED 343


>gi|150171056|emb|CAO01511.1| DNA recombination protein [Burkholderia latens]
          Length = 341

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/328 (70%), Positives = 286/328 (87%), Gaps = 1/328 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VE
Sbjct: 2   KSKALAAALAQIEKQFGKGSIMRMGD-GEAKEDIQVVSTGSLGLDIALGVGGLPRGRVVE 60

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGE
Sbjct: 61  IYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGE 120

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I 
Sbjct: 121 QALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIK 180

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
           R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TR
Sbjct: 181 RTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETR 240

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++
Sbjct: 241 VKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKD 300

Query: 312 NSKIFLRENIEIAENIESLLRQNAGLVA 339
           N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 301 NAREFLRENPEIAREIENRIRESLGVVA 328


>gi|126256482|gb|ABO09806.1| RecA [Burkholderia sp. Y10]
          Length = 347

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R + G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRGSLGVVA 331


>gi|150171050|emb|CAO01508.1| DNA recombination protein [Burkholderia seminalis]
          Length = 333

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/324 (69%), Positives = 281/324 (86%), Gaps = 1/324 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLVA 339
           FLREN EIA  IE+ +R++ G+ +
Sbjct: 300 FLRENPEIAREIENRIRESLGVAS 323


>gi|315127429|ref|YP_004069432.1| RecA protein (recombinase A) [Pseudoalteromonas sp. SM9913]
 gi|315015943|gb|ADT69281.1| RecA protein (recombinase A) [Pseudoalteromonas sp. SM9913]
          Length = 347

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/323 (69%), Positives = 276/323 (85%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AALSQI+R +GKG+IM+LG   ++   I+ VS+GSLG+DIALGIGG P GRIV
Sbjct: 4   NKQKALDAALSQIERQFGKGSIMKLGDNKAL--NIDAVSTGSLGIDIALGIGGLPMGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTL L  IA++QK G TCAFVDAEHALD IYA+KLGV++  LL+SQPDTG
Sbjct: 62  EVYGPESSGKTTLTLQVIAEAQKEGKTCAFVDAEHALDPIYAQKLGVNIDELLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRS AVD++++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT +I
Sbjct: 122 EQALEICDMLVRSSAVDVVIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR+DIRR+GS+K+ D + GN+T
Sbjct: 182 KRSNTLCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRIDIRRIGSVKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVK+VKNK+A PFKQ EF IMYGEGIS  GELIDLGVK  +V+K+GAW+S+ G ++GQG+
Sbjct: 242 RVKIVKNKVAPPFKQAEFIIMYGEGISKQGELIDLGVKHKLVEKAGAWYSYNGNKVGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            NS  FL+EN EIA+ IE  LR+
Sbjct: 302 SNSIKFLKENPEIADEIEGKLRE 324


>gi|161523830|ref|YP_001578842.1| recombinase A [Burkholderia multivorans ATCC 17616]
 gi|221200152|ref|ZP_03573195.1| recA protein [Burkholderia multivorans CGD2M]
 gi|221206695|ref|ZP_03579707.1| recA protein [Burkholderia multivorans CGD2]
 gi|221211334|ref|ZP_03584313.1| recA protein [Burkholderia multivorans CGD1]
 gi|160341259|gb|ABX14345.1| recA protein [Burkholderia multivorans ATCC 17616]
 gi|221168695|gb|EEE01163.1| recA protein [Burkholderia multivorans CGD1]
 gi|221173350|gb|EEE05785.1| recA protein [Burkholderia multivorans CGD2]
 gi|221180391|gb|EEE12795.1| recA protein [Burkholderia multivorans CGD2M]
 gi|325520210|gb|EGC99384.1| recombinase A [Burkholderia sp. TJI49]
          Length = 357

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVAA 340


>gi|157326973|gb|ABV44599.1| RecA [Burkholderia multivorans]
 gi|157326985|gb|ABV44605.1| RecA [Burkholderia multivorans]
          Length = 319

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 279/319 (87%), Gaps = 1/319 (0%)

Query: 18  AALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPES 77
           AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPES
Sbjct: 2   AALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPES 60

Query: 78  SGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEIT 137
           SGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEIT
Sbjct: 61  SGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEIT 120

Query: 138 DMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCIL 197
           D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C++
Sbjct: 121 DALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLV 180

Query: 198 VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN 257
           +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKN
Sbjct: 181 IFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKN 240

Query: 258 KMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFL 317
           K++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FL
Sbjct: 241 KVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFL 300

Query: 318 RENIEIAENIESLLRQNAG 336
           REN EIA  IE+ +R++ G
Sbjct: 301 RENPEIAREIENRIRESLG 319


>gi|149374513|ref|ZP_01892287.1| recA protein [Marinobacter algicola DG893]
 gi|149361216|gb|EDM49666.1| recA protein [Marinobacter algicola DG893]
          Length = 350

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/336 (66%), Positives = 276/336 (82%), Gaps = 9/336 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AALSQI+R +GKGA+M++G Q    E I  VS+GSLGLD+ALGIGG P GRI 
Sbjct: 4   NRKKALGAALSQIERQFGKGAVMKMGDQPR--EAIPAVSTGSLGLDVALGIGGLPYGRIC 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAFVDAEHALD +YA KLGV++  LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKAGKTCAFVDAEHALDPVYAEKLGVNVDELLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI+DMLVRS AVD+I++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT ++
Sbjct: 122 EQALEISDMLVRSNAVDVIIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTGNV 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+L+FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD D + GN+T
Sbjct: 182 KHANCLLIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKDGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ EF IMYG+GI    E++D+GVK   VDKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQAEFQIMYGKGIYHMAEVLDMGVKEGFVDKSGAWYAYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
            N+  FL EN+EIA  IE+ +R       D L+ +P
Sbjct: 302 ANACKFLEENLEIANEIEAAVR-------DKLMPKP 330


>gi|167835573|ref|ZP_02462456.1| recombinase A [Burkholderia thailandensis MSMB43]
          Length = 356

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM+LG  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRLGD-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG++LPG+QARLMSQALRKLT SI
Sbjct: 132 EQALEIVDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTGSI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA +IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPEIARDIENRIRESLGVAA 340


>gi|254575568|gb|ACT68298.1| RecA [Burkholderia cepacia]
          Length = 347

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVAA 330


>gi|189351408|ref|YP_001947036.1| recombinase A [Burkholderia multivorans ATCC 17616]
 gi|205562578|sp|A9AFT0|RECA_BURM1 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|10121154|gb|AAG13089.1|AF143774_1 RecA [Burkholderia multivorans]
 gi|10121156|gb|AAG13090.1|AF143775_1 RecA [Burkholderia multivorans ATCC 17616]
 gi|10121158|gb|AAG13091.1|AF143776_1 RecA [Burkholderia multivorans]
 gi|10121160|gb|AAG13092.1|AF143777_1 RecA [Burkholderia multivorans]
 gi|10121162|gb|AAG13093.1|AF143778_1 RecA [Burkholderia multivorans]
 gi|1575711|gb|AAB09577.1| RecA protein [Burkholderia cepacia]
 gi|189335430|dbj|BAG44500.1| recombination protein [Burkholderia multivorans ATCC 17616]
          Length = 348

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVAA 331


>gi|116119158|gb|ABJ74749.1| RecA [Burkholderia sp. M293]
          Length = 347

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A I DK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIADKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVS 331


>gi|116119150|gb|ABJ74745.1| RecA [Burkholderia sp. M229]
          Length = 347

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/348 (66%), Positives = 295/348 (84%), Gaps = 4/348 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALK YSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKLYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           +N++ FLREN EIA  IE+ +R++ G+VA   + +  +N  +  D+++
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA---MPDGVVNEAEAMDEEE 347


>gi|70904880|gb|AAZ14018.1| RecA [Burkholderia cenocepacia]
          Length = 324

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 225/322 (69%), Positives = 280/322 (86%), Gaps = 1/322 (0%)

Query: 18  AALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPES 77
           AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPES
Sbjct: 2   AALAQIEKQFGKGSIMRMGD-GEAKEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPES 60

Query: 78  SGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEIT 137
           SGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEIT
Sbjct: 61  SGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEIT 120

Query: 138 DMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCIL 197
           D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C++
Sbjct: 121 DALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLV 180

Query: 198 VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN 257
           +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKN
Sbjct: 181 IFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKN 240

Query: 258 KMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFL 317
           K++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FL
Sbjct: 241 KVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFL 300

Query: 318 RENIEIAENIESLLRQNAGLVA 339
           REN EIA  IE+ +R++ G+ A
Sbjct: 301 RENPEIALEIENRIRESLGVAA 322


>gi|242133676|gb|ACS87949.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLG+++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGMNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|150171052|emb|CAO01509.1| DNA recombination protein [Burkholderia seminalis]
          Length = 330

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/331 (68%), Positives = 284/331 (85%), Gaps = 5/331 (1%)

Query: 13  SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72
           SKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEI
Sbjct: 1   SKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEI 59

Query: 73  YGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQ 132
           YGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQ
Sbjct: 60  YGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQ 119

Query: 133 ALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISR 192
           ALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R
Sbjct: 120 ALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKR 179

Query: 193 SKCIL----VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGN 248
           + C++    +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN
Sbjct: 180 TNCLVTASCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGN 239

Query: 249 QTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQ 308
           +TRVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQ
Sbjct: 240 ETRVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQ 299

Query: 309 GRENSKIFLRENIEIAENIESLLRQNAGLVA 339
           G++N++ FLREN EIA  IE+ +R++ G+ +
Sbjct: 300 GKDNAREFLRENPEIAREIENRIRESLGVAS 330


>gi|254575556|gb|ACT68292.1| RecA [Burkholderia cepacia]
 gi|254575558|gb|ACT68293.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/348 (66%), Positives = 295/348 (84%), Gaps = 4/348 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
           +N++ FLREN EIA  IE+ +R++ G+ A   + +  +N  +  D+++
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVAA---MPDGVVNEAEAMDEEE 346


>gi|10121166|gb|AAG13095.1|AF143780_1 RecA [Burkholderia cepacia]
          Length = 347

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGG+ALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGSALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|16125339|ref|NP_419903.1| recombinase A [Caulobacter crescentus CB15]
 gi|221234078|ref|YP_002516514.1| recombinase A [Caulobacter crescentus NA1000]
 gi|20178056|sp|Q9A9A7|RECA_CAUCR RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|254790426|sp|B8H3I7|RECA_CAUCN RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|13422391|gb|AAK23071.1| recA protein [Caulobacter crescentus CB15]
 gi|220963250|gb|ACL94606.1| RecA protein [Caulobacter crescentus NA1000]
          Length = 356

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 235/333 (70%), Positives = 287/333 (86%), Gaps = 2/333 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK +ALEAAL+QI R +GKG++M+LG +G +   IE VS+GSLGLDIALGIGG PKGRIV
Sbjct: 16  DKQRALEAALAQIDRAFGKGSVMKLGEKGKVE--IESVSTGSLGLDIALGIGGLPKGRIV 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTLALH +A+ QK GGT AFVDAEHALD  YA KLGV+L NLL+SQPD G
Sbjct: 74  EVYGPESSGKTTLALHVVAEVQKAGGTAAFVDAEHALDPSYAYKLGVNLDNLLVSQPDNG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAVDI+V+DSVAALTP+AEIEG+MG+SLPG+QARLMSQALRKLT+SI
Sbjct: 134 EQALEITDTLVRSGAVDIVVVDSVAALTPKAEIEGEMGDSLPGLQARLMSQALRKLTASI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +++  I++FINQ+R KIGVM+GSPETTTGGNALKFY+SVRLDIRR GS+K +D I GN  
Sbjct: 194 NKANTIVIFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSVKARDEIVGNNV 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++VEFDIMYGEGIS  GE+IDLGVKA I+DK+G+WFS+  QR+GQGR
Sbjct: 254 RVKVVKNKVAPPFREVEFDIMYGEGISKLGEVIDLGVKAGIIDKAGSWFSYGSQRIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           +N + FL+ N ++A +IE  +R+++  + + LL
Sbjct: 314 DNVREFLKNNPDVAADIEKAVRKSSQKIEEELL 346


>gi|254575566|gb|ACT68297.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PET TGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETMTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVA 330


>gi|148653778|ref|YP_001280871.1| recombinase A [Psychrobacter sp. PRwf-1]
 gi|172048565|sp|A5WGY0|RECA_PSYWF RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|148572862|gb|ABQ94921.1| recA protein [Psychrobacter sp. PRwf-1]
          Length = 349

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/336 (67%), Positives = 278/336 (82%), Gaps = 7/336 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL+AAL QI++ +GK  IM LG   +  + ++VVS+GSLGLDIALGIGG PKGRI+
Sbjct: 4   NKAKALKAALGQIEKQFGKNTIMHLGDNSATLD-VDVVSTGSLGLDIALGIGGLPKGRII 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGTCAF+DAEHALD IYARKLGV+  +LL+SQPD G
Sbjct: 63  EIYGPESSGKTTLTLQAIAECQKQGGTCAFIDAEHALDPIYARKLGVNTDDLLVSQPDNG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGA+D+IVIDSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 123 EQALEITDMLVRSGALDMIVIDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNA 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K  D I GNQT
Sbjct: 183 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKSGDEIIGNQT 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKV+KNKMA PF+Q EF+I YGEG +   E+IDLGV+  +V K+GAW+S+  +++GQG+
Sbjct: 243 RVKVIKNKMAPPFRQAEFEITYGEGTNHLAEVIDLGVEIGVVGKAGAWYSYGDEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
            NS +FL++N  IAE IE+ +R      A+ L  EP
Sbjct: 303 ANSVLFLKDNPAIAEEIEAKIR------AEKLAVEP 332


>gi|300113490|ref|YP_003760065.1| recA protein [Nitrosococcus watsonii C-113]
 gi|299539427|gb|ADJ27744.1| recA protein [Nitrosococcus watsonii C-113]
          Length = 342

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 222/324 (68%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AALSQI++ +GKGA+M+LG   SI   +EV+S+GSLGLDIALG+GG P+GR+V
Sbjct: 4   NRKKALGAALSQIEKQFGKGAVMRLGD-ASIVREVEVISTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPE+SGKTTLAL   A++Q  GGT AFVDAEHALD  YA +LGV++++LL+SQPDTG
Sbjct: 63  EIFGPEASGKTTLALQVAAEAQALGGTAAFVDAEHALDPQYAERLGVNVEDLLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++VIDSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEIADMLVRSGAVDVVVIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRRVG++K  D I GN+T
Sbjct: 183 KRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGALKKGDEIVGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PFKQV FDI+YG G+S  GE+IDLGV+  +++K+GAW+S+KG+R+GQGR
Sbjct: 243 RVKVVKNKMAPPFKQVSFDILYGSGVSREGEIIDLGVREGLIEKAGAWYSYKGERIGQGR 302

Query: 311 ENSKIFLRENIEIAENIESLLRQN 334
           +N + FL+E+ +IA+ IE+ +R+ 
Sbjct: 303 DNVRQFLKEHRDIAQEIEAHIREK 326


>gi|237908825|gb|ACR33788.1| RecA [Burkholderia caribensis]
          Length = 319

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 279/319 (87%), Gaps = 1/319 (0%)

Query: 18  AALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPES 77
           AAL+QI++ +GKG++M+LG QG   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPES
Sbjct: 2   AALAQIEKQFGKGSVMRLG-QGEAVEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPES 60

Query: 78  SGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEIT 137
           SGKTTL L  +A+ QK GGT AF+DAEHALD  YA+KLGV++ +LL+SQPDTGEQALEI 
Sbjct: 61  SGKTTLTLQVVAEMQKVGGTAAFIDAEHALDIQYAQKLGVNVSDLLVSQPDTGEQALEIA 120

Query: 138 DMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCIL 197
           D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C++
Sbjct: 121 DALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLV 180

Query: 198 VFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN 257
           +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKN
Sbjct: 181 IFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKN 240

Query: 258 KMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFL 317
           K++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G R+GQG++N++ FL
Sbjct: 241 KVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGDRIGQGKDNAREFL 300

Query: 318 RENIEIAENIESLLRQNAG 336
           REN +IA  IE+ +R++ G
Sbjct: 301 RENPDIAREIENRIRESLG 319


>gi|167579956|ref|ZP_02372830.1| recombinase A [Burkholderia thailandensis TXDOH]
          Length = 356

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 285/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM+LG  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRLGD-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG++LPG+QARLMSQALRKLT SI
Sbjct: 132 EQALEIVDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTGSI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVAA 340


>gi|187478799|ref|YP_786823.1| recombinase A [Bordetella avium 197N]
 gi|123738620|sp|Q2KYE8|RECA_BORA1 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|115423385|emb|CAJ49919.1| RecA protein (recombinase A) [Bordetella avium 197N]
          Length = 353

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 274/318 (86%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM+ G    +   I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 22  QIEKQFGKGSIMRYGDN-EVEHDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 80

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGTCAFVDAEHALD  YA KLGV+L +LLISQPDTGEQALEITD LV
Sbjct: 81  TLTLQVIAEMQKVGGTCAFVDAEHALDVQYASKLGVNLGDLLISQPDTGEQALEITDALV 140

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG+VD+IVIDSVAAL P+AEIEG+MG++LPG+QARLMSQALRKLT++I R+ C+++FIN
Sbjct: 141 RSGSVDLIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTATIKRTNCMVIFIN 200

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK+A 
Sbjct: 201 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKGDEVVGNETRVKVVKNKVAP 260

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PFKQ EFDIMYG GIS  GE+IDLGV A++++KSGAW+S+ G R+GQG++N + +L+EN 
Sbjct: 261 PFKQAEFDIMYGAGISREGEIIDLGVAANVIEKSGAWYSYSGNRIGQGKDNVREYLKENR 320

Query: 322 EIAENIESLLRQNAGLVA 339
            +A  IE+ +R N G+VA
Sbjct: 321 AMAIEIENKIRDNQGIVA 338


>gi|152980318|ref|YP_001354551.1| recombinase A [Janthinobacterium sp. Marseille]
 gi|166220652|sp|A6T204|RECA_JANMA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|151280395|gb|ABR88805.1| RecA recombination protein [Janthinobacterium sp. Marseille]
          Length = 367

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 228/337 (67%), Positives = 287/337 (85%), Gaps = 1/337 (0%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K     DKSKAL AAL+QI++ +GKG++M++   G++ E ++VVS+GSLGLDIALG
Sbjct: 1   MDDKKNAPSSDKSKALAAALAQIEKQFGKGSVMRM-EDGAVVEEVQVVSTGSLGLDIALG 59

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           +GG P+GR+VEIYGPESSGKTTL L TIA+ QK GGTCAF+DAEHALD  YA+KLG++L 
Sbjct: 60  VGGLPRGRVVEIYGPESSGKTTLTLQTIAEMQKLGGTCAFIDAEHALDVTYAQKLGINLS 119

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
           +LLISQPDTGEQALEI D LVRSG VD+IVIDSVAALTPRAEIEGDMG+SLPG+QARLMS
Sbjct: 120 DLLISQPDTGEQALEICDALVRSGGVDLIVIDSVAALTPRAEIEGDMGDSLPGLQARLMS 179

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLT SI+R+  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR GSIK
Sbjct: 180 QALRKLTGSINRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIK 239

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
             D + GN+T+VKVVKNK+A PFK+  FDI+YGEG S  GE++DLG  A IV+KSGAW+S
Sbjct: 240 SGDEVIGNETKVKVVKNKIAPPFKEAHFDILYGEGTSREGEILDLGSDAKIVEKSGAWYS 299

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           + G+R+GQG++N++ +L+E  ++A  IE+ +R + G+
Sbjct: 300 YNGERIGQGKDNARNYLKERPDLAREIENKVRVSLGV 336


>gi|217969145|ref|YP_002354379.1| recombinase A [Thauera sp. MZ1T]
 gi|217506472|gb|ACK53483.1| recA protein [Thauera sp. MZ1T]
          Length = 345

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/327 (69%), Positives = 280/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL AALSQI++ +GKG+IM++G  GSI   I+ VS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   NKAKALSAALSQIEKQFGKGSIMRMGD-GSIERDIQTVSTGSLGLDIALGLGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGVD+++LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDVGYAEKLGVDIEDLLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSG VDI+VIDSVAALTP+AEIEG+MG+ LPG+QARLMSQALRKLT++I
Sbjct: 123 EQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVR+DIRR G+IK  D + G++T
Sbjct: 183 KRTNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRMDIRRTGTIKKGDEVVGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFK+  FDI+YGEGIS  GE+IDLGV+  IVDKSGAW+++KG ++GQG+
Sbjct: 243 RVKVVKNKVSPPFKEAHFDILYGEGISREGEIIDLGVEHKIVDKSGAWYAYKGDKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +NS+ FLR N  +A  IE+ +R   GL
Sbjct: 303 DNSREFLRANPVLAREIENKVRVAVGL 329


>gi|170693424|ref|ZP_02884583.1| recA protein [Burkholderia graminis C4D1M]
 gi|170141579|gb|EDT09748.1| recA protein [Burkholderia graminis C4D1M]
          Length = 357

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLGA-GEVVEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVIAEMQKIGGTAAFIDAEHALDIQYAGKLGVNVNDLLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 313 DNAREFLRENPDIAREIENRIRESLGVNA 341


>gi|30313406|gb|AAM55296.1| RecA [Burkholderia cepacia]
          Length = 331

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/329 (68%), Positives = 283/329 (86%), Gaps = 3/329 (0%)

Query: 20  LSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSG 79
           L+QI++ +GKG+IM++G      E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSG
Sbjct: 4   LAQIEKQFGKGSIMRMGD-AEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSG 62

Query: 80  KTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDM 139
           KTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD 
Sbjct: 63  KTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDA 122

Query: 140 LVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVF 199
           LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++F
Sbjct: 123 LVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIF 182

Query: 200 INQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKM 259
           INQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK+
Sbjct: 183 INQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKV 242

Query: 260 ASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRE 319
           A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLRE
Sbjct: 243 APPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRE 302

Query: 320 NIEIAENIESLLRQNAGLVA--DSLLQEP 346
           N EIA  IE+ +R++ G+VA  ++L  +P
Sbjct: 303 NPEIAREIENRIRESLGVVAMPEALATKP 331


>gi|30313398|gb|AAM55293.1| RecA [Burkholderia cepacia]
          Length = 347

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEVAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QA LMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQALLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|242133658|gb|ACS87940.1| RecA [Burkholderia cepacia]
          Length = 346

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  I + QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVITELQKIGGTAAFIDAEHALDIQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|163856367|ref|YP_001630665.1| recombinase A [Bordetella petrii DSM 12804]
 gi|229470327|sp|A9IKD2|RECA_BORPD RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|163260095|emb|CAP42396.1| RecA protein [Bordetella petrii]
          Length = 357

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 276/318 (86%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM+ G    +   I+VVS+GSLGLDIALG+GG P+GR++EIYGPESSGKT
Sbjct: 23  QIEKQFGKGSIMRYGDN-EVEHDIQVVSTGSLGLDIALGVGGLPRGRVIEIYGPESSGKT 81

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGTCAFVDAEHALD  YA KLGV+L +LLISQPDTGEQALEITD LV
Sbjct: 82  TLTLQVIAEMQKIGGTCAFVDAEHALDVQYAAKLGVNLTDLLISQPDTGEQALEITDALV 141

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT++I R+ C+++FIN
Sbjct: 142 RSGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFIN 201

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  + + GN+TRVKVVKNK++ 
Sbjct: 202 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKGEEVVGNETRVKVVKNKVSP 261

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PFKQ EFDIMYG GIS  GE+IDLGV+A +VDKSGAW+S+ G R+GQG++N + +L+E+ 
Sbjct: 262 PFKQAEFDIMYGAGISREGEIIDLGVQAGVVDKSGAWYSYSGTRIGQGKDNVREYLKEHP 321

Query: 322 EIAENIESLLRQNAGLVA 339
           E+A  IE+ +R+N G+V+
Sbjct: 322 ELAVEIENKVRENQGIVS 339


>gi|270342006|gb|ACZ74645.1| RecA [Burkholderia cepacia]
          Length = 347

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IES +R++ G+ +
Sbjct: 302 DNAREFLRENPEIAREIESRIRESLGVAS 330


>gi|116119164|gb|ABJ74752.1| RecA [Burkholderia sp. M317]
          Length = 347

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GS GLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSPGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVS 331


>gi|254575562|gb|ACT68295.1| RecA [Burkholderia cepacia]
          Length = 347

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNAL+FYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALRFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVAA 330


>gi|77359646|ref|YP_339221.1| RecA protein (recombinase A) [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874557|emb|CAI85778.1| RecA protein (Recombinase A) [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 347

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 234/352 (66%), Positives = 285/352 (80%), Gaps = 11/352 (3%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AALSQI+R +GKG+IM+LG   ++   IE VS+GSLG+DIALGIGG P GRIV
Sbjct: 4   NKQKALDAALSQIERQFGKGSIMKLGDNKAL--NIESVSTGSLGIDIALGIGGLPMGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTL L  IA++QK G TCAF+DAEHALD +YA+KLGV++  L +SQPDTG
Sbjct: 62  EVYGPESSGKTTLTLQVIAEAQKEGKTCAFIDAEHALDPVYAQKLGVNIDELFVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRS AVD+++IDSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT +I
Sbjct: 122 EQALEICDMLVRSSAVDVVIIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR+DIRR+GS+K+ D + GN+T
Sbjct: 182 KRSNTLCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRIDIRRIGSVKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVK+VKNK+A PFKQ EF IMYGEGIS  GELIDLGVK  IV+K+GAW+S+ G ++GQG+
Sbjct: 242 RVKIVKNKVAPPFKQAEFIIMYGEGISKQGELIDLGVKHKIVEKAGAWYSYCGNKVGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADK--DDTD 360
            NS  FL+EN EIA+ IE  LR+        LL +  I   D  DK  D+ D
Sbjct: 302 SNSIKFLKENPEIADEIEGKLRE-------MLLLKATIEPDDGEDKLGDEAD 346


>gi|53718415|ref|YP_107401.1| recombinase A [Burkholderia pseudomallei K96243]
 gi|53724718|ref|YP_102098.1| recombinase A [Burkholderia mallei ATCC 23344]
 gi|67639766|ref|ZP_00438601.1| protein RecA [Burkholderia mallei GB8 horse 4]
 gi|76809737|ref|YP_332384.1| recombinase A [Burkholderia pseudomallei 1710b]
 gi|121598818|ref|YP_993968.1| recombinase A [Burkholderia mallei SAVP1]
 gi|124385042|ref|YP_001028365.1| recombinase A [Burkholderia mallei NCTC 10229]
 gi|126441506|ref|YP_001057861.1| recombinase A [Burkholderia pseudomallei 668]
 gi|126448472|ref|YP_001079599.1| recombinase A [Burkholderia mallei NCTC 10247]
 gi|126452699|ref|YP_001065095.1| recombinase A [Burkholderia pseudomallei 1106a]
 gi|166998886|ref|ZP_02264738.1| recA protein [Burkholderia mallei PRL-20]
 gi|167718276|ref|ZP_02401512.1| recombinase A [Burkholderia pseudomallei DM98]
 gi|167737323|ref|ZP_02410097.1| recombinase A [Burkholderia pseudomallei 14]
 gi|167814447|ref|ZP_02446127.1| recombinase A [Burkholderia pseudomallei 91]
 gi|167822913|ref|ZP_02454384.1| recombinase A [Burkholderia pseudomallei 9]
 gi|167844480|ref|ZP_02469988.1| recombinase A [Burkholderia pseudomallei B7210]
 gi|167893005|ref|ZP_02480407.1| recombinase A [Burkholderia pseudomallei 7894]
 gi|167901469|ref|ZP_02488674.1| recombinase A [Burkholderia pseudomallei NCTC 13177]
 gi|167909714|ref|ZP_02496805.1| recombinase A [Burkholderia pseudomallei 112]
 gi|167917736|ref|ZP_02504827.1| recombinase A [Burkholderia pseudomallei BCC215]
 gi|217419940|ref|ZP_03451446.1| RecA protein [Burkholderia pseudomallei 576]
 gi|226199408|ref|ZP_03794966.1| recA protein [Burkholderia pseudomallei Pakistan 9]
 gi|237811009|ref|YP_002895460.1| protein RecA [Burkholderia pseudomallei MSHR346]
 gi|242317165|ref|ZP_04816181.1| recA protein [Burkholderia pseudomallei 1106b]
 gi|254176888|ref|ZP_04883545.1| recA protein [Burkholderia mallei ATCC 10399]
 gi|254181635|ref|ZP_04888232.1| recA protein [Burkholderia pseudomallei 1655]
 gi|254187593|ref|ZP_04894105.1| recA protein [Burkholderia pseudomallei Pasteur 52237]
 gi|254196276|ref|ZP_04902700.1| recA protein [Burkholderia pseudomallei S13]
 gi|254203781|ref|ZP_04910141.1| recA protein [Burkholderia mallei FMH]
 gi|254208758|ref|ZP_04915106.1| recA protein [Burkholderia mallei JHU]
 gi|254260268|ref|ZP_04951322.1| recA protein [Burkholderia pseudomallei 1710a]
 gi|254296286|ref|ZP_04963743.1| recA protein [Burkholderia pseudomallei 406e]
 gi|254360185|ref|ZP_04976455.1| recA protein [Burkholderia mallei 2002721280]
 gi|59798167|sp|Q62MH0|RECA_BURMA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|59798209|sp|Q66X92|RECA_BURPS RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|51594210|gb|AAU08168.1| RecA [Burkholderia pseudomallei]
 gi|52208829|emb|CAH34768.1| putative recombinase A [Burkholderia pseudomallei K96243]
 gi|52428141|gb|AAU48734.1| recA protein [Burkholderia mallei ATCC 23344]
 gi|76579190|gb|ABA48665.1| recA protein [Burkholderia pseudomallei 1710b]
 gi|121227628|gb|ABM50146.1| recA protein [Burkholderia mallei SAVP1]
 gi|124293062|gb|ABN02331.1| RecA protein [Burkholderia mallei NCTC 10229]
 gi|126220999|gb|ABN84505.1| RecA protein [Burkholderia pseudomallei 668]
 gi|126226341|gb|ABN89881.1| recA protein [Burkholderia pseudomallei 1106a]
 gi|126241342|gb|ABO04435.1| RecA protein [Burkholderia mallei NCTC 10247]
 gi|147745293|gb|EDK52373.1| recA protein [Burkholderia mallei FMH]
 gi|147750634|gb|EDK57703.1| recA protein [Burkholderia mallei JHU]
 gi|148029425|gb|EDK87330.1| recA protein [Burkholderia mallei 2002721280]
 gi|157805935|gb|EDO83105.1| recA protein [Burkholderia pseudomallei 406e]
 gi|157935273|gb|EDO90943.1| recA protein [Burkholderia pseudomallei Pasteur 52237]
 gi|160697929|gb|EDP87899.1| recA protein [Burkholderia mallei ATCC 10399]
 gi|169653019|gb|EDS85712.1| recA protein [Burkholderia pseudomallei S13]
 gi|184212173|gb|EDU09216.1| recA protein [Burkholderia pseudomallei 1655]
 gi|217397244|gb|EEC37260.1| RecA protein [Burkholderia pseudomallei 576]
 gi|225928484|gb|EEH24513.1| recA protein [Burkholderia pseudomallei Pakistan 9]
 gi|237506701|gb|ACQ99019.1| protein RecA [Burkholderia pseudomallei MSHR346]
 gi|238520364|gb|EEP83825.1| protein RecA [Burkholderia mallei GB8 horse 4]
 gi|242140404|gb|EES26806.1| recA protein [Burkholderia pseudomallei 1106b]
 gi|243064966|gb|EES47152.1| recA protein [Burkholderia mallei PRL-20]
 gi|254218957|gb|EET08341.1| recA protein [Burkholderia pseudomallei 1710a]
          Length = 356

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 285/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM+LG  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRLGD-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG++LPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEIVDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGVAA 340


>gi|307730901|ref|YP_003908125.1| recA protein [Burkholderia sp. CCGE1003]
 gi|307585436|gb|ADN58834.1| recA protein [Burkholderia sp. CCGE1003]
          Length = 357

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLGA-GEVVEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 313 DNAREFLRENPDIAREIENRIRESLGVNA 341


>gi|226953077|ref|ZP_03823541.1| recombinase A [Acinetobacter sp. ATCC 27244]
 gi|226836169|gb|EEH68552.1| recombinase A [Acinetobacter sp. ATCC 27244]
          Length = 347

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/323 (68%), Positives = 272/323 (84%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL+AALSQI++ +GK  +M+LG   +  + +E VS+GSL LDIALGIGG PKGRI+
Sbjct: 4   NKSKALQAALSQIEKQFGKNTVMRLGD--NTVQAVEAVSTGSLTLDIALGIGGLPKGRII 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IAQ QKTGGTCAF+DAEHALD  YARKLGVD+ NLL+SQPD G
Sbjct: 62  EIYGPESSGKTTMTLQAIAQCQKTGGTCAFIDAEHALDPEYARKLGVDIDNLLVSQPDNG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 122 EQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGNA 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+ D ITGN+T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEGDEITGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PFK+  F IMYG+G +  GEL+DL V+  IV K+GAW+S++G ++GQG+
Sbjct: 242 RVKVVKNKMAPPFKEAVFQIMYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N      EN ++A+ IE L+R+
Sbjct: 302 NNVIRHFEENPQMAQEIEKLIRE 324


>gi|88798291|ref|ZP_01113877.1| recombinase A [Reinekea sp. MED297]
 gi|88779067|gb|EAR10256.1| recombinase A [Reinekea sp. MED297]
          Length = 365

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/322 (68%), Positives = 273/322 (84%), Gaps = 2/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AALSQI+R +GKG++M++G Q  +   +  +S+GSLGLDIALGIGG PKGR+V
Sbjct: 9   NKEKALSAALSQIERQFGKGSVMRMGDQEKV--NVPAISTGSLGLDIALGIGGLPKGRVV 66

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK GGTCAFVDAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 67  EIYGPESSGKTTLTLQVIAEAQKAGGTCAFVDAEHALDPNYAGKLGVNVDDLLVSQPDTG 126

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRS AVD+I++DSVAAL P+AEIEG+MG+   G+QARLMSQALRK+T +I
Sbjct: 127 EQALEITDMLVRSNAVDVIIVDSVAALVPKAEIEGEMGDHHVGLQARLMSQALRKITGNI 186

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR G+IKD D + G++T
Sbjct: 187 KTANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGTIKDGDEVVGSET 246

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ EF IMYG+GI   GE+IDLGVK  +V+KSGAW+S+KG ++GQG+
Sbjct: 247 RVKVVKNKVAPPFKQAEFQIMYGKGIYHLGEVIDLGVKIGLVEKSGAWYSYKGNKIGQGK 306

Query: 311 ENSKIFLRENIEIAENIESLLR 332
            N+  FL EN E+A+ IE+ +R
Sbjct: 307 ANAAKFLGENPEMAQEIEAAIR 328


>gi|29654363|ref|NP_820055.1| recombinase A [Coxiella burnetii RSA 493]
 gi|154707523|ref|YP_001424368.1| recombinase A [Coxiella burnetii Dugway 5J108-111]
 gi|161830332|ref|YP_001596675.1| recombinase A [Coxiella burnetii RSA 331]
 gi|165918533|ref|ZP_02218619.1| protein RecA [Coxiella burnetii RSA 334]
 gi|212212529|ref|YP_002303465.1| recombinase A [Coxiella burnetii CbuG_Q212]
 gi|37537929|sp|Q83CQ4|RECA_COXBU RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|29541630|gb|AAO90569.1| RecA [Coxiella burnetii RSA 493]
 gi|154356809|gb|ABS78271.1| RecA [Coxiella burnetii Dugway 5J108-111]
 gi|161762199|gb|ABX77841.1| protein RecA [Coxiella burnetii RSA 331]
 gi|165917779|gb|EDR36383.1| protein RecA [Coxiella burnetii RSA 334]
 gi|212010939|gb|ACJ18320.1| RecA [Coxiella burnetii CbuG_Q212]
          Length = 343

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/323 (70%), Positives = 282/323 (87%), Gaps = 1/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++S AL AALSQI+R +GKG++M+LG  G I + I+V+S+GSLGLDIALG+GG P+GRI+
Sbjct: 3   NRSNALNAALSQIERQFGKGSVMRLGDPGLIPD-IDVISTGSLGLDIALGVGGLPRGRII 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPE+SGKTTLAL TIA  Q+ GGT AFVDAEHALD+IYA KLGV +++LL+SQPDTG
Sbjct: 62  EIYGPEASGKTTLALQTIASCQRMGGTAAFVDAEHALDAIYAGKLGVKVEDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD+IVIDSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT++I
Sbjct: 122 EQALEITDMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            +S  +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G+IK  + I G++T
Sbjct: 182 KKSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGEEILGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QVEFDI+YG GIS   ELIDLGVK  +V+K+GAW+S+ G+R+GQG+
Sbjct: 242 RVKVVKNKVAPPFRQVEFDILYGLGISRESELIDLGVKNELVEKAGAWYSYNGERIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
           EN + F  EN +IA  IE+ LR+
Sbjct: 302 ENVRQFFLENPKIAGEIETRLRE 324


>gi|116119156|gb|ABJ74748.1| RecA [Burkholderia sp. M292]
          Length = 347

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ P ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPSREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVS 331


>gi|295677592|ref|YP_003606116.1| recA protein [Burkholderia sp. CCGE1002]
 gi|295437435|gb|ADG16605.1| recA protein [Burkholderia sp. CCGE1002]
          Length = 358

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVADLLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 313 DNAREFLRENPDIAREIENRIRESLGVTA 341


>gi|209518322|ref|ZP_03267147.1| recA protein [Burkholderia sp. H160]
 gi|209501241|gb|EEA01272.1| recA protein [Burkholderia sp. H160]
          Length = 358

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVADLLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 313 DNAREFLRENPDIAREIENRIRESLGVTA 341


>gi|242133666|gb|ACS87944.1| RecA [Burkholderia cepacia]
          Length = 332

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/329 (69%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 1   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 59

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 60  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 119

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG+VD+IVIDSVAAL P+AEIEG++G+SLPG+QARLMSQALRKLT +I
Sbjct: 120 EQALEITDALVRSGSVDMIVIDSVAALVPKAEIEGEVGDSLPGLQARLMSQALRKLTGTI 179

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 180 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 239

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 240 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 299

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 300 DNAREFLRENPEIAREIENRIRESLGVVA 328


>gi|157826209|ref|YP_001493929.1| recombinase A [Rickettsia akari str. Hartford]
 gi|157800167|gb|ABV75421.1| recombinase A [Rickettsia akari str. Hartford]
          Length = 362

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/356 (64%), Positives = 289/356 (81%), Gaps = 11/356 (3%)

Query: 5   KEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGF 64
           K M+  DK +A+ AAL QI++ YGKG++M+LG + ++   IE VS+GSLGLDIALGIGG 
Sbjct: 18  KFMSNTDKERAIAAALVQIEKSYGKGSVMKLGQRPNV--DIEAVSTGSLGLDIALGIGGV 75

Query: 65  PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124
           PKGRI+EI+GPESSGKTTL LH IA++QK GGTCAF+DAEHALD  YA+KLGV++  L+I
Sbjct: 76  PKGRIIEIFGPESSGKTTLTLHLIAEAQKKGGTCAFIDAEHALDPAYAKKLGVNIDELII 135

Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184
           SQPDTGEQALEITD L+RSG +D+I+IDSVAAL P++EIEG+MG++    QARLMSQALR
Sbjct: 136 SQPDTGEQALEITDTLIRSGGIDMIIIDSVAALVPKSEIEGEMGDAQMASQARLMSQALR 195

Query: 185 KLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDS 244
           KLT+SI+R+ CI VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVR+DIRR+GSIKDK+ 
Sbjct: 196 KLTASINRTNCITVFINQIRMKIGVMFGSPETTTGGNALKFYASVRIDIRRIGSIKDKEE 255

Query: 245 ITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQ 304
           + G+QTRVKVVKNK++ PFK  +FDIMYG GIS  GE+IDLGVK  IV+KSG+WFS+   
Sbjct: 256 VIGSQTRVKVVKNKVSPPFKTADFDIMYGSGISKEGEIIDLGVKLDIVEKSGSWFSYNNV 315

Query: 305 RLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTD 360
           R+GQGREN K +L+E+ +I+  IE ++R+ +  +         IN   D  +D+ D
Sbjct: 316 RIGQGRENVKQYLKEHPQISNEIEKIIREKSSKI---------ININLDQMEDEND 362


>gi|30141700|emb|CAD82859.1| RecA protein [Burkholderia graminis C4D1M]
          Length = 350

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 288/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 12  EKSKALAAALAQIEKQFGKGSVMRLGA-GEVVEDIQVVSTGSLGLDIALGVGGLPRGRVV 70

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 71  EIYGPESSGKTTLTLQVIAEMQKIGGTAAFIDAEHALDIQYAGKLGVNVNDLLVSQPDTG 130

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 131 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 190

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 191 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 250

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 251 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGERIGQGK 310

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 311 DNAREFLRENPDIAREIENRIRESLGVNA 339


>gi|294650666|ref|ZP_06728020.1| recombination protein A [Acinetobacter haemolyticus ATCC 19194]
 gi|292823457|gb|EFF82306.1| recombination protein A [Acinetobacter haemolyticus ATCC 19194]
          Length = 347

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/323 (68%), Positives = 272/323 (84%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL+AALSQI++ +GK  +M+LG   +  + +E VS+GSL LDIALGIGG PKGRI+
Sbjct: 4   NKSKALQAALSQIEKQFGKNTVMRLGD--NTVQAVEAVSTGSLTLDIALGIGGLPKGRII 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IAQ QKTGGTCAF+DAEHALD  YARKLGVD+ NLL+SQPD G
Sbjct: 62  EIYGPESSGKTTMTLQAIAQCQKTGGTCAFIDAEHALDPEYARKLGVDIDNLLVSQPDNG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 122 EQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGNA 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++K+ D ITGN+T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKEGDEITGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PFK+  F IMYG+G +  GEL+DL V+  IV K+GAW+S++G ++GQG+
Sbjct: 242 RVKVVKNKMAPPFKEAVFQIMYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N      EN ++A+ IE L+R+
Sbjct: 302 NNVIRHFEENPQMAQEIEKLIRE 324


>gi|134095796|ref|YP_001100871.1| recombinase A [Herminiimonas arsenicoxydans]
 gi|166220651|sp|A4G8B3|RECA_HERAR RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|133739699|emb|CAL62750.1| Protein RecA (Recombinase A) [Herminiimonas arsenicoxydans]
          Length = 367

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 286/337 (84%), Gaps = 1/337 (0%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD +K     DKSKAL AAL+QI++ +GKG++M++   G++ E ++VVS+GSLGLD+ALG
Sbjct: 1   MDDKKNAPSSDKSKALAAALAQIEKQFGKGSVMRM-EDGAVVEEVQVVSTGSLGLDLALG 59

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           +GG P+GR+VEIYGPESSGKTTL L TIA+ QK GGTCAF+DAEHALD  YA+KLG++L 
Sbjct: 60  VGGLPRGRVVEIYGPESSGKTTLTLQTIAEMQKLGGTCAFIDAEHALDVTYAQKLGINLS 119

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEI D LVRSG VD+IVIDSVAALTPRAEIEGDMG+SLPG+QARLMS
Sbjct: 120 ELLISQPDTGEQALEICDALVRSGGVDLIVIDSVAALTPRAEIEGDMGDSLPGLQARLMS 179

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLT SI+R+  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR GSIK
Sbjct: 180 QALRKLTGSINRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIK 239

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
             D + GN+T+VKVVKNK+A PFK+  F+I+YGEG S  GE++DLG  A IV+KSGAW+S
Sbjct: 240 SGDEVIGNETKVKVVKNKIAPPFKEAHFEILYGEGTSREGEILDLGSDAKIVEKSGAWYS 299

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           + G+R+GQG++N++ +L+E  E+A  IE+ +R + G+
Sbjct: 300 YNGERIGQGKDNARNYLKERPELAREIENKVRASLGV 336


>gi|87122443|ref|ZP_01078323.1| RecA protein [Marinomonas sp. MED121]
 gi|86162236|gb|EAQ63521.1| RecA protein [Marinomonas sp. MED121]
          Length = 356

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/347 (65%), Positives = 281/347 (80%), Gaps = 2/347 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AALSQI+R +GKGAIM++G +    E I  VS+GSLGLDIALGIGG P GR +
Sbjct: 10  NKKKALDAALSQIERQFGKGAIMKMGDKPR--EAIPSVSTGSLGLDIALGIGGLPLGRCI 67

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTL L TIAQ+QK G TCAF+DAEHALD IYA KLGV+L  LL+SQPDTG
Sbjct: 68  ELYGPESSGKTTLTLSTIAQAQKQGYTCAFIDAEHALDPIYAEKLGVNLDELLLSQPDTG 127

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRS AV++IVIDSVAALTP++EIEG+MG+S  G+QARLMSQALRKLT + 
Sbjct: 128 EQALEICDMLVRSNAVNLIVIDSVAALTPKSEIEGNMGDSHVGLQARLMSQALRKLTGAA 187

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C++VFINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GS+K  D + GN+T
Sbjct: 188 KNANCMIVFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSVKQGDEVVGNET 247

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF+Q EF IMYG GI   GE+IDLGVK  +VDKSGAW+++KG ++GQG+
Sbjct: 248 RVKVVKNKVSPPFRQAEFQIMYGAGIYHMGEIIDLGVKQGLVDKSGAWYAYKGAKIGQGK 307

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
            N+  +L +NI+IA  IE+ +R+       +   E +  TK++  KD
Sbjct: 308 ANAAKYLEDNIDIANEIEAEIRKQLIQTTTNKEAEESKATKEEVQKD 354


>gi|83647897|ref|YP_436332.1| recombinase A [Hahella chejuensis KCTC 2396]
 gi|123739862|sp|Q2SBR7|RECA_HAHCH RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|83635940|gb|ABC31907.1| recA protein [Hahella chejuensis KCTC 2396]
          Length = 345

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 273/324 (84%), Gaps = 2/324 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AALSQI+R +GKGA+M++G Q    E I  VS+GSLGLDIALGIGG P GRIV
Sbjct: 4   NRKKALTAALSQIERQFGKGAVMRMGEQPR--EIIPSVSTGSLGLDIALGIGGLPYGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++Q+ G TCAFVDAEHALD IYA KLGV++  LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQRQGKTCAFVDAEHALDPIYAEKLGVNIDQLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD+I+IDSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT S+
Sbjct: 122 EQALEIADMLVRSGAVDVIIIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTGSV 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRRVGS+K+ + + GN+T
Sbjct: 182 KQANCLMIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGSVKEGEEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ +F IMYG GI   GE+IDLGVK   VDKSGAW+S+KG ++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQADFQIMYGRGIYRTGEIIDLGVKEGFVDKSGAWYSYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQN 334
            NS  +L E+ EIA  IE+ +R+ 
Sbjct: 302 ANSSRYLEEHPEIAVEIETAIREK 325


>gi|83721519|ref|YP_441199.1| recombinase A [Burkholderia thailandensis E264]
 gi|167621349|ref|ZP_02389980.1| recombinase A [Burkholderia thailandensis Bt4]
 gi|257140135|ref|ZP_05588397.1| recombinase A [Burkholderia thailandensis E264]
 gi|83655344|gb|ABC39407.1| recA protein [Burkholderia thailandensis E264]
          Length = 356

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 228/327 (69%), Positives = 284/327 (86%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM+LG  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMRLGD-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG++LPG+QARLMSQALRKLT SI
Sbjct: 132 EQALEIVDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDALPGLQARLMSQALRKLTGSI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +N++ FLREN EIA  IE+ +R++ G+
Sbjct: 312 DNAREFLRENPEIAREIENRIRESLGV 338


>gi|311105063|ref|YP_003977916.1| protein RecA [Achromobacter xylosoxidans A8]
 gi|310759752|gb|ADP15201.1| protein RecA [Achromobacter xylosoxidans A8]
          Length = 354

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 275/318 (86%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM+ G    +   I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 23  QIEKQFGKGSIMRYGDN-DVSHDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 81

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  +A+ QK GGTCAFVDAEHALD  YA KLGV+L +LLISQPDTGEQALEITD LV
Sbjct: 82  TLTLQVVAEMQKLGGTCAFVDAEHALDVQYASKLGVNLADLLISQPDTGEQALEITDALV 141

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT++I ++ C+++FIN
Sbjct: 142 RSGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKKTNCMVIFIN 201

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK+A 
Sbjct: 202 QIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKGDEVVGNETRVKVVKNKVAP 261

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PFKQ EFDIMYG GIS  GE+IDLGV A++VDKSGAW+S+ G R+GQG++N + +L+E+ 
Sbjct: 262 PFKQAEFDIMYGAGISREGEIIDLGVAANVVDKSGAWYSYNGNRIGQGKDNVREYLKEHK 321

Query: 322 EIAENIESLLRQNAGLVA 339
            +A  IE+ +R+N G+V+
Sbjct: 322 ALAIEIENRVRENQGIVS 339


>gi|30141696|emb|CAD82856.1| RecA protein [Burkholderia fungorum]
          Length = 348

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 10  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 68

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 69  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTG 128

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 129 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 188

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 189 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 248

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 249 RVKVVKNKVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 308

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 309 DNAREFLRENPDIAREIENRIRESLGVNA 337


>gi|150171058|emb|CAO01512.1| DNA recombination protein [Burkholderia arboris]
          Length = 336

 Score =  471 bits (1211), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/316 (70%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 14  KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73
           KAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIY
Sbjct: 1   KALAAALAQIEKQFGKGSIMRMGD-GDATENIQVVSTGSLGLDIALGVGGLPRGRVVEIY 59

Query: 74  GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133
           GPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQA
Sbjct: 60  GPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQA 119

Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193
           LEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+ LPG+QARLMSQALRKLT +I R+
Sbjct: 120 LEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDXLPGLQARLMSQALRKLTGTIKRT 179

Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253
            C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVK
Sbjct: 180 NCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVK 239

Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313
           VVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N+
Sbjct: 240 VVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNA 299

Query: 314 KIFLRENIEIAENIES 329
           + FLREN EIA  IE+
Sbjct: 300 REFLRENPEIAREIEN 315


>gi|157326981|gb|ABV44603.1| RecA [Burkholderia multivorans]
          Length = 321

 Score =  471 bits (1211), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 223/320 (69%), Positives = 279/320 (87%), Gaps = 1/320 (0%)

Query: 20  LSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSG 79
           L+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSG
Sbjct: 1   LAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSG 59

Query: 80  KTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDM 139
           KTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD 
Sbjct: 60  KTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDA 119

Query: 140 LVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVF 199
           LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++F
Sbjct: 120 LVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIF 179

Query: 200 INQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKM 259
           INQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK+
Sbjct: 180 INQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKV 239

Query: 260 ASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRE 319
           + PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLRE
Sbjct: 240 SPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRE 299

Query: 320 NIEIAENIESLLRQNAGLVA 339
           N EIA  IE+ +R++ G+ A
Sbjct: 300 NPEIAREIENRIRESLGVAA 319


>gi|292491237|ref|YP_003526676.1| recA protein [Nitrosococcus halophilus Nc4]
 gi|291579832|gb|ADE14289.1| recA protein [Nitrosococcus halophilus Nc4]
          Length = 342

 Score =  471 bits (1211), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/323 (68%), Positives = 281/323 (86%), Gaps = 1/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AALSQI++ +GKGA+M+LG   ++  G+EV+S+GSLGLDIALG+GG P+GR+V
Sbjct: 4   NRKKALGAALSQIEKQFGKGAVMRLGDANTV-RGVEVISTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPE+SGKTTLAL  +A++QK GGT AFVDAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 63  EIFGPEASGKTTLALQVVAEAQKVGGTAAFVDAEHALDPQYAEKLGVNVDDLLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++VIDSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEIADMLVRSGAVDVVVIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  ++VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRRVGS+K  + I GN+T
Sbjct: 183 KRSNTLVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGSLKKGEEIVGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVK+VKNK+A PFKQ+ FDI+YG G+S  GE+IDLGV+  +V K+GAW+S+ G R+GQGR
Sbjct: 243 RVKIVKNKVAPPFKQISFDILYGSGVSREGEIIDLGVQEGLVQKTGAWYSYNGDRIGQGR 302

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
           +N + FL+E+ E+A+ IE+ +R+
Sbjct: 303 DNVRQFLKEHQELAQGIEASIRE 325


>gi|116119178|gb|ABJ74759.1| RecA [Burkholderia sp. R460]
          Length = 347

 Score =  471 bits (1211), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVR G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRLGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+VA
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVVA 331


>gi|30524996|emb|CAD70707.1| RecA protein [Burkholderia fungorum]
          Length = 348

 Score =  471 bits (1211), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 10  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 68

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 69  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTG 128

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 129 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 188

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 189 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 248

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 249 RVKVVKNKVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 308

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 309 DNAREFLRENPDIAREIENRIRESLGVNA 337


>gi|148887239|emb|CAM12786.1| recombinase A [Ochrobactrum sp. PR 17]
          Length = 268

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 220/265 (83%), Positives = 248/265 (93%)

Query: 45  IEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE 104
           IE VS+GSL LDIALG+GG PKGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAE
Sbjct: 4   IETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAE 63

Query: 105 HALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIE 164
           HALD +YARKLGVDL+NLLISQPDTGEQALEITD LVRSGA+D++VIDSVAALTPRAEIE
Sbjct: 64  HALDPVYARKLGVDLENLLISQPDTGEQALEITDTLVRSGAIDVLVIDSVAALTPRAEIE 123

Query: 165 GDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALK 224
           G+MG+SLPG+QARLMSQALRKLT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALK
Sbjct: 124 GEMGDSLPGLQARLMSQALRKLTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALK 183

Query: 225 FYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELID 284
           FY+SVRLDIRR+GSIK++D + GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+D
Sbjct: 184 FYASVRLDIRRIGSIKERDEVVGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKMGELVD 243

Query: 285 LGVKASIVDKSGAWFSFKGQRLGQG 309
           LGVKA +V+KSGAWFS+  QRLGQG
Sbjct: 244 LGVKAGVVEKSGAWFSYNSQRLGQG 268


>gi|30141698|emb|CAD82857.1| RecA protein [Burkholderia fungorum]
          Length = 349

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 11  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 69

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 70  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTG 129

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 130 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 189

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 190 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 249

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 250 RVKVVKNKVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 309

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 310 DNAREFLRENPDIAREIENRIRESLGVNA 338


>gi|116119176|gb|ABJ74758.1| RecA [Burkholderia sp. R456]
          Length = 348

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ +
Sbjct: 303 DNAREFLRENPEIAREIENRIRESLGVAS 331


>gi|242133684|gb|ACS87953.1| RecA [Burkholderia cepacia]
          Length = 336

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ + KG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFDKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+V+
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVVS 330


>gi|88858311|ref|ZP_01132953.1| RecA protein (Recombinase A) [Pseudoalteromonas tunicata D2]
 gi|88819928|gb|EAR29741.1| RecA protein (Recombinase A) [Pseudoalteromonas tunicata D2]
          Length = 353

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/342 (66%), Positives = 281/342 (82%), Gaps = 9/342 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AALSQI+R +GKG+IM+LG   ++   IE +S+GSLG+DIALGIGG P GRIV
Sbjct: 4   NKEKALSAALSQIERQFGKGSIMKLGDSQAL--DIESISTGSLGIDIALGIGGLPAGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IA++QK G TCAF+DAEHALD +YA KLGV++K+LL+SQPDTG
Sbjct: 62  EIFGPESSGKTTLTLQVIAEAQKKGKTCAFIDAEHALDPVYAEKLGVNIKDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD+++IDSVAALTP+AEIEGDMG+   G+QARLMSQALRKLT +I
Sbjct: 122 EQALEICDMLVRSGAVDVVIIDSVAALTPKAEIEGDMGDHHVGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR+DIRR GS+K+ D + GN+T
Sbjct: 182 KRSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRIDIRRTGSVKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVK+VKNK+A PFKQ EF IMYGEGIS  GELIDLGV+   V+K+GAW+S++G ++GQG+
Sbjct: 242 RVKIVKNKVAPPFKQAEFIIMYGEGISKHGELIDLGVQHKFVEKAGAWYSYQGNKVGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKD 352
            NS  FL+EN  IA+ IE  LR       D LL +  I  +D
Sbjct: 302 SNSIKFLKENPAIADEIEKKLR-------DMLLLKATIKPED 336


>gi|30142194|emb|CAD83084.1| RecA protein [Burkholderia plantarii]
          Length = 335

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/324 (69%), Positives = 280/324 (86%), Gaps = 1/324 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI++ +GKG+IM+LG      E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIEKQFGKGSIMKLGD-AEAKEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARL SQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLWSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFRESIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEIAENIESLLRQNAGLVA 339
           FLREN +IA  IE+ +R++ G+VA
Sbjct: 300 FLRENPDIAREIENRIRESLGVVA 323


>gi|30141704|emb|CAD82858.2| RecA protein [Burkholderia fungorum]
          Length = 349

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 12  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 70

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 71  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTG 130

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 131 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 190

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 191 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 250

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 251 RVKVVKNKVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 310

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 311 DNAREFLRENPDIAREIENRIRESLGVNA 339


>gi|30525000|emb|CAD70709.1| RecA protein [Burkholderia fungorum]
          Length = 345

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 7   EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 65

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 66  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTG 125

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 126 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 185

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 186 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 245

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 246 RVKVVKNKVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 305

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 306 DNAREFLRENPDIAREIENRIRESLGVNA 334


>gi|146278408|ref|YP_001168567.1| recombinase A [Rhodobacter sphaeroides ATCC 17025]
 gi|166220671|sp|A4WV48|RECA_RHOS5 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|145556649|gb|ABP71262.1| recA protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 357

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/337 (70%), Positives = 287/337 (85%), Gaps = 4/337 (1%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           ++ R+EM   DK+KALE+AL+QI+R +GKG+IM+LG+   + E IE  S+GSLGLDIALG
Sbjct: 9   LNGRREM---DKAKALESALAQIERQFGKGSIMKLGANSPVME-IEATSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG PKGRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L 
Sbjct: 65  IGGLPKGRIIEIYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPAYAKKLGVNLD 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEI D LVRSGAV +IV+DSVAALTP++EIEGDMG+   G QARLMS
Sbjct: 125 ELLISQPDTGEQALEIVDTLVRSGAVSLIVVDSVAALTPKSEIEGDMGDMQMGSQARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT+SI RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR G IK
Sbjct: 185 QAMRKLTASIGRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGGIK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D++ GN T+VKVVKNK+A PF++VEFDIMYGEGIS  GEL+DLGVKA +V+KSG+W+S
Sbjct: 245 DRDNVIGNTTKVKVVKNKVAPPFREVEFDIMYGEGISKTGELVDLGVKAGVVEKSGSWYS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           +  +R+GQGREN+K FLR N  +A +IE  +R + GL
Sbjct: 305 YGDERIGQGRENAKAFLRANPSVAGDIEDKIRASHGL 341


>gi|296535683|ref|ZP_06897857.1| recombinase A [Roseomonas cervicalis ATCC 49957]
 gi|296263980|gb|EFH10431.1| recombinase A [Roseomonas cervicalis ATCC 49957]
          Length = 347

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%), Gaps = 7/354 (1%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KAL+AALSQI+R +GKG+IM++G++    E +EV+ +GSLGLD+ LGIGG P+GRI
Sbjct: 1   MDKNKALDAALSQIERAFGKGSIMRMGAKQQSDE-VEVIPTGSLGLDLGLGIGGLPRGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALH IA++QK GGTCAFVDAEHALD  YARKLGVD+ NLLISQPD 
Sbjct: 60  VEIYGPESSGKTTLALHAIAEAQKRGGTCAFVDAEHALDPGYARKLGVDVDNLLISQPDA 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAVD++V+DSVAAL PRAE+EG+MG+S  G+ ARLMSQALRKLT S
Sbjct: 120 GEQALEIADTLVRSGAVDVLVVDSVAALVPRAELEGEMGDSHVGLHARLMSQALRKLTGS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ++RS  +L+F+NQ+R+KIGVMFG+PETTTGGNALKFY+S+RL+IRRVG IKD++ + GNQ
Sbjct: 180 VARSNTLLIFLNQIRLKIGVMFGNPETTTGGNALKFYASIRLEIRRVGQIKDREEVVGNQ 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           TRVKVVKNKMA PF+QVEFDIMYGEG+S  GEL+DLGVKA +V+KSGAWFS   QR+GQG
Sbjct: 240 TRVKVVKNKMAPPFRQVEFDIMYGEGVSKVGELLDLGVKAGVVEKSGAWFSCDSQRIGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE 363
           REN+K FLR+N  +A++IE  +R  AGLVA +++  P      D++ DD    E
Sbjct: 300 RENAKQFLRDNPAMADSIEQRIRAQAGLVASAMMVGP------DSESDDAAAAE 347


>gi|323527264|ref|YP_004229417.1| recA protein [Burkholderia sp. CCGE1001]
 gi|323384266|gb|ADX56357.1| recA protein [Burkholderia sp. CCGE1001]
          Length = 358

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 287/329 (87%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 313 DNAREFLRENPDIAREIENRIRESLGVNA 341


>gi|157326949|gb|ABV44587.1| RecA [Burkholderia cenocepacia]
          Length = 319

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/319 (69%), Positives = 278/319 (87%), Gaps = 1/319 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           +QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGK
Sbjct: 1   AQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGK 59

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD L
Sbjct: 60  TTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDAL 119

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FI
Sbjct: 120 VRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFI 179

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++
Sbjct: 180 NQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVS 239

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN
Sbjct: 240 PPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLREN 299

Query: 321 IEIAENIESLLRQNAGLVA 339
            EIA  IE+ +R++ G+V+
Sbjct: 300 PEIAREIENRIRESLGVVS 318


>gi|153206757|ref|ZP_01945598.1| protein RecA [Coxiella burnetii 'MSU Goat Q177']
 gi|212218394|ref|YP_002305181.1| recombinase A [Coxiella burnetii CbuK_Q154]
 gi|120577120|gb|EAX33744.1| protein RecA [Coxiella burnetii 'MSU Goat Q177']
 gi|212012656|gb|ACJ20036.1| RecA [Coxiella burnetii CbuK_Q154]
          Length = 343

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/323 (70%), Positives = 281/323 (86%), Gaps = 1/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++S AL AALSQI+R +GKG++M+LG  G I + I+V+S+GSLGLDIALG+GG P+GRI+
Sbjct: 3   NRSNALNAALSQIERQFGKGSVMRLGDPGLIPD-IDVISTGSLGLDIALGVGGLPRGRII 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPE+SGKTTLAL TIA  Q+ GGT AFVDAEHALD+IYA KLGV +++LL+SQPDTG
Sbjct: 62  EIYGPEASGKTTLALQTIASCQRMGGTAAFVDAEHALDAIYAGKLGVKVEDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD+IVIDSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT++I
Sbjct: 122 EQALEITDMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTANI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            +S  +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G IK  + I G++T
Sbjct: 182 KKSNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGVIKKGEEILGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QVEFDI+YG GIS   ELIDLGVK  +V+K+GAW+S+ G+R+GQG+
Sbjct: 242 RVKVVKNKVAPPFRQVEFDILYGLGISRESELIDLGVKNELVEKAGAWYSYNGERIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
           EN + F  EN +IA  IE+ LR+
Sbjct: 302 ENVRQFFLENPKIAGEIETRLRE 324


>gi|157326927|gb|ABV44576.1| RecA [Burkholderia cenocepacia]
          Length = 328

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+VA
Sbjct: 300 EIAREIENRIRESLGVVA 317


>gi|187925268|ref|YP_001896910.1| recombinase A [Burkholderia phytofirmans PsJN]
 gi|187716462|gb|ACD17686.1| recA protein [Burkholderia phytofirmans PsJN]
          Length = 358

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 14  EKSKALAAALAQIEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVV 72

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGT AF+DAEHALD  YA KLGV++  LL+SQPDTG
Sbjct: 73  EIYGPESSGKTTLTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVNELLVSQPDTG 132

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 133 EQALEIADALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 192

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 193 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 252

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG+
Sbjct: 253 RVKVVKNKVAPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYSGERIGQGK 312

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 313 DNAREFLRENPDIAREIENRIRESLGVNA 341


>gi|221639883|ref|YP_002526145.1| recombinase A [Rhodobacter sphaeroides KD131]
 gi|221160664|gb|ACM01644.1| Protein recA [Rhodobacter sphaeroides KD131]
          Length = 367

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 289/337 (85%), Gaps = 4/337 (1%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           ++ R+EM   DK+KALE+AL+QI+R +GKG+IM+LG+   + E IE  S+GSLGLDIALG
Sbjct: 19  LNGRREM---DKAKALESALAQIERQFGKGSIMKLGANSPVME-IEATSTGSLGLDIALG 74

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG PKGRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L 
Sbjct: 75  IGGLPKGRIIEIYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLD 134

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEI D LVRSGAV++IV+DSVAALTP++EIEGDMG+   G QARLMS
Sbjct: 135 ELLISQPDTGEQALEIVDTLVRSGAVNLIVVDSVAALTPKSEIEGDMGDMQMGSQARLMS 194

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT+SI RS C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR G+IK
Sbjct: 195 QAMRKLTASIGRSNCMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIK 254

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D++ GN T+VKVVKNK+A PF++VEFDIMYGEGIS  GEL+DLGVKA +V+KSG+W+S
Sbjct: 255 DRDNVIGNTTKVKVVKNKVAPPFREVEFDIMYGEGISKTGELVDLGVKAGVVEKSGSWYS 314

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           +  +R+GQGREN+K FLR N  +A +IE  +R + GL
Sbjct: 315 YGDERIGQGRENAKAFLRANPTVAGDIEDRIRASHGL 351


>gi|120554998|ref|YP_959349.1| recombinase A [Marinobacter aquaeolei VT8]
 gi|166220655|sp|A1U2E3|RECA_MARAV RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|120324847|gb|ABM19162.1| recA protein [Marinobacter aquaeolei VT8]
 gi|302608138|emb|CBW44418.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Marinobacter hydrocarbonoclasticus]
          Length = 347

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 275/336 (81%), Gaps = 9/336 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AALSQI+R +GKGA+M++G Q    E I  VS+GSLGLD+ALGIGG P GRIV
Sbjct: 4   NRKKALGAALSQIERQFGKGAVMKMGDQPR--EAIPAVSTGSLGLDVALGIGGLPYGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAFVDAEHALD +YA KLGV++  LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKQGKTCAFVDAEHALDPVYAEKLGVNVDELLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRS AVD+I++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT ++
Sbjct: 122 EQALEIADMLVRSNAVDVIIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTGNV 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C++VFINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+GS+KD D + GN+T
Sbjct: 182 KHANCLMVFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGSVKDGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF+Q EF IMYG+GI    E++D+GVK   VDKSGAW+++ G ++GQG+
Sbjct: 242 RVKVVKNKVSPPFRQAEFQIMYGKGIYHMAEVLDMGVKEGFVDKSGAWYAYNGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
            N+  FL EN++IA  IE+ +R       D L+ +P
Sbjct: 302 ANACKFLEENLDIANEIEAKVR-------DKLMPKP 330


>gi|237749552|ref|ZP_04580032.1| recA [Oxalobacter formigenes OXCC13]
 gi|229380914|gb|EEO31005.1| recA [Oxalobacter formigenes OXCC13]
          Length = 353

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/337 (66%), Positives = 284/337 (84%), Gaps = 1/337 (0%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD  K  +  +K+KAL AAL+QI++ +GKG++M++ + G + E I  VS+GSLGLDIALG
Sbjct: 1   MDDNKNASNQEKNKALSAALAQIEKQFGKGSVMRM-APGVVVEEIPSVSTGSLGLDIALG 59

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           +GG P+GR++EIYGPESSGKTTL L  IA+ QK GGTCAF+DAEHALD  YA+KLGV L+
Sbjct: 60  VGGLPRGRVIEIYGPESSGKTTLTLQVIAEMQKLGGTCAFIDAEHALDVGYAQKLGVHLQ 119

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
           +LLISQPDTGEQALEITD LVRSG VD+IVIDSVAALTP+AEIEGDMG+SLPG+QARLMS
Sbjct: 120 DLLISQPDTGEQALEITDALVRSGGVDLIVIDSVAALTPKAEIEGDMGDSLPGLQARLMS 179

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLT SI+++   ++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR GSIK
Sbjct: 180 QALRKLTGSINKTNTSVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSIK 239

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
             D + G++TRVKVVKNK A PFK+  FDI+YGEG S  GE++DLG +A IVDK+GAW+S
Sbjct: 240 SGDEVIGSETRVKVVKNKTAPPFKEAYFDILYGEGTSREGEILDLGSEAKIVDKAGAWYS 299

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           + G+++GQG++N++ +LR N ++A  IE+ +R + G+
Sbjct: 300 YNGEKIGQGKDNARNYLRANPKLAREIENKVRASYGV 336


>gi|257454120|ref|ZP_05619393.1| protein RecA [Enhydrobacter aerosaccus SK60]
 gi|257448448|gb|EEV23418.1| protein RecA [Enhydrobacter aerosaccus SK60]
          Length = 351

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 273/322 (84%), Gaps = 1/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL AALSQI++ +GK  IM+LG + +    ++VVS+GSLGLDIALGIGG PKGRIV
Sbjct: 4   NKAKALTAALSQIEKQFGKNTIMRLGDESAKIN-VDVVSTGSLGLDIALGIGGLPKGRIV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ QK GGTCAF+DAEHALD IYA+KLGVD+  LL++QPD G
Sbjct: 63  EIYGPESSGKTTLTLQAIAQCQKQGGTCAFIDAEHALDPIYAKKLGVDVDALLVTQPDNG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD+IV+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 123 EQALEITDMLVRSGAVDMIVVDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNA 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C++VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++KD ++I G++T
Sbjct: 183 KRSNCMVVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKDGENIVGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKV+KNK+A PF+Q EFDIMYG G +  GE++DLGV    V KSGAW+S+   ++GQG+
Sbjct: 243 RVKVIKNKLAPPFRQAEFDIMYGTGTNHLGEVVDLGVDIDAVKKSGAWYSYNDSKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLR 332
            N+  FL EN +IA+ IE+ +R
Sbjct: 303 ANAIRFLEENPQIAQEIEAKVR 324


>gi|34484371|gb|AAP51732.1| RecA [Burkholderia sp. BC14]
          Length = 332

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ +
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVAS 330


>gi|157326959|gb|ABV44592.1| RecA [Burkholderia cenocepacia]
          Length = 319

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKHFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+V+
Sbjct: 300 EIAREIENRIRESLGVVS 317


>gi|77464021|ref|YP_353525.1| recombinase A [Rhodobacter sphaeroides 2.4.1]
 gi|126462866|ref|YP_001043980.1| recombinase A [Rhodobacter sphaeroides ATCC 17029]
 gi|166220670|sp|A3PLJ2|RECA_RHOS1 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|77388439|gb|ABA79624.1| Recombinase A, DNA recombination protein [Rhodobacter sphaeroides
           2.4.1]
 gi|126104530|gb|ABN77208.1| recA protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 357

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 289/337 (85%), Gaps = 4/337 (1%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           ++ R+EM   DK+KALE+AL+QI+R +GKG+IM+LG+   + E IE  S+GSLGLDIALG
Sbjct: 9   LNGRREM---DKAKALESALAQIERQFGKGSIMKLGANSPVME-IEATSTGSLGLDIALG 64

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           IGG PKGRI+EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L 
Sbjct: 65  IGGLPKGRIIEIYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLD 124

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
            LLISQPDTGEQALEI D LVRSGAV++IV+DSVAALTP++EIEGDMG+   G QARLMS
Sbjct: 125 ELLISQPDTGEQALEIVDTLVRSGAVNLIVVDSVAALTPKSEIEGDMGDMQMGSQARLMS 184

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QA+RKLT+SI RS C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR G+IK
Sbjct: 185 QAMRKLTASIGRSNCMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIK 244

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
           D+D++ GN T+VKVVKNK+A PF++VEFDIMYGEGIS  GEL+DLGVKA +V+KSG+W+S
Sbjct: 245 DRDNVIGNTTKVKVVKNKVAPPFREVEFDIMYGEGISKTGELVDLGVKAGVVEKSGSWYS 304

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           +  +R+GQGREN+K FLR N  +A +IE  +R + GL
Sbjct: 305 YGDERIGQGRENAKAFLRANPTVAGDIEDRIRASHGL 341


>gi|77164441|ref|YP_342966.1| DNA recombination protein, RecA [Nitrosococcus oceani ATCC 19707]
 gi|254433644|ref|ZP_05047152.1| protein RecA [Nitrosococcus oceani AFC27]
 gi|76882755|gb|ABA57436.1| RecA protein [Nitrosococcus oceani ATCC 19707]
 gi|207089977|gb|EDZ67248.1| protein RecA [Nitrosococcus oceani AFC27]
          Length = 342

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 279/324 (86%), Gaps = 1/324 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AALSQI++ +GKGA+M+LG   SI   +EV+S+GSLGLDIALG+GG P+GR+V
Sbjct: 4   NRKKALGAALSQIEKQFGKGAVMRLGD-ASIVREVEVISTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPE+SGKTTLAL   A++Q  GGT AFVDAEHALD  YA +LGV +++LL+SQPDTG
Sbjct: 63  EIFGPEASGKTTLALQVAAEAQALGGTAAFVDAEHALDPQYAERLGVSVEDLLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++VIDSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEIADMLVRSGAVDVVVIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRRVG++K  D I GN+T
Sbjct: 183 KRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGALKKGDEIVGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PFKQV FDI+YG G+S  GE+IDLGV+   ++K+GAW+S+ G+R+GQGR
Sbjct: 243 RVKVVKNKMAPPFKQVSFDILYGSGVSREGEIIDLGVREGFIEKAGAWYSYNGERIGQGR 302

Query: 311 ENSKIFLRENIEIAENIESLLRQN 334
           +N + FL+E+ E+A+ IE+ +R+ 
Sbjct: 303 DNVRQFLKEHRELAQGIEAHIREK 326


>gi|256822657|ref|YP_003146620.1| recA protein [Kangiella koreensis DSM 16069]
 gi|256796196|gb|ACV26852.1| recA protein [Kangiella koreensis DSM 16069]
          Length = 346

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/322 (71%), Positives = 270/322 (83%), Gaps = 1/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL+QI+R +GKG+IM+LG   S   GI  +S+GSLGLDIALGIGG PKGR+V
Sbjct: 4   NKKKALGAALTQIERQFGKGSIMRLGDN-SAARGIGTISTGSLGLDIALGIGGLPKGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLAL  IA  QK GGT AFVDAEHALD  YA KLGV+L +L++SQPDTG
Sbjct: 63  EIYGPESSGKTTLALQAIASCQKDGGTAAFVDAEHALDPTYAEKLGVNLDDLIVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVDI+V+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEITDMLVRSGAVDIVVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G IK  D I GN+T
Sbjct: 183 KRSNTLCVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQIKQGDEIVGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ EF I+YGEG S  GE++D GVK  +V+KSGAW+S+ G ++GQG+
Sbjct: 243 RVKVVKNKVAPPFKQAEFQILYGEGTSLEGEILDWGVKHDLVEKSGAWYSYNGNKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLR 332
           +N   FL++N +I E IE  LR
Sbjct: 303 QNVIQFLKDNADIKEEIEGKLR 324


>gi|167645357|ref|YP_001683020.1| recombinase A [Caulobacter sp. K31]
 gi|189039593|sp|B0SZN2|RECA_CAUSK RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|167347787|gb|ABZ70522.1| recA protein [Caulobacter sp. K31]
          Length = 356

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 234/333 (70%), Positives = 288/333 (86%), Gaps = 2/333 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK +ALEAAL+QI R +GKG++M+LG +G +   +E +S+GSLGLDIALGIGG PKGR++
Sbjct: 16  DKQRALEAALAQIDRAFGKGSVMKLGEKGKVE--MESISTGSLGLDIALGIGGLPKGRVI 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALH +A+ QK GGT AFVDAEHALD  YA KLGV+L NLL+SQPD G
Sbjct: 74  EIYGPESSGKTTLALHVVAECQKAGGTAAFVDAEHALDPGYAFKLGVNLDNLLVSQPDNG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAVDI+VIDSVAALTP+AEIEG+MG+SLPG+QARLMSQALRKLT+SI
Sbjct: 134 EQALEITDTLVRSGAVDIVVIDSVAALTPKAEIEGEMGDSLPGLQARLMSQALRKLTASI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +++  I++FINQ+R KIGVM+GSPETTTGGNALKFY+SVRLDIRR GSIK++D I GN  
Sbjct: 194 NKANTIVIFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSIKNRDEIVGNNV 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++VEFDIMYGEGIS  GE+IDLGVKA I+DK+G+WFS+  QR+GQGR
Sbjct: 254 RVKVVKNKVAPPFREVEFDIMYGEGISKLGEIIDLGVKAGIIDKAGSWFSYNSQRIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           +N + FL+ N ++A  IE+ +R+++  + + LL
Sbjct: 314 DNVREFLKVNKDLAAEIEAAVRKSSQKIEEELL 346


>gi|308212820|gb|ADO21638.1| RecA [Burkholderia sp. HT16]
 gi|308212822|gb|ADO21639.1| RecA [Burkholderia sp. HT21]
 gi|308212824|gb|ADO21640.1| RecA [Burkholderia sp. HT80]
 gi|308212826|gb|ADO21641.1| RecA [Burkholderia sp. HT81]
 gi|308212828|gb|ADO21642.1| RecA [Burkholderia sp. HT83]
          Length = 325

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/319 (69%), Positives = 278/319 (87%), Gaps = 1/319 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           +QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGK
Sbjct: 1   AQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGK 59

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD L
Sbjct: 60  TTLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDAL 119

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FI
Sbjct: 120 VRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFI 179

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++
Sbjct: 180 NQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVS 239

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN
Sbjct: 240 PPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLREN 299

Query: 321 IEIAENIESLLRQNAGLVA 339
            EIA  IE+ +R++ G+VA
Sbjct: 300 PEIAREIENRIRESLGVVA 318


>gi|308212802|gb|ADO21629.1| RecA [Burkholderia arboris]
 gi|308212804|gb|ADO21630.1| RecA [Burkholderia arboris]
 gi|308212806|gb|ADO21631.1| RecA [Burkholderia arboris]
          Length = 319

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+V+
Sbjct: 300 EIAREIENRIRESLGVVS 317


>gi|296803114|gb|ADH51633.1| DNA recombinase [Burkholderia stabilis]
          Length = 322

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/323 (69%), Positives = 279/323 (86%), Gaps = 1/323 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGN LKFY+SVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNELKFYASVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           VKNK++ PF++  FDI+YGEGIS  GE+IDL V+A IVDK+GAW+S+ G+++GQG++N++
Sbjct: 240 VKNKVSPPFREAIFDILYGEGISRQGEIIDLRVQAKIVDKAGAWYSYNGEKIGQGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGL 337
            FLREN EIA  IE+ +R++ G+
Sbjct: 300 EFLRENPEIAREIENRIRESLGV 322


>gi|70904874|gb|AAZ14016.1| RecA [Burkholderia cenocepacia]
          Length = 334

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/329 (69%), Positives = 285/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAKEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+ID GV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDFGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 302 DNAREFLRENPEIALEIENRIRESLGVAA 330


>gi|289208783|ref|YP_003460849.1| recA protein [Thioalkalivibrio sp. K90mix]
 gi|288944414|gb|ADC72113.1| recA protein [Thioalkalivibrio sp. K90mix]
          Length = 348

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 283/342 (82%), Gaps = 8/342 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AAL QI+R +GKGA+M++G Q ++   +  +S+GSL LDIALGIGG P+GR+V
Sbjct: 4   NRKKALTAALGQIERQFGKGAVMRMGDQQAV--DVPAISTGSLALDIALGIGGVPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A++QK GGT AFVDAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVVAEAQKLGGTAAFVDAEHALDPTYAEKLGVNVDDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 122 EQALEIADMLVRSGAVDVVIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVR+DIRR+G+IK  D + GN+T
Sbjct: 182 KRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRMDIRRIGAIKKGDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PF++  F+I+YGEGIS  GE+I++GVK  ++DK+GAW+S+ G+R+GQG+
Sbjct: 242 RVKVVKNKMAPPFREAYFEILYGEGISRVGEIIEMGVKEGLIDKAGAWYSYNGERIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ------NAGLVADSLLQEP 346
           EN++ +L++N +IAE +E  LR+      N   V D  +  P
Sbjct: 302 ENARQYLKDNPQIAEEVEKTLRERLLPKRNKAAVEDEPVDAP 343


>gi|157326983|gb|ABV44604.1| RecA [Burkholderia multivorans]
          Length = 319

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+ A
Sbjct: 300 EIAREIENRIRESLGVAA 317


>gi|308212790|gb|ADO21623.1| RecA [Burkholderia arboris]
 gi|308212818|gb|ADO21637.1| RecA [Burkholderia arboris]
          Length = 323

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARGFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+V+
Sbjct: 300 EIAREIENRIRESLGVVS 317


>gi|70904872|gb|AAZ14015.1| RecA [Burkholderia multivorans]
          Length = 318

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+ A
Sbjct: 300 EIAREIENRIRESLGVAA 317


>gi|70904909|gb|AAZ14032.1| RecA [Burkholderia vietnamiensis]
          Length = 316

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 277/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GDVKEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+VA
Sbjct: 300 IAREIENRIRESLGVVA 316


>gi|308212830|gb|ADO21643.1| RecA [Burkholderia sp. HT38]
 gi|308212832|gb|ADO21644.1| RecA [Burkholderia sp. HT58]
 gi|308212834|gb|ADO21645.1| RecA [Burkholderia sp. HT69]
          Length = 323

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+VA
Sbjct: 300 EIAREIENRIRESLGVVA 317


>gi|238028533|ref|YP_002912764.1| recombinase A [Burkholderia glumae BGR1]
 gi|237877727|gb|ACR30060.1| Recombinase A [Burkholderia glumae BGR1]
          Length = 360

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 285/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM+LG      E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMKLGD-AEAKEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 252 RVKVVKNKVSPPFRESIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPDIAREIENRIRESLGVAA 340


>gi|145629785|ref|ZP_01785580.1| recombinase A [Haemophilus influenzae 22.1-21]
 gi|145638484|ref|ZP_01794093.1| recombinase A [Haemophilus influenzae PittII]
 gi|144978024|gb|EDJ87808.1| recombinase A [Haemophilus influenzae 22.1-21]
 gi|145272079|gb|EDK11987.1| recombinase A [Haemophilus influenzae PittII]
 gi|309751787|gb|ADO81771.1| DNA recombination protein RecA [Haemophilus influenzae R2866]
          Length = 354

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/330 (68%), Positives = 279/330 (84%), Gaps = 4/330 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKG+IM+LG   ++   +E +S+GSLGLD+ALGIGG P GRIV
Sbjct: 6   EKQKALAAALGQIEKQFGKGSIMKLGDTKTL--DVESISTGSLGLDVALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G TCAF+DAEHALD IYA KLGVD+K L +SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELFVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGA+D+I++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C++VFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR GS+KD ++I GN+T
Sbjct: 184 KNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGENIIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PF+QV+F I+YGEGIS  GEL++LGVK  +V+KSGAW+S+ G+++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELLELGVKHKLVEKSGAWYSYNGEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
            NS  +L ENIE ++ +E+ LR  A LVA+
Sbjct: 304 ANSMKWLNENIEKSDELEAHLR--AELVAN 331


>gi|157326933|gb|ABV44579.1| RecA [Burkholderia multivorans]
          Length = 322

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 277/318 (87%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+ A
Sbjct: 300 EIAREIENRIRESLGVAA 317


>gi|254575570|gb|ACT68299.1| RecA [Burkholderia cepacia]
          Length = 347

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 285/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGE IS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGESISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ +
Sbjct: 302 DNAREFLRENPEIAREIENRIRESLGVAS 330


>gi|16272543|ref|NP_438757.1| recombinase A [Haemophilus influenzae Rd KW20]
 gi|68249193|ref|YP_248305.1| recombinase A [Haemophilus influenzae 86-028NP]
 gi|145631869|ref|ZP_01787626.1| recombinase A [Haemophilus influenzae R3021]
 gi|145633990|ref|ZP_01789708.1| recombinase A [Haemophilus influenzae 3655]
 gi|145635971|ref|ZP_01791655.1| recombinase A [Haemophilus influenzae PittAA]
 gi|145637982|ref|ZP_01793620.1| recombinase A [Haemophilus influenzae PittHH]
 gi|145640575|ref|ZP_01796159.1| recombinase A [Haemophilus influenzae R3021]
 gi|148826752|ref|YP_001291505.1| recombinase A [Haemophilus influenzae PittEE]
 gi|148827785|ref|YP_001292538.1| recombinase A [Haemophilus influenzae PittGG]
 gi|229845740|ref|ZP_04465860.1| recombinase A [Haemophilus influenzae 6P18H1]
 gi|229847527|ref|ZP_04467620.1| recombinase A [Haemophilus influenzae 7P49H1]
 gi|260581460|ref|ZP_05849272.1| recombination protein RecA [Haemophilus influenzae RdAW]
 gi|260583237|ref|ZP_05851014.1| recombinase A [Haemophilus influenzae NT127]
 gi|319775389|ref|YP_004137877.1| RecA [Haemophilus influenzae F3047]
 gi|319897800|ref|YP_004135997.1| reca [Haemophilus influenzae F3031]
 gi|329122586|ref|ZP_08251166.1| recombination protein A [Haemophilus aegyptius ATCC 11116]
 gi|1172885|sp|P43705|RECA_HAEIN RecName: Full=Protein RecA; AltName: Full=Recombinase 1; AltName:
           Full=Recombinase A
 gi|76363332|sp|Q4QMV2|RECA_HAEI8 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|166220648|sp|A5UEC1|RECA_HAEIE RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|166220649|sp|A5UH99|RECA_HAEIG RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|305382|gb|AAC36817.1| recombinase [Haemophilus influenzae]
 gi|1573588|gb|AAC22257.1| recA protein (recA) [Haemophilus influenzae Rd KW20]
 gi|68057392|gb|AAX87645.1| RecA [Haemophilus influenzae 86-028NP]
 gi|144982472|gb|EDJ90035.1| recombinase A [Haemophilus influenzae R3021]
 gi|144985136|gb|EDJ91991.1| recombinase A [Haemophilus influenzae 3655]
 gi|145266780|gb|EDK06800.1| recombinase A [Haemophilus influenzae PittAA]
 gi|145268827|gb|EDK08792.1| recombinase A [Haemophilus influenzae PittHH]
 gi|145275161|gb|EDK15023.1| recombinase A [Haemophilus influenzae 22.4-21]
 gi|148716912|gb|ABQ99122.1| recombinase A [Haemophilus influenzae PittEE]
 gi|148719027|gb|ABR00155.1| recombinase A [Haemophilus influenzae PittGG]
 gi|229809553|gb|EEP45282.1| recombinase A [Haemophilus influenzae 7P49H1]
 gi|229811334|gb|EEP47043.1| recombinase A [Haemophilus influenzae 6P18H1]
 gi|260091906|gb|EEW75857.1| recombination protein RecA [Haemophilus influenzae RdAW]
 gi|260093690|gb|EEW77601.1| recombinase A [Haemophilus influenzae NT127]
 gi|301169315|emb|CBW28914.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Haemophilus influenzae 10810]
 gi|309973891|gb|ADO97092.1| DNA recombination protein RecA [Haemophilus influenzae R2846]
 gi|317433306|emb|CBY81681.1| RecA [Haemophilus influenzae F3031]
 gi|317449980|emb|CBY86192.1| RecA [Haemophilus influenzae F3047]
 gi|327472689|gb|EGF18117.1| recombination protein A [Haemophilus aegyptius ATCC 11116]
          Length = 354

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/330 (68%), Positives = 279/330 (84%), Gaps = 4/330 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKG+IM+LG   ++   +E +S+GSLGLD+ALGIGG P GRIV
Sbjct: 6   EKQKALAAALGQIEKQFGKGSIMKLGDTKTL--DVESISTGSLGLDVALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G TCAF+DAEHALD IYA KLGVD+K L +SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELFVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGA+D+I++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C++VFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR GS+KD ++I GN+T
Sbjct: 184 KNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGENIIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PF+QV+F I+YGEGIS  GEL++LGVK  +V+KSGAW+S+ G+++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELLELGVKHKLVEKSGAWYSYNGEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
            NS  +L ENIE ++ +E+ LR  A LVA+
Sbjct: 304 ANSMKWLNENIEKSDELEARLR--AELVAN 331


>gi|270342004|gb|ACZ74644.1| RecA [Burkholderia cepacia]
          Length = 347

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 3   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 182 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLRE+ EIA  IE+ +R++ G+ +
Sbjct: 302 DNAREFLRESPEIAREIENRIRESLGVAS 330


>gi|295688601|ref|YP_003592294.1| recombination protein RecA [Caulobacter segnis ATCC 21756]
 gi|295430504|gb|ADG09676.1| recA protein [Caulobacter segnis ATCC 21756]
          Length = 356

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/333 (69%), Positives = 288/333 (86%), Gaps = 2/333 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK +ALEAAL+QI R +GKG++M+LG +G +   +E VS+GSLGLDIALGIGG PKGRI+
Sbjct: 16  DKQRALEAALAQIDRAFGKGSVMKLGEKGKVE--MESVSTGSLGLDIALGIGGLPKGRII 73

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTLALH +A+ QK GGT AFVDAEHALD  YA KLGV+L +LL+SQPD G
Sbjct: 74  EVYGPESSGKTTLALHVVAEVQKAGGTAAFVDAEHALDPSYAHKLGVNLDSLLVSQPDNG 133

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSGAVDI+VIDSVAALTP+AEIEG+MG+SLPG+QARLMSQALRKLT+SI
Sbjct: 134 EQALEITDTLVRSGAVDIVVIDSVAALTPKAEIEGEMGDSLPGLQARLMSQALRKLTASI 193

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +++  I++FINQ+R KIGVM+GSPETTTGGNALKFY+SVRLDIRR GS+K +D I GN  
Sbjct: 194 NKANTIVIFINQIRHKIGVMYGSPETTTGGNALKFYASVRLDIRRTGSVKVRDEIIGNNV 253

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF++VEFDIMYGEGIS  GE+IDLGVKA I++K+G+WFS+  QR+GQGR
Sbjct: 254 RVKVVKNKVAPPFREVEFDIMYGEGISKLGEVIDLGVKAGIIEKAGSWFSYGSQRIGQGR 313

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLL 343
           +N + FL+ N +IA +IE+ +R+++  + + LL
Sbjct: 314 DNVREFLKNNPDIASSIEAAVRKSSQKIEEELL 346


>gi|285809808|gb|ADC36197.1| RecA [Burkholderia sp. GB-01]
          Length = 320

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 276/318 (86%), Gaps = 1/318 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GEATEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAGLVA 339
           EIA  IE+ +R++ G+ A
Sbjct: 300 EIAREIENRIRESLGVAA 317


>gi|45825408|gb|AAS77553.1| RecA protein [Mesorhizobium sp. ICMP 14330]
          Length = 284

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/281 (79%), Positives = 258/281 (91%), Gaps = 1/281 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           VDKSKAL+AALSQI+R +GKG+IM+LG+   + E IE V +GSLGLDIALG+GG P+GRI
Sbjct: 3   VDKSKALDAALSQIERAFGKGSIMRLGANEQVVE-IETVPTGSLGLDIALGVGGLPRGRI 61

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           VEIYGPESSGKTTLALHT+A++QK GG CAFVDAEHALD +YARKLGVDL+NLLISQPDT
Sbjct: 62  VEIYGPESSGKTTLALHTVAEAQKKGGICAFVDAEHALDPVYARKLGVDLENLLISQPDT 121

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGA+D++V+DSVAALTPRAEIEG+MG+SLPG+QARLMSQALRKLT+S
Sbjct: 122 GEQALEICDTLVRSGAIDVLVVDSVAALTPRAEIEGEMGDSLPGLQARLMSQALRKLTAS 181

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           ISRS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD+D + GNQ
Sbjct: 182 ISRSNTMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDRDEVVGNQ 241

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKAS 290
           TRVKVVKNK+A PFK VEFDIMYGEG+S  GEL+DLGVK +
Sbjct: 242 TRVKVVKNKLAPPFKVVEFDIMYGEGVSKTGELVDLGVKPA 282


>gi|224551699|gb|ACN54249.1| RecA [Burkholderia sp. MDIII-T536]
          Length = 319

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+V+
Sbjct: 300 IAREIENRIRESLGVVS 316


>gi|262273677|ref|ZP_06051490.1| RecA protein [Grimontia hollisae CIP 101886]
 gi|262222092|gb|EEY73404.1| RecA protein [Grimontia hollisae CIP 101886]
          Length = 347

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/344 (65%), Positives = 281/344 (81%), Gaps = 11/344 (3%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKG+IM+LG   ++   IE VS+GSL LDIALG GG P GRIV
Sbjct: 4   NKQKALAAALGQIEKQFGKGSIMRLGDDRTM--DIETVSTGSLSLDIALGAGGLPYGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAF+DAEHALD IYARKL VD+ NLL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKQGKTCAFIDAEHALDPIYARKLNVDIDNLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D L RSGAVD+I+IDSVAALTP+AEIEG+MG+S  G+QAR++SQA+RKLT++I
Sbjct: 122 EQALEIADALTRSGAVDVIIIDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTANI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             S  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK+ D + GN T
Sbjct: 182 KNSNTLMIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKEGDEVVGNDT 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PFKQ EF I+YGEGI+ +GELIDLGVK  +V+K+GAW+S+ G+++GQG+
Sbjct: 242 RVKVVKNKIAAPFKQAEFQILYGEGINLYGELIDLGVKHKLVEKAGAWYSYNGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ--EPAINTKD 352
            N+  FL+EN EIA+ ++  LR       D LLQ  +P    KD
Sbjct: 302 ANACKFLKENPEIAKELDKTLR-------DMLLQNGQPQAENKD 338


>gi|71062458|gb|AAZ21461.1| recA protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 358

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/360 (61%), Positives = 289/360 (80%), Gaps = 16/360 (4%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           ++AA+SQI   +GKG++M+LG + ++   +E +S+GSL LD+ALGIGG PKGR++E+YGP
Sbjct: 1   MDAAMSQIIDNFGKGSVMKLGQRRAM--DVESISTGSLSLDVALGIGGLPKGRVIEVYGP 58

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTLAL  +A++QK GG CAF+DAEHALD IYA+KLGVD + LLISQPDTGEQALE
Sbjct: 59  ESSGKTTLALQVLAEAQKAGGICAFIDAEHALDPIYAKKLGVDTEELLISQPDTGEQALE 118

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           I D LV+SG++ +IVIDSVAALTPRAEIEG+MG+   G+Q+RLMSQALRKLT SIS +  
Sbjct: 119 IADTLVKSGSISVIVIDSVAALTPRAEIEGEMGDHHVGLQSRLMSQALRKLTGSISSTNT 178

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVR+DIRR+G+IK+ D I GN TRVKVV
Sbjct: 179 MMIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRMDIRRIGAIKNGDEIIGNSTRVKVV 238

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK+A PFK VEFD+MYG+GIS  GEL+DLG KA IV+K+GAW+++KG+++GQGREN+K 
Sbjct: 239 KNKVAPPFKVVEFDLMYGKGISKVGELVDLGSKADIVEKAGAWYAYKGEKIGQGRENAKT 298

Query: 316 FLRENIEIAENIESLLRQNAGLVADSL--------------LQEPAINTKDDADKDDTDN 361
           +L +N +IA  IE  +R+ AG++A  +              ++EP + TK++       N
Sbjct: 299 YLEQNPKIAAEIEMAIREKAGVIAKKIEGNPLDPEKAAKDQIEEPKLETKEEVTPPSKKN 358


>gi|224551713|gb|ACN54256.1| RecA [Burkholderia sp. MVP-C2-48]
          Length = 319

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+V+
Sbjct: 300 IAREIENRIRESLGVVS 316


>gi|251793617|ref|YP_003008347.1| recombinase A [Aggregatibacter aphrophilus NJ8700]
 gi|247535014|gb|ACS98260.1| protein RecA [Aggregatibacter aphrophilus NJ8700]
          Length = 353

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 283/353 (80%), Gaps = 9/353 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KALEAAL QI++ +GKGAIM+LG    +   IE +S+GS GLD+ALGIGG P GRIV
Sbjct: 6   EKQKALEAALGQIEKQFGKGAIMKLGDSQKL--DIEAISTGSFGLDLALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IA++QK G TCAF+DAEHALD IYA KLGVD+K LL+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAEAQKNGKTCAFIDAEHALDPIYASKLGVDVKELLVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD++++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLTS I
Sbjct: 124 EQALEICDALVRSGAVDVVIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTSQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IK+ D + GN+T
Sbjct: 184 KNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QV+F I+YGEGIS   ELIDLGVK  ++ K+GAW++++ +++GQG+
Sbjct: 244 RVKVVKNKVAPPFRQVDFQILYGEGISKESELIDLGVKHKLISKAGAWYAYQNEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE 363
            N+  +L++N E A+ IES LR       D LL  P      D+D +   N+E
Sbjct: 304 TNAMKWLKDNPEQAKIIESTLR-------DELLAHPESAITADSDNEAQGNIE 349


>gi|116119154|gb|ABJ74747.1| RecA [Burkholderia sp. M281]
          Length = 347

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 284/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G   E I+VVS+G LGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGPLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+ VIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMNVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N+  FLREN EIA  IE+ +R++ G+V+
Sbjct: 303 DNACEFLRENPEIAREIENRIRESLGVVS 331


>gi|262376180|ref|ZP_06069410.1| recA protein [Acinetobacter lwoffii SH145]
 gi|262308781|gb|EEY89914.1| recA protein [Acinetobacter lwoffii SH145]
          Length = 347

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/347 (63%), Positives = 282/347 (81%), Gaps = 9/347 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL AALSQI++ +GK  +M+LG   +  + +E VS+GSL LDIALGIGG PKGRIV
Sbjct: 4   NKNKALNAALSQIEKQFGKNTVMRLGD--NTVQAVEAVSTGSLTLDIALGIGGLPKGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IA+ QK GGTCAF+DAEHALD  YARKLGVD+ NLL+SQPD G
Sbjct: 62  EIYGPESSGKTTMTLQAIAECQKAGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPDHG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 122 EQALEIADMLVRSGAIDMIVVDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNA 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G +K+ D I G++T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNKMA PFK+  F I+YG+G++  GELIDL V+  IV K+GAW+S++G ++GQG+
Sbjct: 242 KVKVVKNKMAPPFKEALFQILYGKGVNHLGELIDLAVQQEIVQKAGAWYSYQGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKD 357
            N+  +L E+ E+A+ IE L+R       D LL +  +  +DD+ ++
Sbjct: 302 NNTIRYLEEHKEMAQTIEKLIR-------DQLLTKAVVVEEDDSKEE 341


>gi|417636|sp|P32725|RECA_RHOS4 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|288349|emb|CAA51258.1| recA [Rhodobacter sphaeroides]
          Length = 343

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 284/328 (86%), Gaps = 1/328 (0%)

Query: 10  VDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69
           +DK+KALE+AL+QI+R +GKG+IM+LG+   + E IE  S+GSLGLDIALGIGG PKGRI
Sbjct: 1   MDKAKALESALAQIERQFGKGSIMKLGANSPVME-IEATSTGSLGLDIALGIGGLPKGRI 59

Query: 70  VEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDT 129
           +EIYGPESSGKTTL LH +A+ QK GG CAFVDAEHALD  YA+KLGV+L  LLISQPDT
Sbjct: 60  IEIYGPESSGKTTLTLHVVAEEQKKGGVCAFVDAEHALDPQYAKKLGVNLDELLISQPDT 119

Query: 130 GEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSS 189
           GEQALEI D LVRSGAV++IV+DSVAALTP++EIEGDMG+   G QARLMSQA+RKLT+S
Sbjct: 120 GEQALEIVDTLVRSGAVNLIVVDSVAALTPKSEIEGDMGDMQMGSQARLMSQAMRKLTAS 179

Query: 190 ISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQ 249
           I RS C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR G+IKD+D++ GN 
Sbjct: 180 IGRSNCMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDRDNVIGNT 239

Query: 250 TRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQG 309
           T+VKVVKNK+A PF++VEFDIMYGEGIS  GEL+DLGVKA +V+KSG+W+S+  +R+GQG
Sbjct: 240 TKVKVVKNKVAPPFREVEFDIMYGEGISKTGELVDLGVKAGVVEKSGSWYSYGDERIGQG 299

Query: 310 RENSKIFLRENIEIAENIESLLRQNAGL 337
           REN+K FLR N  +A +IE  +R + GL
Sbjct: 300 RENAKAFLRANPTVAGDIEDRIRASHGL 327


>gi|311693939|gb|ADP96812.1| recombinase A [marine bacterium HP15]
          Length = 348

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 220/336 (65%), Positives = 274/336 (81%), Gaps = 9/336 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KAL AAL QI+R +GKGA+M++G Q    E I  VS+GSLGLD+ALGIGG P GRI 
Sbjct: 4   NRKKALSAALGQIERQFGKGAVMKMGDQPR--EAIPAVSTGSLGLDVALGIGGLPYGRIC 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAFVDAEHALD +YA KLGV++ +LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKAGKTCAFVDAEHALDPVYAEKLGVNVDDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRS AVD+I++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT ++
Sbjct: 122 EQALEIADMLVRSNAVDVIIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTGNV 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD D + GN+T
Sbjct: 182 KHANCLMIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKDGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ EF IMYG+GI    E++D+GVK   VDKSGAW+++ G ++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQAEFQIMYGKGIYHMAEVLDMGVKEGFVDKSGAWYAYNGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
            N+  FL EN++IA  IE+ +R       D L+ +P
Sbjct: 302 ANACKFLEENMDIANEIEAKVR-------DKLMPKP 330


>gi|308048572|ref|YP_003912138.1| recA protein [Ferrimonas balearica DSM 9799]
 gi|307630762|gb|ADN75064.1| recA protein [Ferrimonas balearica DSM 9799]
          Length = 346

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 273/318 (85%), Gaps = 2/318 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K +AL AAL QI++ +GKG+IM+LG   ++   IE VS+GSLGLDIALGIGG P GRIV
Sbjct: 4   NKKRALSAALGQIEKQFGKGSIMRLGDATTL--DIESVSTGSLGLDIALGIGGLPYGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAFVDAEHALD +YA KLGV+++ LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKQGKTCAFVDAEHALDPVYAAKLGVNVEELLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 122 EQALEICDMLVRSGAVDVVIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + VFINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G++KD D + GN+T
Sbjct: 182 KRSNTLCVFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAVKDGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ EF I+YGEG S  GELIDLGV+  +++KSGAW+S++G+++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQAEFQILYGEGTSKEGELIDLGVQQKLIEKSGAWYSYQGEKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIE 328
            NS  FL+EN+ IA  IE
Sbjct: 302 ANSIRFLKENVAIANEIE 319


>gi|159044192|ref|YP_001532986.1| recombinase A [Dinoroseobacter shibae DFL 12]
 gi|157911952|gb|ABV93385.1| bacterial DNA recombination [Dinoroseobacter shibae DFL 12]
          Length = 355

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 235/327 (71%), Positives = 279/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL++AL+QI+R +GKG+IM+LG+   + E IE  S+GS+GLDIALGIGG PKGRI+
Sbjct: 16  DKQKALDSALAQIERQFGKGSIMKLGADSPVAE-IEATSTGSIGLDIALGIGGIPKGRII 74

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YARKLGVDL  LLISQPDTG
Sbjct: 75  EIYGPESSGKTTLTLHCIAEEQKKGGVCAFVDAEHALDPQYARKLGVDLDELLISQPDTG 134

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEIT+ LVRSGAV ++V+DSVAALTP++E+EGDMG++  G QARLMSQA+RKLT +I
Sbjct: 135 EQALEITETLVRSGAVSMVVVDSVAALTPKSELEGDMGDAQVGAQARLMSQAMRKLTGAI 194

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS C ++FINQ+RMKIGVMFGSPETT+GGNALKFYSSVRLDIRR+GS+KD+D I GN T
Sbjct: 195 SRSNCTVIFINQIRMKIGVMFGSPETTSGGNALKFYSSVRLDIRRIGSVKDRDEIVGNTT 254

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNK+A PFKQVEFDI+YGEGIS  GELIDLGVKA +V KSG+WFS+  +R+GQGR
Sbjct: 255 KVKVVKNKVAPPFKQVEFDIIYGEGISKMGELIDLGVKAGVVQKSGSWFSYGDERIGQGR 314

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +LR+N   A  +E  +R   GL
Sbjct: 315 ENAKQYLRDNTRTALELEDKIRAAHGL 341


>gi|224551673|gb|ACN54236.1| RecA [Burkholderia sp. FC65]
 gi|224551707|gb|ACN54253.1| RecA [Burkholderia cenocepacia]
          Length = 318

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+V+
Sbjct: 300 IAREIENRIRESLGVVS 316


>gi|157326955|gb|ABV44590.1| RecA [Burkholderia cenocepacia]
          Length = 327

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 10  IEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 68

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 69  LTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVR 128

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 129 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 188

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 189 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 248

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 249 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 308

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+V+
Sbjct: 309 IAREIENRIRESLGVVS 325


>gi|237747401|ref|ZP_04577881.1| recA protein [Oxalobacter formigenes HOxBLS]
 gi|229378752|gb|EEO28843.1| recA protein [Oxalobacter formigenes HOxBLS]
          Length = 353

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/337 (66%), Positives = 283/337 (83%), Gaps = 1/337 (0%)

Query: 1   MDYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALG 60
           MD  K  +  +K+KAL  AL+QI++ +GKG++M++ + G + E I VVS+GSLGLDIALG
Sbjct: 1   MDDNKTASNPEKNKALAIALAQIEKQFGKGSVMRM-APGVVVEEIPVVSTGSLGLDIALG 59

Query: 61  IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLK 120
           +GG P+GR++EIYGPESSGKTTL L  IA+ QK GGTCAF+DAEHALD  YA+KLGV L+
Sbjct: 60  VGGLPRGRVIEIYGPESSGKTTLTLQVIAEMQKLGGTCAFIDAEHALDVGYAQKLGVHLQ 119

Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
           +LLISQPDTGEQALEITD LVRSGAVD+IVIDSVAALTP+AEIEGDMG+SLPG+QARLMS
Sbjct: 120 DLLISQPDTGEQALEITDALVRSGAVDLIVIDSVAALTPKAEIEGDMGDSLPGLQARLMS 179

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIK 240
           QALRKLT SI+++   ++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR GSIK
Sbjct: 180 QALRKLTGSINKTNTSVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSIK 239

Query: 241 DKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFS 300
             D + G++TRVKVVKNK A PFK+  FDI+YGEG S  GE++DLG  A IV+K+G+W+S
Sbjct: 240 SSDEVIGSETRVKVVKNKTAPPFKEAYFDILYGEGTSREGEILDLGADAKIVEKAGSWYS 299

Query: 301 FKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           + G+R+GQG++N++ +LR + ++A  IE+ +R   G+
Sbjct: 300 YNGERIGQGKDNARNYLRAHPKLAREIENKVRAAYGV 336


>gi|332140353|ref|YP_004426091.1| recombinase A [Alteromonas macleodii str. 'Deep ecotype']
 gi|238693255|sp|B4RVU1|RECA_ALTMD RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|327550375|gb|AEA97093.1| recombinase A [Alteromonas macleodii str. 'Deep ecotype']
          Length = 348

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/343 (66%), Positives = 282/343 (82%), Gaps = 3/343 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AA+ QI++ +GKGAIM+LG   ++   IE +S+GSL +DIALGIGG P GR+V
Sbjct: 4   NKSKALTAAVGQIEKQFGKGAIMRLGDNQAM--DIEAISTGSLTIDIALGIGGLPCGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAFVDAEHALD +YA KLGV++  LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKNGKTCAFVDAEHALDPVYAEKLGVNIDELLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT++I
Sbjct: 122 EQALEICDMLVRSGAVDVVIVDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTANI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  + +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G++K+ D + GN+T
Sbjct: 182 KRSNTLCIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAVKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ EF I YGEGIS   ELIDLGVK  +VDK+GAW+S+KG R+GQG+
Sbjct: 242 RVKVVKNKVAPPFKQAEFMIRYGEGISKEAELIDLGVKQKLVDKAGAWYSYKGDRIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
            N   +L+E+ E A  IE+ +RQ   L++ ++  E A+   +D
Sbjct: 302 ANVMKYLKEHPETANEIETKIRQEL-LLSKTVKAEEALPQGED 343


>gi|331007036|ref|ZP_08330270.1| RecA protein [gamma proteobacterium IMCC1989]
 gi|330419163|gb|EGG93595.1| RecA protein [gamma proteobacterium IMCC1989]
          Length = 377

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/323 (68%), Positives = 273/323 (84%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KALEAALSQI+R +GKG +M++G +  +   I  +S+GSLGLDIALGIGG PKGRI 
Sbjct: 33  NKDKALEAALSQIERQFGKGTVMRMGDKELV--KIPAISTGSLGLDIALGIGGLPKGRIA 90

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK GGTCAF+DAEHALD +YA KLGV++ +L+ISQPDTG
Sbjct: 91  EIYGPESSGKTTLTLQVIAEAQKQGGTCAFIDAEHALDPVYAEKLGVNVDDLIISQPDTG 150

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALE+ DMLVRSGAVD+IVIDSVAALTP+AEIEGDMG+   G+QARLMSQALRK+T +I
Sbjct: 151 EQALEVADMLVRSGAVDVIVIDSVAALTPKAEIEGDMGDHHVGLQARLMSQALRKITGNI 210

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+ +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G++K+ + I G++T
Sbjct: 211 KNANCLCIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAVKEGEDIVGSET 270

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ EF IMYG GI+  GE+ID GVK  ++DK+GAW+S+KG+++GQG+
Sbjct: 271 RVKVVKNKVAPPFKQTEFQIMYGRGINRLGEVIDYGVKLELIDKAGAWYSYKGEKIGQGK 330

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N   FL+E  EIAE +E  +R+
Sbjct: 331 NNVIKFLQERPEIAEEVELAIRR 353


>gi|239787354|emb|CAX83831.1| Protein RecA [uncultured bacterium]
          Length = 353

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 218/326 (66%), Positives = 276/326 (84%), Gaps = 1/326 (0%)

Query: 7   MNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPK 66
           M+  +K KAL+AAL+QI+R +GKG++M+LG + +    IE +S+GSLGLD+ALGIGG PK
Sbjct: 1   MSTAEKVKALDAALAQIERNFGKGSVMRLGQKDTSMN-IESISTGSLGLDLALGIGGLPK 59

Query: 67  GRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQ 126
           GRI+EI+GPESSGKTTL LH IA+ QK GG CAFVDAEHALD  YARKLGV  + L+ISQ
Sbjct: 60  GRIIEIFGPESSGKTTLTLHVIAECQKKGGICAFVDAEHALDPSYARKLGVKTEELIISQ 119

Query: 127 PDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKL 186
           PDTGEQALEI D LVRSGAVDIIVIDSVAAL P+AE+EGDMG+S  G+QARLMSQALRK+
Sbjct: 120 PDTGEQALEIADTLVRSGAVDIIVIDSVAALVPKAELEGDMGDSHMGLQARLMSQALRKI 179

Query: 187 TSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSIT 246
           T SIS++ C+++FINQ+R KIG++FG+PETTTGGNALKFY+SVRLDIRR+G++KDK+ I 
Sbjct: 180 TGSISKTNCMVIFINQIRQKIGIVFGNPETTTGGNALKFYASVRLDIRRIGAVKDKEEIV 239

Query: 247 GNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRL 306
           GNQTRVKVVKNKMA PF+ VEFD+ YG GIS  GE+ID+GV   +++KSG+W+S+K  ++
Sbjct: 240 GNQTRVKVVKNKMAPPFRTVEFDVSYGSGISKTGEIIDMGVNVGLIEKSGSWYSYKNNKI 299

Query: 307 GQGRENSKIFLRENIEIAENIESLLR 332
           GQGRE +K +L+E+ ++A  +E  +R
Sbjct: 300 GQGREVAKTYLKEHPDVARELEQQIR 325


>gi|296837413|gb|ADH59565.1| DNA recombinase [Burkholderia lata]
          Length = 317

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+VA
Sbjct: 300 AREIENRIRESLGVVA 315


>gi|296837381|gb|ADH59549.1| DNA recombinase [Burkholderia contaminans]
          Length = 318

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLV 338
           IA  IE+ +R++ G+V
Sbjct: 300 IAREIENRIRESLGVV 315


>gi|157326977|gb|ABV44601.1| RecA [Burkholderia multivorans]
          Length = 315

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 276/316 (87%), Gaps = 1/316 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           +QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGK
Sbjct: 1   AQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGK 59

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD L
Sbjct: 60  TTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDAL 119

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FI
Sbjct: 120 VRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFI 179

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++
Sbjct: 180 NQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVS 239

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN
Sbjct: 240 PPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLREN 299

Query: 321 IEIAENIESLLRQNAG 336
            EIA  IE+ +R++ G
Sbjct: 300 PEIAREIENRIRESLG 315


>gi|296837391|gb|ADH59554.1| DNA recombinase [Burkholderia arboris]
          Length = 319

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 2   IEKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 60

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 61  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 120

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 121 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 180

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 181 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 240

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 241 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 300

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+V+
Sbjct: 301 IAREIENRIRESLGVVS 317


>gi|157326919|gb|ABV44572.1| RecA [Burkholderia cenocepacia]
          Length = 319

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ GQ++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGQKIGQGKDNAREFLRENSEIARE 300

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 301 IENRIRESLGVVS 313


>gi|308212784|gb|ADO21620.1| RecA [Burkholderia arboris]
          Length = 318

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEQQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+V+
Sbjct: 300 IAREIENRIRESLGVVS 316


>gi|296837389|gb|ADH59553.1| DNA recombinase [Burkholderia contaminans]
          Length = 316

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLV 338
           IA  IE+ +R++ G+V
Sbjct: 300 IAREIENRIRESLGVV 315


>gi|157326975|gb|ABV44600.1| RecA [Burkholderia multivorans]
          Length = 314

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 275/315 (87%), Gaps = 1/315 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKT
Sbjct: 1   QIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKT 59

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LV
Sbjct: 60  TLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALV 119

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FIN
Sbjct: 120 RSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIN 179

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ 
Sbjct: 180 QIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSP 239

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN 
Sbjct: 240 PFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENP 299

Query: 322 EIAENIESLLRQNAG 336
           EIA  IE+ +R++ G
Sbjct: 300 EIAREIENRIRESLG 314


>gi|329896396|ref|ZP_08271495.1| RecA protein [gamma proteobacterium IMCC3088]
 gi|328921816|gb|EGG29187.1| RecA protein [gamma proteobacterium IMCC3088]
          Length = 345

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/342 (64%), Positives = 279/342 (81%), Gaps = 3/342 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KALEAAL+QI+R +GKG +M++G    +   I  +S+GSLGLDIALGIGG PKGRI 
Sbjct: 4   NKQKALEAALAQIERQFGKGTVMRMGDSERV--AIPSISTGSLGLDIALGIGGLPKGRIC 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK GGT AF+DAEHALD IYA +LGV + +L++SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKLGGTAAFIDAEHALDPIYAERLGVQVDDLILSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALE+T+MLVRSGAVD++V+DSVAALTP+AEIEGDMG+S  G+QARL+SQA+RKLT SI
Sbjct: 122 EQALEVTEMLVRSGAVDVLVVDSVAALTPKAEIEGDMGDSHVGLQARLLSQAMRKLTGSI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++K+ D I GN+T
Sbjct: 182 KQTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKEGDEIVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ EF IMYG GI   GELID GVK  ++DKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQAEFQIMYGSGIYHNGELIDWGVKLGLIDKSGAWYAYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKD 352
            N+  FL +N +IA+ IE+ +R    L      + P   T+D
Sbjct: 302 ANAAKFLSDNKDIADEIEAAIRAQT-LTTAKPAEAPVAETQD 342


>gi|330818200|ref|YP_004361905.1| Recombinase A [Burkholderia gladioli BSR3]
 gi|327370593|gb|AEA61949.1| Recombinase A [Burkholderia gladioli BSR3]
          Length = 359

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 284/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM+LG      E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKSKALAAALAQIEKQFGKGSIMKLGD-AEAKEDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G ++GQG+
Sbjct: 252 RVKVVKNKVSPPFRESIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGDKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN +IA  IE+ +R++ G+ A
Sbjct: 312 DNAREFLRENPDIALEIENRIRESLGVAA 340


>gi|296837393|gb|ADH59555.1| DNA recombinase [Burkholderia arboris]
          Length = 315

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLV 338
           IA  IE+ +R++ G+V
Sbjct: 300 IAREIENRIRESLGVV 315


>gi|70904886|gb|AAZ14021.1| RecA [Burkholderia cenocepacia]
          Length = 324

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+VA
Sbjct: 300 AREIENRIRESLGVVA 315


>gi|52426298|ref|YP_089435.1| recombinase A [Mannheimia succiniciproducens MBEL55E]
 gi|59798184|sp|Q65QB0|RECA_MANSM RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|52308350|gb|AAU38850.1| RecA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 351

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/348 (65%), Positives = 285/348 (81%), Gaps = 7/348 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL QI++ +GKGAIM+LG   ++   +E +S+GS+GLD+ALGIGG P GR+V
Sbjct: 6   EKSKALAAALGQIEKQFGKGAIMKLGDTQAL--DVESISTGSIGLDVALGIGGLPMGRVV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G  CAF+DAEHALD IYA KLGVD+K LL+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKVCAFIDAEHALDPIYAAKLGVDVKELLVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD+I++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAVDVIIVDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C++VFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRRVG++KD D I GN+T
Sbjct: 184 KNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRVGAVKDGDEIIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QV+F I+YGEGIS  GELI+LGVK  +VDKSGAW+++ G ++GQG+
Sbjct: 244 RVKVVKNKLAPPFRQVDFQILYGEGISKNGELIELGVKHKLVDKSGAWYAYNGDKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD---SLLQEPAINTKDDAD 355
            N+  +L EN  +A  +E+ +R  A L+A+   +LL +   N+++  D
Sbjct: 304 ANAMKWLAENPTVAAELENKIR--AELLANPEQALLADIETNSEEKED 349


>gi|224551705|gb|ACN54252.1| RecA [Burkholderia sp. MexII-219]
          Length = 319

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 274/316 (86%), Gaps = 1/316 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 5   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 63

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 64  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 123

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 124 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 183

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 184 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 243

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 244 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 303

Query: 327 IESLLRQNAGLVADSL 342
           IE+ +R++ G+VA  +
Sbjct: 304 IENRIRESLGVVASPM 319


>gi|70904896|gb|AAZ14026.1| RecA [Burkholderia cenocepacia]
          Length = 330

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 281/325 (86%), Gaps = 1/325 (0%)

Query: 15  ALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYG 74
           AL AAL+QI++ +G+G+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYG
Sbjct: 1   ALAAALAQIEKQFGEGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYG 59

Query: 75  PESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQAL 134
           PESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQAL
Sbjct: 60  PESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQAL 119

Query: 135 EITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK 194
           EITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ 
Sbjct: 120 EITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTN 179

Query: 195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKV 254
           C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKV
Sbjct: 180 CLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKV 239

Query: 255 VKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSK 314
           V+NK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++G G++N++
Sbjct: 240 VENKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGPGKDNAR 299

Query: 315 IFLRENIEIAENIESLLRQNAGLVA 339
             +RE+ EIA  IE+ +R++ G+V+
Sbjct: 300 DSVRESAEIAREIENRIRESLGVVS 324


>gi|70904866|gb|AAZ14012.1| RecA [Burkholderia multivorans]
          Length = 318

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+ A
Sbjct: 300 IAREIENRIRESLGVAA 316


>gi|296837403|gb|ADH59560.1| DNA recombinase [Burkholderia cenocepacia]
          Length = 317

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FI+Q
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFIHQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+VA
Sbjct: 300 IAREIENRIRESLGVVA 316


>gi|297539361|ref|YP_003675130.1| recombination protein RecA [Methylotenera sp. 301]
 gi|297258708|gb|ADI30553.1| recA protein [Methylotenera sp. 301]
          Length = 342

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/343 (65%), Positives = 289/343 (84%), Gaps = 4/343 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+QI++ +GKG+IM++G  G+I E I+ VS+GSLGLDIALGIGG P+GR++
Sbjct: 4   NKSKALSAALAQIEKQFGKGSIMRMGD-GNIGEDIQAVSTGSLGLDIALGIGGLPRGRVI 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ QK+GG  AF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLSVIAQMQKSGGVAAFIDAEHALDPQYAAKLGVNVPDLLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSG+VDI+VIDSVAALTPRAEIEG+MG+S  G+QARLMSQALRKLT +I
Sbjct: 123 EQALEIVDMLVRSGSVDIVVIDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKLTGNI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR G+IK  D + G++T
Sbjct: 183 KRTNTMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKKGDEVIGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKV+KNK+A PFKQ EFDI+YGEGIS  GE+I+LG    +V+K+G+W+S+ G+++GQG+
Sbjct: 243 RVKVIKNKVAPPFKQAEFDILYGEGISREGEIIELGANLKMVEKAGSWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           +N++ FLR N  IA  I++ +R N   +++++   PA+ +++D
Sbjct: 303 DNAREFLRSNPAIANEIDAKIRANMKSLSEAM---PAVRSEED 342


>gi|296112538|ref|YP_003626476.1| recombination protein RecA [Moraxella catarrhalis RH4]
 gi|295920232|gb|ADG60583.1| recombination protein RecA [Moraxella catarrhalis RH4]
 gi|326561307|gb|EGE11665.1| recombinase A [Moraxella catarrhalis 7169]
 gi|326562548|gb|EGE12863.1| recombinase A [Moraxella catarrhalis 46P47B1]
 gi|326566176|gb|EGE16330.1| recombinase A [Moraxella catarrhalis BC1]
 gi|326569092|gb|EGE19155.1| recombinase A [Moraxella catarrhalis BC8]
 gi|326571693|gb|EGE21708.1| recombinase A [Moraxella catarrhalis BC7]
 gi|326576322|gb|EGE26232.1| recombinase A [Moraxella catarrhalis CO72]
          Length = 349

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/345 (64%), Positives = 284/345 (82%), Gaps = 3/345 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AAL+QI++ +GK  IM LG + +  + ++VVS+GSLGLDIALGIGG PKGRI+
Sbjct: 4   NKEKALKAALAQIEKQFGKNTIMHLGDETAKLD-VDVVSTGSLGLDIALGIGGLPKGRII 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L TIA+ QK GGTCAF+DAEHALD IYA+KLGV++ +LL+SQPD G
Sbjct: 63  EIFGPESSGKTTLTLQTIAECQKQGGTCAFIDAEHALDPIYAKKLGVNIDDLLVSQPDNG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 123 EQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGNA 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD D I G++T
Sbjct: 183 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDGDEIIGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKV+KNKMA PF+Q EF IMYGEGI+  GE+IDLGV    V KSGAW+S+   ++GQG+
Sbjct: 243 RVKVIKNKMAPPFRQTEFQIMYGEGINRLGEVIDLGVDIGAVGKSGAWYSYGDGKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ--EPAINTKDD 353
            N+  +L+EN  IA  IE+ +R++       +++  EP  + +DD
Sbjct: 303 ANTVKYLQENPAIASEIEAKVRESKLATVTPIVESDEPEEHLEDD 347


>gi|224551687|gb|ACN54243.1| RecA [Burkholderia sp. MDII-104r]
          Length = 320

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 6   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 64

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG+V
Sbjct: 65  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSV 124

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 125 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 184

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 185 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 244

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 245 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 304

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 305 IENRIRESLGVVS 317


>gi|157326901|gb|ABV44563.1| RecA [Burkholderia cenocepacia]
          Length = 322

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+V+
Sbjct: 300 AREIENRIRESLGVVS 315


>gi|157326951|gb|ABV44588.1| RecA [Burkholderia cenocepacia]
          Length = 317

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+V+
Sbjct: 300 AREIENRIRESLGVVS 315


>gi|515814|emb|CAA37537.1| unnamed protein product [Bordetella pertussis]
          Length = 352

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/319 (69%), Positives = 275/319 (86%), Gaps = 2/319 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           SQI++ +GKG+IM+ G    +   I+VVS+GSLGLDIALG+GG P   ++E+YGPESSGK
Sbjct: 22  SQIEKQFGKGSIMRYGDN-EVEHDIQVVSTGSLGLDIALGVGGLPAA-VIEVYGPESSGK 79

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  IA+ QK GGTCAFVDAEHALD  YA KLGV+L +LLISQPDTGEQALEITD L
Sbjct: 80  TTLTLQVIAEMQKLGGTCAFVDAEHALDVQYASKLGVNLTDLLISQPDTGEQALEITDAL 139

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT++I R+ C+++FI
Sbjct: 140 VRSGSVDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFI 199

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G+IK  D + GN+TRVKVVKNK+A
Sbjct: 200 NQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKKGDEVVGNETRVKVVKNKVA 259

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PFKQ EFDIMYG GIS  GE+IDLGV+A++VDKSGAW+S+ G R+GQG++N + +L+E+
Sbjct: 260 PPFKQAEFDIMYGSGISREGEIIDLGVQANVVDKSGAWYSYSGNRIGQGKDNVREYLKEH 319

Query: 321 IEIAENIESLLRQNAGLVA 339
            E+A  IE+ +R+N G+V+
Sbjct: 320 KEMAIEIENKVRENQGIVS 338


>gi|157326925|gb|ABV44575.1| RecA [Burkholderia cenocepacia]
          Length = 322

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IV+K+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVEKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+V+
Sbjct: 300 IARQIENRIRESLGVVS 316


>gi|224551689|gb|ACN54244.1| RecA [Burkholderia sp. MDII-137p]
          Length = 319

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 4   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 62

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG+V
Sbjct: 63  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSV 122

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 123 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 182

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 183 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 242

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 243 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 302

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 303 IENRIRESLGVVS 315


>gi|70904919|gb|AAZ14037.1| RecA [Burkholderia ambifaria]
          Length = 314

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 273/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 301 IENRIRESLGVV 312


>gi|70904877|gb|AAZ14017.1| RecA [Burkholderia cenocepacia]
          Length = 335

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 284/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL+ I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 4   EKSKALAAALAHIEKQFGKGSIMRMGD-GEAKEDIQVVSTGSLGLDIALGVGGLPRGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+T
Sbjct: 183 KRTNCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IV K+GAW+S+ G+++GQG+
Sbjct: 243 RVKVVKNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVYKAGAWYSYNGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ FLREN EIA  IE+ +R++ G+ A
Sbjct: 303 DNAREFLRENPEIALEIENRIRESXGVAA 331


>gi|157326889|gb|ABV44557.1| RecA [Burkholderia cenocepacia]
 gi|157326891|gb|ABV44558.1| RecA [Burkholderia cenocepacia]
 gi|157326895|gb|ABV44560.1| RecA [Burkholderia cenocepacia]
 gi|157326911|gb|ABV44568.1| RecA [Burkholderia cenocepacia]
 gi|157326915|gb|ABV44570.1| RecA [Burkholderia cenocepacia]
          Length = 321

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+V+
Sbjct: 300 AREIENRIRESLGVVS 315


>gi|224551695|gb|ACN54247.1| RecA [Burkholderia cenocepacia]
          Length = 319

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 6   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 64

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 65  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 124

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 125 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 184

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 185 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 244

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 245 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 304

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 305 IENRIRESLGVVS 317


>gi|90020935|ref|YP_526762.1| recombinase A [Saccharophagus degradans 2-40]
 gi|123277374|sp|Q21L79|RECA_SACD2 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|89950535|gb|ABD80550.1| recA protein [Saccharophagus degradans 2-40]
          Length = 348

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 272/321 (84%), Gaps = 2/321 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           KSKALEAALSQI R +GKG +M+LG +G   E +  +S+GSLGLD+ALGIGG PKGRIVE
Sbjct: 5   KSKALEAALSQIDRQFGKGTVMRLGDKGR--EKMPAISTGSLGLDVALGIGGLPKGRIVE 62

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTL L  IA++Q+ GGTCAFVDAEHALD +YA KLGV++ +L+ISQPD GE
Sbjct: 63  IYGPESSGKTTLTLQVIAEAQRQGGTCAFVDAEHALDPVYAEKLGVNVDDLIISQPDNGE 122

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALE+ DMLVRSGAVD++V+DSVAALTP+AEIEGDMG+   G+QARLMSQALRK+T +I 
Sbjct: 123 QALEVADMLVRSGAVDVLVVDSVAALTPKAEIEGDMGDHHVGLQARLMSQALRKITGNIK 182

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
            + C+ +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GS+K+ D + G+ TR
Sbjct: 183 NANCLAIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSVKEGDEVVGSDTR 242

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNK+A PFKQ EF I+YG+GI+  GE++D GVK  ++DK+GAW+S+ G ++GQG+ 
Sbjct: 243 VKVVKNKVAPPFKQAEFQILYGQGINRLGEIVDFGVKLGLIDKAGAWYSYNGDKIGQGKA 302

Query: 312 NSKIFLRENIEIAENIESLLR 332
           N+  +LR+N E+AE +E  ++
Sbjct: 303 NAMQYLRDNKEVAEFLEQKIK 323


>gi|308212792|gb|ADO21624.1| RecA [Burkholderia arboris]
          Length = 317

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+V+
Sbjct: 300 AREIENRIRESLGVVS 315


>gi|224551711|gb|ACN54255.1| RecA [Burkholderia sp. MVC2-55]
          Length = 317

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 4   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 62

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 63  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 122

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 123 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 182

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 183 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 242

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 243 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 302

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 303 IENRIRESLGVVS 315


>gi|157326905|gb|ABV44565.1| RecA [Burkholderia cenocepacia]
          Length = 320

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/316 (69%), Positives = 275/316 (87%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+V+
Sbjct: 300 AREIENRIRESLGVVS 315


>gi|224551693|gb|ACN54246.1| RecA [Burkholderia cenocepacia]
          Length = 319

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 6   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 64

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 65  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 124

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 125 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 184

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 185 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 244

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 245 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 304

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 305 IENRIRESLGVVS 317


>gi|224551703|gb|ACN54251.1| RecA [Burkholderia cenocepacia]
          Length = 319

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 6   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 64

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 65  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 124

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 125 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 184

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 185 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 244

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 245 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 304

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 305 IENRIRESLGVVS 317


>gi|224551691|gb|ACN54245.1| RecA [Burkholderia sp. MDIII-B238]
          Length = 318

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 4   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 62

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 63  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 122

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 123 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 182

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 183 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 242

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 243 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 302

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 303 IENRIRESLGVVS 315


>gi|224551683|gb|ACN54241.1| RecA [Burkholderia cenocepacia]
 gi|224551685|gb|ACN54242.1| RecA [Burkholderia cenocepacia]
 gi|224551709|gb|ACN54254.1| RecA [Burkholderia cenocepacia]
          Length = 318

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 5   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 63

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 64  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 123

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 124 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 183

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 184 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 243

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 244 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 303

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 304 IENRIRESLGVVS 316


>gi|224551675|gb|ACN54237.1| RecA [Burkholderia cenocepacia]
          Length = 321

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 6   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 64

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 65  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 124

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 125 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 184

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 185 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 244

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 245 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 304

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 305 IENRIRESLGVVS 317


>gi|255318935|ref|ZP_05360160.1| protein RecA [Acinetobacter radioresistens SK82]
 gi|262378327|ref|ZP_06071484.1| recA protein [Acinetobacter radioresistens SH164]
 gi|255303952|gb|EET83144.1| protein RecA [Acinetobacter radioresistens SK82]
 gi|262299612|gb|EEY87524.1| recA protein [Acinetobacter radioresistens SH164]
          Length = 348

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/342 (65%), Positives = 275/342 (80%), Gaps = 8/342 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AALSQI++ +GK  +M+LG   +  + +E VS+GSL LDIALGIGG PKGRIV
Sbjct: 4   NKSKALNAALSQIEKQFGKNTVMRLGD--NTVQAVEAVSTGSLTLDIALGIGGLPKGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IAQ QK GGTCAF+DAEHALD  YARKLGVD+ NLL+SQPD G
Sbjct: 62  EIYGPESSGKTTMTLQAIAQCQKAGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPDNG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 122 EQALEIADMLVRSGAIDLIVVDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNA 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G +K+ D I G++T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIIGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNKMA PFK+  F I+YG+G++  GELIDL V+  I+ K+GAW+S++G ++GQG+
Sbjct: 242 KVKVVKNKMAPPFKEALFQILYGKGVNHLGELIDLAVQQEIIQKAGAWYSYQGNKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ------NAGLVADSLLQEP 346
            N    L EN E+A  +E L+R+      NA L  D   + P
Sbjct: 302 NNVIRHLEENPELAVEVERLIRELLLTTNNAPLAEDEAEEVP 343


>gi|157326887|gb|ABV44556.1| RecA [Burkholderia cenocepacia]
          Length = 314

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+VA
Sbjct: 302 IENRIRESLGVVA 314


>gi|224551667|gb|ACN54233.1| RecA [Burkholderia arboris]
          Length = 318

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 5   FGKGSIMRMGD-GDATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 63

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 64  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 123

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 124 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 183

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 184 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 243

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 244 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 303

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 304 IENRIRESLGVVS 316


>gi|224551697|gb|ACN54248.1| RecA [Burkholderia cenocepacia]
          Length = 317

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 5   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 63

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 64  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 123

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 124 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 183

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 184 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 243

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 244 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 303

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 304 IENRIRESLGVVS 316


>gi|157326897|gb|ABV44561.1| RecA [Burkholderia cenocepacia]
          Length = 319

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 300 IENRIRESLGVVS 312


>gi|157326913|gb|ABV44569.1| RecA [Burkholderia cenocepacia]
          Length = 314

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/315 (69%), Positives = 274/315 (86%), Gaps = 1/315 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLV 338
           A  IE+ +R++ G+V
Sbjct: 300 AREIENRIRESLGVV 314


>gi|157326953|gb|ABV44589.1| RecA [Burkholderia cenocepacia]
          Length = 316

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 302 IENRIRESLGVVS 314


>gi|162769939|emb|CAP58285.1| DNA recombinase [Burkholderia contaminans]
          Length = 324

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 301 IENRIRESLGVV 312


>gi|330720883|gb|EGG99071.1| RecA protein [gamma proteobacterium IMCC2047]
          Length = 343

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/330 (67%), Positives = 275/330 (83%), Gaps = 4/330 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K +AL+ ALSQI + +GKG++M++G Q      +  +S+GSLGLDIALGIGG PKGRI+
Sbjct: 4   NKQRALDMALSQIDKQFGKGSVMRMGDQER--PNVPAISTGSLGLDIALGIGGLPKGRII 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK GGT AF+DAEHALD  YA+K+GVD+ NLL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQAIAEAQKAGGTAAFIDAEHALDPDYAQKIGVDVDNLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVDI+VIDSVAALTP+AEIEGDMG+S  G+QARLMSQALRK+T ++
Sbjct: 122 EQALEIADALVRSGAVDILVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKMTGNV 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IK+ D + GN+T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PFKQ EF IMYG+GI   GELIDLGVK  +V K+GAW+S++G ++GQG+
Sbjct: 242 RVKVVKNKMAPPFKQTEFQIMYGKGIFRMGELIDLGVKQGLVGKAGAWYSYQGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
            N+  FL +N  +AE IE  +R  A L+ D
Sbjct: 302 ANAAQFLNDNPTVAEEIEGQIR--AALLGD 329


>gi|296802982|gb|ADH51567.1| DNA recombinase [Burkholderia contaminans]
          Length = 316

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 5   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 63

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 64  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 123

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 124 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 183

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 184 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 243

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 244 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 303

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 304 IENRIRESLGVV 315


>gi|301165521|emb|CBW25092.1| recombinase A [Bacteriovorax marinus SJ]
          Length = 374

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/353 (63%), Positives = 288/353 (81%), Gaps = 4/353 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL+ AL+ I++ +GKGAIM+L S+  + E +  +S+G LGLD+ALG+GG P+GRI+
Sbjct: 13  NKTKALDLALATIEKQFGKGAIMKLDSEKKL-EKVPAISTGCLGLDLALGVGGIPQGRII 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           E+YGPESSGKTTL LH  A+ QK GGT AF+DAEHALD+ YA KLGVD+ N LISQPD+G
Sbjct: 72  EVYGPESSGKTTLTLHAAAECQKAGGTVAFIDAEHALDTYYAEKLGVDVPNTLISQPDSG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++++DSVAALTPRAE+EGDMG+S  G+QARLMSQALRKLT SI
Sbjct: 132 EQALEIADMLVRSGAVDLLIVDSVAALTPRAELEGDMGDSHMGLQARLMSQALRKLTGSI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRS   ++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVR+DIRR+G+IK+ D + G++T
Sbjct: 192 SRSNTTVIFINQLRMKIGVMFGNPETTTGGNALKFYASVRVDIRRIGAIKNGDEVVGSRT 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVK+VKNK+A PFKQ+EFDIMYGEGIS  G+++DL V+  +V+K+GAWFS+   ++GQGR
Sbjct: 252 RVKIVKNKVAPPFKQIEFDIMYGEGISKTGDVLDLAVEHGVVEKAGAWFSYNNAKIGQGR 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDDTDNVE 363
           ENSK FL EN +I E I + +    GL+    L+E A++ +     ++T  VE
Sbjct: 312 ENSKNFLSENKDIFEEIRNKVLAKNGLIT---LEEEAVDKETGEIIEETAPVE 361


>gi|170664176|gb|ACB28507.1| RecA [Burkholderia pyrrocinia]
          Length = 310

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/311 (70%), Positives = 272/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QKTGGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG+V
Sbjct: 60  VIAELQKTGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSV 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|70904882|gb|AAZ14019.1| RecA [Burkholderia cenocepacia]
          Length = 309

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/308 (71%), Positives = 270/308 (87%), Gaps = 1/308 (0%)

Query: 16  LEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGP 75
           L AAL+QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGP
Sbjct: 1   LAAALAQIEKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGP 59

Query: 76  ESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALE 135
           ESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALE
Sbjct: 60  ESSGKTTLTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALE 119

Query: 136 ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKC 195
           ITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C
Sbjct: 120 ITDALVRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNC 179

Query: 196 ILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVV 255
           +++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVV
Sbjct: 180 LVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVV 239

Query: 256 KNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKI 315
           KNK++ PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ 
Sbjct: 240 KNKVSPPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARE 299

Query: 316 FLRENIEI 323
           FLREN EI
Sbjct: 300 FLRENPEI 307


>gi|57340309|gb|AAW50125.1| RecA [Burkholderia ubonensis]
          Length = 319

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/316 (69%), Positives = 274/316 (86%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEATEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+ A
Sbjct: 300 AREIENRIRESLGVAA 315


>gi|70904851|gb|AAZ14005.1| RecA [Burkholderia cepacia]
 gi|296837399|gb|ADH59558.1| DNA recombinase [Burkholderia contaminans]
          Length = 316

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 302 IENRIRESLGVV 313


>gi|296803010|gb|ADH51581.1| DNA recombinase [Burkholderia contaminans]
          Length = 315

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 302 IENRIRESLGVV 313


>gi|110834662|ref|YP_693521.1| recA protein [Alcanivorax borkumensis SK2]
 gi|110647773|emb|CAL17249.1| recA protein [Alcanivorax borkumensis SK2]
          Length = 344

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/322 (67%), Positives = 277/322 (86%), Gaps = 2/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKAL AALSQI+R +GKG++M++G +    E +  +S+GSLGLD+ALGIGG PKGRIV
Sbjct: 3   DKSKALSAALSQIERQFGKGSVMRMGDRKR--ERMPSISTGSLGLDVALGIGGLPKGRIV 60

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ+QK G TCAFVDAEHALD  YA KLGV++ +L++SQPDTG
Sbjct: 61  EIYGPESSGKTTLTLSVIAQAQKKGATCAFVDAEHALDPDYAEKLGVNVDDLIVSQPDTG 120

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD++++DSVAAL P+AEIEG+MG++  G+QARLMSQALRK+T ++
Sbjct: 121 EQALEITDMLVRSGAVDVVIVDSVAALVPKAEIEGEMGDTHVGLQARLMSQALRKITGNV 180

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             +  ++VFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G++K  D +TGN+T
Sbjct: 181 KNANTLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAVKQGDEVTGNET 240

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF+Q EF I+YG+GI+  GE++DLGV+  +VDKSGAW+++KG ++GQG+
Sbjct: 241 RVKVVKNKVSPPFRQAEFQILYGQGINQLGEVLDLGVQQGLVDKSGAWYAYKGDKIGQGK 300

Query: 311 ENSKIFLRENIEIAENIESLLR 332
           +N+  +LREN  IAE IE+ +R
Sbjct: 301 QNACEYLRENPAIAEEIETEIR 322


>gi|296837373|gb|ADH59545.1| DNA recombinase [Burkholderia contaminans]
 gi|296837385|gb|ADH59551.1| DNA recombinase [Burkholderia contaminans]
          Length = 316

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 302 IENRIRESLGVV 313


>gi|296803012|gb|ADH51582.1| DNA recombinase [Burkholderia multivorans]
          Length = 314

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+ A
Sbjct: 301 IENRIRESLGVAA 313


>gi|296803052|gb|ADH51602.1| DNA recombinase [Burkholderia contaminans]
          Length = 313

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 302 IENRIRESLGVV 313


>gi|114775363|ref|ZP_01450931.1| recombinase A [Mariprofundus ferrooxydans PV-1]
 gi|114553474|gb|EAU55855.1| recombinase A [Mariprofundus ferrooxydans PV-1]
          Length = 336

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/330 (65%), Positives = 275/330 (83%), Gaps = 2/330 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DKSKAL+ ALSQI+R +GKG +M+LG    +   + VV SGSL LD ALG+GG+P+GR++
Sbjct: 3   DKSKALDTALSQIERQFGKGTVMRLGDHAKV--PVSVVPSGSLALDAALGVGGYPRGRVI 60

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ALH IA++QK GG  AFVDAEHALD  YA +LGVD+ NLL+SQPD+G
Sbjct: 61  EIYGPESSGKTTMALHAIAEAQKLGGQAAFVDAEHALDPSYAERLGVDVDNLLVSQPDSG 120

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DML RSG VDIIV+DSVAALTP+AE+EGDMG+S  G+QARLMSQALRKLT SI
Sbjct: 121 EQALEIVDMLTRSGGVDIIVVDSVAALTPKAELEGDMGDSHMGLQARLMSQALRKLTGSI 180

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           +RS  I++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLD+RR+G+IK  D + GN T
Sbjct: 181 ARSNTIIIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDVRRIGAIKKGDEVMGNDT 240

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ +F IMYGEG+S  GE++D+GV+  +V+KSGAW++   +R+GQGR
Sbjct: 241 RVKVVKNKVAPPFKQAQFSIMYGEGVSHAGEVLDMGVQYGLVNKSGAWYACGNERIGQGR 300

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVAD 340
           +N+  +L+E+ E+   IE+ +R+  GL+ +
Sbjct: 301 DNAMTYLKEHPEMLAEIETGVREALGLIKN 330


>gi|30524998|emb|CAD70708.1| RecA protein [Burkholderia fungorum]
          Length = 333

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 218/317 (68%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG++M+LG+ G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 10  IEKQFGKGSVMRLGA-GEAVEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 68

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  +A+ QK GGT AF+DAEHALD  YA KLGV++ +LL+SQPDTGEQALEI D LVR
Sbjct: 69  LTLQVVAEMQKLGGTAAFIDAEHALDIQYAGKLGVNVSDLLVSQPDTGEQALEIADALVR 128

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 129 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 188

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK+A P
Sbjct: 189 IRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVAPP 248

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+R+GQG++N++ FLREN +
Sbjct: 249 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGERIGQGKDNAREFLRENPD 308

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+ A
Sbjct: 309 IAREIENRIRESLGVNA 325


>gi|71361898|gb|AAZ30056.1| recombinant protein A [Moraxella catarrhalis O35E]
          Length = 349

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/345 (64%), Positives = 283/345 (82%), Gaps = 3/345 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AAL+QI++ +GK  IM LG + +  + ++VVS+GSLGLDIALGIGG PKGRI+
Sbjct: 4   NKEKALKAALAQIEKQFGKNTIMHLGDETAKLD-VDVVSTGSLGLDIALGIGGLPKGRII 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L TIA+ QK GGTCAF+DAEHALD IYA+KLGV++ +LL+SQPD G
Sbjct: 63  EIFGPESSGKTTLTLQTIAECQKQGGTCAFIDAEHALDPIYAKKLGVNIDDLLVSQPDNG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 123 EQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGNA 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD D I G++T
Sbjct: 183 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDGDEIIGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKV+KNKMA PF+Q EF IMYGEGI+  GE+IDLGV    V KSGAW+S+   ++GQG+
Sbjct: 243 RVKVIKNKMAPPFRQTEFQIMYGEGINRLGEVIDLGVDIGAVGKSGAWYSYGDGKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQ--EPAINTKDD 353
            N+  +L+EN  IA  IE+ +R+        +++  EP  + +DD
Sbjct: 303 ANTVKYLQENPAIASEIEAKVREIKLATVTPIVESDEPEEHLEDD 347


>gi|70904868|gb|AAZ14013.1| RecA [Burkholderia multivorans]
          Length = 317

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 5   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 63

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVRSG++
Sbjct: 64  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVRSGSI 123

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 124 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 183

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 184 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 243

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 244 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 303

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+ A
Sbjct: 304 IENRIRESLGVAA 316


>gi|296802998|gb|ADH51575.1| DNA recombinase [Burkholderia contaminans]
          Length = 313

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 300 IENRIRESLGVV 311


>gi|326562574|gb|EGE12887.1| recombinase A [Moraxella catarrhalis 103P14B1]
 gi|326564101|gb|EGE14341.1| recombinase A [Moraxella catarrhalis 12P80B1]
 gi|326573518|gb|EGE23481.1| recombinase A [Moraxella catarrhalis 101P30B1]
 gi|326577768|gb|EGE27641.1| recombinase A [Moraxella catarrhalis O35E]
          Length = 349

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/323 (68%), Positives = 274/323 (84%), Gaps = 1/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AAL+QI++ +GK  IM LG + +  + ++VVS+GSLGLDIALGIGG PKGRI+
Sbjct: 4   NKEKALKAALAQIEKQFGKNTIMHLGDETAKLD-VDVVSTGSLGLDIALGIGGLPKGRII 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L TIA+ QK GGTCAF+DAEHALD IYA+KLGV++ +LL+SQPD G
Sbjct: 63  EIFGPESSGKTTLTLQTIAECQKQGGTCAFIDAEHALDPIYAKKLGVNIDDLLVSQPDNG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 123 EQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGNA 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GS+KD D I G++T
Sbjct: 183 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSVKDGDEIIGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKV+KNKMA PF+Q EF IMYGEGI+  GE+IDLGV    V KSGAW+S+   ++GQG+
Sbjct: 243 RVKVIKNKMAPPFRQTEFQIMYGEGINRLGEVIDLGVDIGAVGKSGAWYSYGDGKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N+  +L+EN  IA  IE+ +R+
Sbjct: 303 ANTVKYLQENPAIASEIEAKVRE 325


>gi|315635224|ref|ZP_07890501.1| recombination protein A [Aggregatibacter segnis ATCC 33393]
 gi|315475970|gb|EFU66725.1| recombination protein A [Aggregatibacter segnis ATCC 33393]
          Length = 350

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/348 (65%), Positives = 280/348 (80%), Gaps = 11/348 (3%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KALEAAL QI++ +GKGAIM+LG    +   IE +S+GS GLD+ALGIGG P GRIV
Sbjct: 6   EKQKALEAALGQIEKQFGKGAIMKLGDSQKL--DIEAISTGSFGLDLALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IA++QK G TCAF+DAEHALD IYA KLGVD+K LL+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAEAQKAGKTCAFIDAEHALDPIYASKLGVDVKELLVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD+I++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAVDVIIVDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRRVGSIK+ D + GN+T
Sbjct: 184 KNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRVGSIKEGDEVIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QV+F I+YGEGIS   ELIDLGVK  ++ K+GAW++++ +++GQG+
Sbjct: 244 RVKVVKNKVAPPFRQVDFQILYGEGISKESELIDLGVKHKLISKAGAWYAYENEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDADKDD 358
            N+  +L+EN E A+ IES LR       D LL  P   T   AD +D
Sbjct: 304 TNAMKWLKENPEQAKLIESTLR-------DELLAHP--ETAITADVED 342


>gi|70904855|gb|AAZ14007.1| RecA [Burkholderia cenocepacia]
          Length = 316

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 275/317 (86%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGE IS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGERISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+VA
Sbjct: 300 IAREIENRIRESLGVVA 316


>gi|226939722|ref|YP_002794795.1| recombinase A [Laribacter hongkongensis HLHK9]
 gi|254790435|sp|C1D4J2|RECA_LARHH RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|226714648|gb|ACO73786.1| RecA [Laribacter hongkongensis HLHK9]
          Length = 354

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/331 (65%), Positives = 281/331 (84%), Gaps = 1/331 (0%)

Query: 7   MNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPK 66
           M   DK KAL AALSQI++ +GKG+IM++ ++  + + ++V+S+GSLGLD+ALG+GG P+
Sbjct: 1   MAETDKQKALSAALSQIEKQFGKGSIMRM-NETQVNDNLQVISTGSLGLDMALGVGGLPR 59

Query: 67  GRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQ 126
           GR+VEIYGPESSGKTTL L  +A++QK GGTCA++DAE+ALD +YA KLGV + +LL+SQ
Sbjct: 60  GRVVEIYGPESSGKTTLCLQVVAEAQKLGGTCAYIDAENALDPVYAGKLGVKVDDLLVSQ 119

Query: 127 PDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKL 186
           PDTGEQALEI DMLVRSG VD+IV+DSVAAL P+AEIEG+MG+S  G+QARLMSQALRKL
Sbjct: 120 PDTGEQALEICDMLVRSGGVDVIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKL 179

Query: 187 TSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSIT 246
           T +I R+  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IK  D I 
Sbjct: 180 TGNIKRTNTLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKKTDEII 239

Query: 247 GNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRL 306
           GN+TRVKVVKNK++ PFKQ EFDI+YGEGIS  GE+I++GV    VDKSGAW+++ GQ++
Sbjct: 240 GNETRVKVVKNKVSPPFKQAEFDILYGEGISREGEIIEMGVANKFVDKSGAWYAYNGQKI 299

Query: 307 GQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           GQG++N++ +LREN  IA+ IE  +R  AG+
Sbjct: 300 GQGKDNAREWLRENPAIAQEIEKKIRTAAGV 330


>gi|70904862|gb|AAZ14010.1| RecA [Burkholderia multivorans]
 gi|70904870|gb|AAZ14014.1| RecA [Burkholderia multivorans]
          Length = 318

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 5   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 63

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVRSG++
Sbjct: 64  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVRSGSI 123

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 124 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 183

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 184 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 243

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 244 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 303

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+ A
Sbjct: 304 IENRIRESLGVAA 316


>gi|239787275|emb|CAX83753.1| RecA bacterial DNA recombination protein [uncultured bacterium]
          Length = 348

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/327 (68%), Positives = 271/327 (82%), Gaps = 2/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++ KALEAA+ QI+R +GKGAIM++   G I   + VVS+GSLGLDIALGIGG P+GR+V
Sbjct: 6   EREKALEAAIGQIERQFGKGAIMRM--DGDITVDVPVVSTGSLGLDIALGIGGLPRGRVV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPE+SGKTTLALH  A+ Q+ GG  AFVDAEHALD  YARKLGV +  LL+SQPDTG
Sbjct: 64  EIYGPEASGKTTLALHVAAEVQRVGGVAAFVDAEHALDPAYARKLGVKVDQLLLSQPDTG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQ LEITDMLVRSGAVD++V+DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT SI
Sbjct: 124 EQGLEITDMLVRSGAVDLVVVDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTGSI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           SRSK I++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR   IK+KD + GN  
Sbjct: 184 SRSKAIVLFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRNAPIKEKDEVVGNHC 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNK+A PF+  EFDI YGEGIS  GE++D+GV+  +V+KSGAW+S++G+R+GQGR
Sbjct: 244 KVKVVKNKLAPPFRSAEFDITYGEGISLEGEILDMGVEEKLVEKSGAWYSYEGERIGQGR 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           E +K FL +N  +   +E  LR   GL
Sbjct: 304 EIAKRFLMDNPAMRNTLEDRLRVIKGL 330


>gi|301155303|emb|CBW14769.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Haemophilus parainfluenzae T3T1]
          Length = 351

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 284/349 (81%), Gaps = 6/349 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKG+IM+LG   ++   +E VS+GSLGLD+ALGIGG P GRIV
Sbjct: 6   EKQKALAAALGQIEKQFGKGSIMKLGDTQAL--DVESVSTGSLGLDVALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G TCAF+DAEHALD IYA KLGVD+K LL+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKVGKTCAFIDAEHALDPIYAAKLGVDVKELLVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD++++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAVDVVIVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR GS+KD D + GN+T
Sbjct: 184 KNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGDEVIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PF+QV+F I+YGEGIS  GELI+LGVK  +V+KSGAW+++ G+++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELIELGVKHKLVEKSGAWYAYNGEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA--DSLLQEPAINTKDDADKD 357
            N+  +L EN   ++ +E+ LR  A LVA  +  L      + DDA+ D
Sbjct: 304 ANAMKWLHENPAKSDELEAKLR--AELVANPEQALMADIEQSNDDAESD 350


>gi|296803056|gb|ADH51604.1| DNA recombinase [Burkholderia contaminans]
          Length = 316

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 300 IENRIRESLGVV 311


>gi|296837365|gb|ADH59541.1| DNA recombinase [Burkholderia stabilis]
          Length = 319

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/317 (69%), Positives = 276/317 (87%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFY+SVRL+IRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYASVRLEIRRIGSIKKIDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+VA
Sbjct: 300 IAREIENRIRESLGVVA 316


>gi|150171066|emb|CAO01516.1| DNA recombination protein [Burkholderia arboris]
          Length = 322

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GDATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAGLVA 339
           E+ +R++ G+V+
Sbjct: 300 ENRIRESLGVVS 311


>gi|162454236|ref|YP_001616603.1| RecA protein [Sorangium cellulosum 'So ce 56']
 gi|161164818|emb|CAN96123.1| RecA protein [Sorangium cellulosum 'So ce 56']
          Length = 393

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/338 (65%), Positives = 279/338 (82%), Gaps = 6/338 (1%)

Query: 6   EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65
           E N   KS ALE A++ +++ YGKGAIM+L    ++ + +  V++GSLGLDIALGIGG+P
Sbjct: 4   EKNTKQKSAALELAIASVEKEYGKGAIMRLKDGQTLHDEVAAVATGSLGLDIALGIGGYP 63

Query: 66  KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLIS 125
           +GRIVE+YGPESSGKTTL LH IA  Q+ GGT AF+DAEHALD  YA+KLGV    LLIS
Sbjct: 64  RGRIVEVYGPESSGKTTLTLHAIAAVQRAGGTAAFIDAEHALDVNYAKKLGVKTDELLIS 123

Query: 126 QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRK 185
           QPD GEQALEI DMLVRS AVDIIV+DSVAAL P+AEIEGDMG+S  G+QARLMSQALRK
Sbjct: 124 QPDYGEQALEIADMLVRSNAVDIIVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRK 183

Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKD---- 241
           LT + SRS+C+L+FINQ+RMKIGVMFGSPETT+GGNALKFY+SVRLDIRR+G+IK+    
Sbjct: 184 LTGTTSRSQCLLMFINQIRMKIGVMFGSPETTSGGNALKFYASVRLDIRRIGAIKEAAAG 243

Query: 242 --KDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWF 299
             + ++ GN+TRVKVVKNKMA PF++VEFDI+YG+GIS  G++IDL  +ASI++KSG+WF
Sbjct: 244 GKEPAVVGNRTRVKVVKNKMAPPFREVEFDILYGQGISHSGDVIDLATEASIIEKSGSWF 303

Query: 300 SFKGQRLGQGRENSKIFLRENIEIAENIESLLRQNAGL 337
           SF+G+R+GQGREN++ +L ++  + + IES++    G+
Sbjct: 304 SFQGERIGQGRENARTYLEQHPAVLDKIESMVLAKHGI 341


>gi|262370234|ref|ZP_06063560.1| recombinase A [Acinetobacter johnsonii SH046]
 gi|262314576|gb|EEY95617.1| recombinase A [Acinetobacter johnsonii SH046]
          Length = 347

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/323 (67%), Positives = 270/323 (83%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AALSQI++ +GK  +M+LG   +  + +E VS+GSL LDIALGIGG PKGRIV
Sbjct: 4   NKSKALNAALSQIEKQFGKNTVMRLGD--NTVQAVEAVSTGSLTLDIALGIGGLPKGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IA+ QK GGTCAF+DAEHALD  YARKLGVD+ NLL+SQPD G
Sbjct: 62  EIYGPESSGKTTMTLQAIAECQKAGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPDHG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 122 EQALEIADMLVRSGAIDLIVVDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKITGNA 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRRVG +K+ D I G++T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRVGQVKEGDEIVGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNKMA PF++  F I+YG+G++  GEL+DL V+  IV K+GAW+S++G ++GQG+
Sbjct: 242 KVKVVKNKMAPPFREALFQILYGKGVNHLGELVDLAVQQEIVQKAGAWYSYQGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N    L EN ++AE IE ++R+
Sbjct: 302 NNVIRHLEENPQLAETIEKIIRE 324


>gi|157326921|gb|ABV44573.1| RecA [Burkholderia cenocepacia]
          Length = 313

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 273/314 (86%), Gaps = 1/314 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAG 336
           IA  IE+ +R++ G
Sbjct: 300 IAREIENRIRESLG 313


>gi|170664160|gb|ACB28499.1| RecA [Burkholderia ambifaria]
 gi|170664162|gb|ACB28500.1| RecA [Burkholderia ambifaria]
 gi|170664164|gb|ACB28501.1| RecA [Burkholderia ambifaria]
 gi|170664166|gb|ACB28502.1| RecA [Burkholderia ambifaria]
 gi|170664168|gb|ACB28503.1| RecA [Burkholderia ambifaria]
 gi|170664170|gb|ACB28504.1| RecA [Burkholderia ambifaria]
 gi|170664172|gb|ACB28505.1| RecA [Burkholderia ambifaria]
          Length = 310

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 272/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G + E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEVAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            +A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VVAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|308212786|gb|ADO21621.1| RecA [Burkholderia arboris]
 gi|308212788|gb|ADO21622.1| RecA [Burkholderia arboris]
          Length = 313

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 273/314 (86%), Gaps = 1/314 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G+VD+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSVDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGL 337
           A  IE+ +R++ G+
Sbjct: 300 AREIENRIRESLGV 313


>gi|302037041|ref|YP_003797363.1| recombinase recA [Candidatus Nitrospira defluvii]
 gi|300605105|emb|CBK41438.1| Recombinase RecA [Candidatus Nitrospira defluvii]
          Length = 370

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/327 (67%), Positives = 276/327 (84%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K +AL+ AL+QI++ YGKGA+M+LG+     + +  +SSGSLGLDIALG+GGFP+GR++
Sbjct: 6   EKKRALDLALAQIEKQYGKGAVMKLGADDRPAD-VPAISSGSLGLDIALGVGGFPRGRVI 64

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL LH IA++QK GG  AF+DAEHALD  YA+KLGV   +LL+SQPDTG
Sbjct: 65  EIFGPESSGKTTLTLHAIAEAQKAGGVAAFIDAEHALDLTYAKKLGVQTDDLLVSQPDTG 124

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI + LVRSGA+D+IV+DSVAAL PRAEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 125 EQALEIAETLVRSGAIDVIVVDSVAALVPRAEIEGEMGDSHMGLQARLMSQALRKLTAAI 184

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           S+S+  L+FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+ SIKD   +TG++ 
Sbjct: 185 SKSQTTLIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIESIKDGQDVTGSRV 244

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNKMA PF+Q EFDIM+ EGIS  GEL+D+GV+  +V+K+GAW+S+KG+RLGQGR
Sbjct: 245 RVKVVKNKMAPPFRQAEFDIMFAEGISKSGELVDIGVEKRVVEKAGAWYSYKGERLGQGR 304

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           E  + FL+ N  IA+ IE  +R  AGL
Sbjct: 305 EAVRDFLKTNPAIAKEIEGKVRDLAGL 331


>gi|304310615|ref|YP_003810213.1| RecA/RadA recombinase [gamma proteobacterium HdN1]
 gi|301796348|emb|CBL44556.1| RecA/RadA recombinase [gamma proteobacterium HdN1]
          Length = 343

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/344 (64%), Positives = 284/344 (82%), Gaps = 4/344 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL+QI+R +GKG+IM++G Q  + + I  +S+GSLGLDIALGIGG PKGRIV
Sbjct: 4   NKRKALGAALAQIERQFGKGSIMRMGDQ--LQQAIPAISTGSLGLDIALGIGGLPKGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ+QK G  CAFVDAEHALD IYA KLGV++ +LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLSVIAQAQKQGAVCAFVDAEHALDPIYANKLGVNVDDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRS AVD+IV+DSVAAL PRAEIEG+MG+S  G+QARLMSQALRK+T ++
Sbjct: 122 EQALEITDMLVRSNAVDVIVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITGNV 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR GS+K  + +TG++T
Sbjct: 182 KQANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSVKQGEEVTGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+Q EF I+YG+GI   GE++DLGV   ++DKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVAPPFRQTEFQILYGKGIYREGEILDLGVACGVIDKSGAWYAYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDA 354
            N+  FL E +E+++ IE  +R +  L+A  L+ + +    +DA
Sbjct: 302 ANAAKFLEEKVEVSQEIEQQIRTS--LMASELVSKSSEPELEDA 343


>gi|56459851|ref|YP_155132.1| RecA recombinase [Idiomarina loihiensis L2TR]
 gi|76363333|sp|Q5QUB8|RECA_IDILO RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|56178861|gb|AAV81583.1| RecA recombinase [Idiomarina loihiensis L2TR]
          Length = 372

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 281/342 (82%), Gaps = 9/342 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           D+ KAL+AAL QI+R +GKG+IM+LG   ++   I+ VS+GSLGLDIALGIGG P GR+V
Sbjct: 4   DRQKALDAALGQIERQFGKGSIMRLGDNQTL--DIDSVSTGSLGLDIALGIGGLPFGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IA++QK G TCAFVDAEHALD IYA  LGV++ +LLISQPDTG
Sbjct: 62  EIYGPESSGKTTMTLEVIAEAQKMGKTCAFVDAEHALDPIYAEALGVNVDDLLISQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVDI+++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLTS+I
Sbjct: 122 EQALEICDMLVRSGAVDIVIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTSNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            +S  + +FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR G++K+ D + GN+T
Sbjct: 182 KKSNTMCIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGALKEGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK+  F I+YG+GIS  GELIDLGVK  +VDK+GAW+S+ G ++GQG+
Sbjct: 242 RVKVVKNKVAPPFKEAHFQILYGKGISKEGELIDLGVKHKMVDKAGAWYSYNGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKD 352
            NS  FL++N +IA+ +E  +R+        LL +P   TK+
Sbjct: 302 ANSMKFLQDNPKIADELEGRIRE-------LLLSKPEKRTKE 336


>gi|296803088|gb|ADH51620.1| DNA recombinase [Burkholderia cepacia]
          Length = 311

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 300 IENRIRESLGVV 311


>gi|157326903|gb|ABV44564.1| RecA [Burkholderia cenocepacia]
          Length = 317

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/316 (69%), Positives = 274/316 (86%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGE IS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGESISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+V+
Sbjct: 300 AREIENRIRESLGVVS 315


>gi|319940910|ref|ZP_08015248.1| recA [Sutterella wadsworthensis 3_1_45B]
 gi|319805626|gb|EFW02414.1| recA [Sutterella wadsworthensis 3_1_45B]
          Length = 381

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/356 (63%), Positives = 294/356 (82%), Gaps = 8/356 (2%)

Query: 4   RKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGG 63
           RKE +  ++ KAL AAL+ I++ +GKGAIM++ + G   + IEVVS+GSLGLD+ALG+GG
Sbjct: 13  RKEGD--ERKKALNAALASIEKQFGKGAIMRM-ADGVEQQNIEVVSTGSLGLDLALGVGG 69

Query: 64  FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLL 123
            P+GRIVEIYGPESSGKTTL+L  IA+ QK GGTCAFVDAEHALD  YA++LGV++  LL
Sbjct: 70  LPRGRIVEIYGPESSGKTTLSLQVIAEMQKIGGTCAFVDAEHALDIQYAQRLGVNVPELL 129

Query: 124 ISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQAL 183
           +SQPD GEQALEI D LVRSG++D+IV+DSVAALTPR+EIEGDMG++LPG+QARLMSQAL
Sbjct: 130 LSQPDAGEQALEIVDALVRSGSIDLIVVDSVAALTPRSEIEGDMGDALPGLQARLMSQAL 189

Query: 184 RKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKD 243
           RKLT+S+SR+KC+++FINQ+RMKIG  +G+PETTTGGNALKFYSSVRLDIRRVG+IK  D
Sbjct: 190 RKLTTSVSRTKCLVIFINQIRMKIG-GYGNPETTTGGNALKFYSSVRLDIRRVGAIKRAD 248

Query: 244 SITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKG 303
            + GN+TRVKVVKNK+A PFKQV+FDI+YGEGIS  GE+ID+G    +++KSGAW+S+ G
Sbjct: 249 EVIGNETRVKVVKNKVAPPFKQVQFDILYGEGISRLGEIIDIGTDLKVLEKSGAWYSYDG 308

Query: 304 QRLGQGRENSKIFLRENIEIAENIESLLRQNAGLVADSLL----QEPAINTKDDAD 355
           +RLGQG+E  +  L EN ++A+ IE  +R+  G+   S+     + P ++  +D+D
Sbjct: 309 RRLGQGKEKVRDLLAENPDLAKEIEGKIRELKGVHISSISAVDDEMPDMDQAEDSD 364


>gi|308212732|gb|ADO21594.1| RecA [Burkholderia arboris]
 gi|308212734|gb|ADO21595.1| RecA [Burkholderia arboris]
 gi|308212736|gb|ADO21596.1| RecA [Burkholderia arboris]
 gi|308212738|gb|ADO21597.1| RecA [Burkholderia arboris]
 gi|308212740|gb|ADO21598.1| RecA [Burkholderia arboris]
 gi|308212742|gb|ADO21599.1| RecA [Burkholderia arboris]
 gi|308212744|gb|ADO21600.1| RecA [Burkholderia arboris]
 gi|308212746|gb|ADO21601.1| RecA [Burkholderia arboris]
 gi|308212748|gb|ADO21602.1| RecA [Burkholderia arboris]
 gi|308212750|gb|ADO21603.1| RecA [Burkholderia arboris]
 gi|308212752|gb|ADO21604.1| RecA [Burkholderia arboris]
 gi|308212754|gb|ADO21605.1| RecA [Burkholderia arboris]
 gi|308212756|gb|ADO21606.1| RecA [Burkholderia arboris]
 gi|308212758|gb|ADO21607.1| RecA [Burkholderia arboris]
 gi|308212760|gb|ADO21608.1| RecA [Burkholderia arboris]
 gi|308212762|gb|ADO21609.1| RecA [Burkholderia arboris]
 gi|308212764|gb|ADO21610.1| RecA [Burkholderia arboris]
 gi|308212766|gb|ADO21611.1| RecA [Burkholderia arboris]
 gi|308212768|gb|ADO21612.1| RecA [Burkholderia arboris]
 gi|308212770|gb|ADO21613.1| RecA [Burkholderia arboris]
 gi|308212772|gb|ADO21614.1| RecA [Burkholderia arboris]
 gi|308212774|gb|ADO21615.1| RecA [Burkholderia arboris]
 gi|308212776|gb|ADO21616.1| RecA [Burkholderia arboris]
 gi|308212778|gb|ADO21617.1| RecA [Burkholderia arboris]
 gi|308212780|gb|ADO21618.1| RecA [Burkholderia arboris]
 gi|308212782|gb|ADO21619.1| RecA [Burkholderia arboris]
          Length = 313

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAGLVA 339
           E+ +R++ G+V+
Sbjct: 300 ENRIRESLGVVS 311


>gi|254481187|ref|ZP_05094432.1| protein RecA [marine gamma proteobacterium HTCC2148]
 gi|214038350|gb|EEB79012.1| protein RecA [marine gamma proteobacterium HTCC2148]
          Length = 347

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/324 (66%), Positives = 271/324 (83%), Gaps = 2/324 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AAL+QI+R +GKG +M++G      E I  +S+GSLGLDIALGIGG PKGRI 
Sbjct: 4   NKEKALDAALTQIERQFGKGTVMRMGD--VKHEAIPSISTGSLGLDIALGIGGLPKGRIC 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK GGT AF+DAEHALD  YA KLGV +  L++SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKAGGTAAFIDAEHALDPQYAEKLGVKMDELIMSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALE+ +MLVRSGAVD++VIDSVAALTP+AEIEGDMG+S  G+QARL+SQA+RKLT++I
Sbjct: 122 EQALEVAEMLVRSGAVDVLVIDSVAALTPKAEIEGDMGDSHVGLQARLLSQAMRKLTAAI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD D + GN+T
Sbjct: 182 KQTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKDGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ EF IMYG+GI   GE+ID GVK ++VDKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQAEFQIMYGKGIYHMGEVIDWGVKLNLVDKSGAWYAYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQN 334
            N+  FL  N  +A  IE+ +R+ 
Sbjct: 302 ANASKFLEANPAVANEIEAAIREQ 325


>gi|152977946|ref|YP_001343575.1| recombinase A [Actinobacillus succinogenes 130Z]
 gi|150839669|gb|ABR73640.1| recA protein [Actinobacillus succinogenes 130Z]
          Length = 367

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 233/357 (65%), Positives = 285/357 (79%), Gaps = 7/357 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL AAL QI++ +GKGAIM+LG +  +   +E VS+GS+GLD+ALGIGG P GRIV
Sbjct: 14  EKSKALAAALGQIEKQFGKGAIMKLGDRPDM--DVESVSTGSIGLDVALGIGGLPMGRIV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G  CAF+DAEHALD IYA KLGVD+K L ISQPD G
Sbjct: 72  EIFGPESSGKTTLTLSVIAQAQKAGKVCAFIDAEHALDPIYAAKLGVDVKELFISQPDNG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGA+D+I++DSVAALTP+AEIEGDMG++  G+QARLMSQALRKLT+ I
Sbjct: 132 EQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDAHVGLQARLMSQALRKLTAQI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             S C++VFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GS+K  D I GN+T
Sbjct: 192 KSSNCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSVKAGDEIIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PF+ V+F IMYGEGIS  GELI+LGVK  +V KSGAWF+++GQ++GQG+
Sbjct: 252 RVKVVKNKLAAPFRTVDFQIMYGEGISKNGELIELGVKQKLVQKSGAWFAYEGQKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLR----QNAGLVADSLLQEPAINTKDDADKDDTDNVE 363
            N+  +L +N E A  +ES +R    +N      + L     NT+ D D +DT N E
Sbjct: 312 ANAMKWLADNPEKAAELESKIRAEFQENPEKTLIAELDGSGKNTELD-DSEDTVNFE 367


>gi|296837429|gb|ADH59573.1| DNA recombinase [Burkholderia contaminans]
          Length = 310

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAGLV 338
           E+ +R++ G+V
Sbjct: 300 ENRIRESLGVV 310


>gi|296803054|gb|ADH51603.1| DNA recombinase [Burkholderia contaminans]
          Length = 311

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAGLV 338
           E+ +R++ G+V
Sbjct: 300 ENRIRESLGVV 310


>gi|170664132|gb|ACB28485.1| RecA [Burkholderia cenocepacia]
 gi|170664134|gb|ACB28486.1| RecA [Burkholderia cenocepacia]
 gi|170664136|gb|ACB28487.1| RecA [Burkholderia cenocepacia]
 gi|170664138|gb|ACB28488.1| RecA [Burkholderia cenocepacia]
 gi|170664140|gb|ACB28489.1| RecA [Burkholderia cenocepacia]
 gi|170664142|gb|ACB28490.1| RecA [Burkholderia cenocepacia]
          Length = 310

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|221133348|ref|ZP_03559653.1| recA protein [Glaciecola sp. HTCC2999]
          Length = 344

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/322 (68%), Positives = 273/322 (84%), Gaps = 2/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K++AL AAL QI++ +GKGAIM+LG   ++   IE VS+GSL +DIALGIGG P GR+V
Sbjct: 5   NKTRALSAALGQIEKQFGKGAIMRLGDNQAM--DIESVSTGSLSIDIALGIGGLPCGRVV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK G TCAFVDAEHALD +YA  LGV++  LL+SQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAEAQKVGKTCAFVDAEHALDPVYAEALGVNIDELLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD++++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT +I
Sbjct: 123 EQALEICDMLVRSGAVDVVIVDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTGNI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+R+KIGVMFG+PETTTGGNALKFYSSVRLDIRR+G+IKD D I GN+T
Sbjct: 183 KRSNTLVIFINQIRLKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAIKDGDEIVGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ EF IMYG+GIS   ELIDLGVK  +V+K+GAW+S+ G+R+GQG+
Sbjct: 243 RVKVVKNKVAPPFKQAEFQIMYGQGISKEAELIDLGVKQKLVEKAGAWYSYNGERIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLR 332
            N   +L+E+ E+A +IE+ +R
Sbjct: 303 ANVVKYLKEHPEMANDIEARIR 324


>gi|296803086|gb|ADH51619.1| DNA recombinase [Burkholderia cenocepacia]
          Length = 316

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 300 IENRIRESLGVV 311


>gi|296803092|gb|ADH51622.1| DNA recombinase [Burkholderia contaminans]
          Length = 312

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQN 334
           IA  IE+ +R++
Sbjct: 300 IAREIENRIRES 311


>gi|319779603|ref|YP_004130516.1| RecA protein [Taylorella equigenitalis MCE9]
 gi|317109627|gb|ADU92373.1| RecA protein [Taylorella equigenitalis MCE9]
          Length = 356

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 275/332 (82%), Gaps = 1/332 (0%)

Query: 22  QIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKT 81
           QI++ +GKG+IM+ G    +   I+V S+GSL LDIALG+GG P+GR++EI+GPESSGKT
Sbjct: 19  QIEKQFGKGSIMRYGDS-EVEHDIQVFSTGSLSLDIALGVGGLPRGRVIEIFGPESSGKT 77

Query: 82  TLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV 141
           TL L  IA+ QK GGTCAF+DAEHALD  YA KLGV+L  LLISQPD+GEQALEITD LV
Sbjct: 78  TLTLQAIAEMQKLGGTCAFIDAEHALDVQYAAKLGVNLDELLISQPDSGEQALEITDALV 137

Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201
           RSG++D+IV+DSVAAL P+AE+EGDMG+SLPG+QARLMSQALRKLT+SI R+ C ++FIN
Sbjct: 138 RSGSIDLIVVDSVAALVPKAELEGDMGDSLPGLQARLMSQALRKLTASIKRTNCTVIFIN 197

Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261
           Q+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK+A 
Sbjct: 198 QIRMKIGVMFGSPETTTGGNALKFYTSVRLDIRRIGSIKKGDEVIGNETRVKVVKNKVAP 257

Query: 262 PFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENI 321
           PFKQVEFDIMYG GIS  GE+IDLGVKA IVDK+G+WFS+ G ++GQG++N + +L+ N 
Sbjct: 258 PFKQVEFDIMYGTGISREGEIIDLGVKAGIVDKAGSWFSYNGNKIGQGKDNVREYLKSNP 317

Query: 322 EIAENIESLLRQNAGLVADSLLQEPAINTKDD 353
           E+A+ IE  +R+  G+    +  + + +  DD
Sbjct: 318 ELAQEIEGKIREAMGVGGSDIFTDMSHSDSDD 349


>gi|148887233|emb|CAM12783.1| recombinase A [Ochrobactrum pseudogrignonense]
          Length = 267

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/263 (82%), Positives = 245/263 (93%)

Query: 45  IEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE 104
           IE V +GSL LDIALG+GG PKGRIVEIYGPESSGKTTLALHTIA++QK GG CAFVDAE
Sbjct: 5   IETVPTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAE 64

Query: 105 HALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIE 164
           HALD +YARKLGVDL+NLLISQPDTGEQALEITD LVRSGA+D++V+DSVAALTPRAEIE
Sbjct: 65  HALDPVYARKLGVDLENLLISQPDTGEQALEITDTLVRSGAIDVLVVDSVAALTPRAEIE 124

Query: 165 GDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALK 224
           G+MG+SLPG+QARLMSQALRKLT+SISRS C+++FINQ+RMKIGVMFGSPETTTGGNALK
Sbjct: 125 GEMGDSLPGLQARLMSQALRKLTASISRSNCMVIFINQIRMKIGVMFGSPETTTGGNALK 184

Query: 225 FYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELID 284
           FY+SVRLDIRR+GSIK++D + GNQTRVKVVKNK+A PFKQVEFDIMYG G+S  GEL+D
Sbjct: 185 FYASVRLDIRRIGSIKERDEVVGNQTRVKVVKNKLAPPFKQVEFDIMYGAGVSKTGELVD 244

Query: 285 LGVKASIVDKSGAWFSFKGQRLG 307
           LGVKA +V+KSGAWFS+  QRLG
Sbjct: 245 LGVKAGVVEKSGAWFSYNSQRLG 267


>gi|296837431|gb|ADH59574.1| DNA recombinase [Burkholderia contaminans]
          Length = 311

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAGLV 338
           E+ +R++ G+V
Sbjct: 300 ENRIRESLGVV 310


>gi|296837379|gb|ADH59548.1| DNA recombinase [Burkholderia contaminans]
          Length = 312

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 302 IENRIRESLGV 312


>gi|296837377|gb|ADH59547.1| DNA recombinase [Burkholderia contaminans]
          Length = 310

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|325577038|ref|ZP_08147579.1| recombination protein A [Haemophilus parainfluenzae ATCC 33392]
 gi|325160894|gb|EGC73014.1| recombination protein A [Haemophilus parainfluenzae ATCC 33392]
          Length = 351

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 283/349 (81%), Gaps = 6/349 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKG+IM+LG   ++   +E VS+GSLGLD+ALGIGG P GRIV
Sbjct: 6   EKQKALAAALGQIEKQFGKGSIMKLGDTQAL--DVESVSTGSLGLDVALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G TCAF+DAEHALD IYA KLGVD+K LL+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKVGKTCAFIDAEHALDPIYAAKLGVDVKELLVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD++++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAVDVVIVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR GS+KD D + GN+T
Sbjct: 184 KNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRTGSVKDGDEVIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A+PF+QV+F I+YGEGIS  GELI+LGVK  +V+KSGAW+++ G+++GQG+
Sbjct: 244 RVKVVKNKLAAPFRQVDFQILYGEGISKAGELIELGVKHKLVEKSGAWYAYNGEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA--DSLLQEPAINTKDDADKD 357
            N+  +L EN   ++ +E+ LR  A LVA  +  L        DDA+ D
Sbjct: 304 ANAMKWLHENPAKSDELEAKLR--AELVANPEQALMADIEQPTDDAESD 350


>gi|70904860|gb|AAZ14009.1| RecA [Burkholderia multivorans]
          Length = 318

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/317 (69%), Positives = 275/317 (86%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GK +IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKESIMRMGD-GDAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+ A
Sbjct: 300 IAREIENRIRESLGVAA 316


>gi|296802994|gb|ADH51573.1| DNA recombinase [Burkholderia multivorans]
          Length = 311

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 272/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|296802990|gb|ADH51571.1| DNA recombinase [Burkholderia contaminans]
 gi|296803026|gb|ADH51589.1| DNA recombinase [Burkholderia contaminans]
 gi|296803038|gb|ADH51595.1| DNA recombinase [Burkholderia contaminans]
 gi|296803040|gb|ADH51596.1| DNA recombinase [Burkholderia contaminans]
 gi|296803046|gb|ADH51599.1| DNA recombinase [Burkholderia contaminans]
 gi|296803060|gb|ADH51606.1| DNA recombinase [Burkholderia contaminans]
 gi|296837357|gb|ADH59537.1| DNA recombinase [Burkholderia contaminans]
          Length = 310

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|296802986|gb|ADH51569.1| DNA recombinase [Burkholderia cepacia]
          Length = 312

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 301 IENRIRESLGVV 312


>gi|119504841|ref|ZP_01626919.1| recA protein [marine gamma proteobacterium HTCC2080]
 gi|119459446|gb|EAW40543.1| recA protein [marine gamma proteobacterium HTCC2080]
          Length = 347

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 273/324 (84%), Gaps = 2/324 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL+AA+SQI+R +GKG +M++G Q  +   I  +S+GSLGLDIALGIGG PKGRI 
Sbjct: 4   NKAKALDAAMSQIERQFGKGTVMRMGDQERV--AIPSISTGSLGLDIALGIGGLPKGRIC 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IA++QK GGT AF+DAEHALD  YA +LGV + ++++SQPDTG
Sbjct: 62  EIYGPESSGKTTMTLQVIAEAQKKGGTAAFIDAEHALDPQYAERLGVQVDDMIVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALE+ +MLVRSGAVD++VIDSVAALTP+AEIEG+MG+S  G+QARL+SQA+RKLT +I
Sbjct: 122 EQALEVAEMLVRSGAVDVLVIDSVAALTPKAEIEGEMGQSHVGLQARLLSQAMRKLTGAI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR G++KD D + GN+T
Sbjct: 182 KQTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKDGDEVVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ EF IMYGEGI   GE+ID GVK ++VDKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQAEFQIMYGEGIYHMGEVIDWGVKLNLVDKSGAWYAYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQN 334
            N+  FL E+ +IA  IES +R  
Sbjct: 302 ANASRFLEEHPDIANEIESQIRHQ 325


>gi|296803028|gb|ADH51590.1| DNA recombinase [Burkholderia contaminans]
 gi|296803034|gb|ADH51593.1| DNA recombinase [Burkholderia contaminans]
          Length = 311

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 301 IENRIRESLGV 311


>gi|296803090|gb|ADH51621.1| DNA recombinase [Burkholderia contaminans]
          Length = 314

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 271/312 (86%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLV 338
           IE+ +R+  G+V
Sbjct: 302 IENRIRELLGVV 313


>gi|157326935|gb|ABV44580.1| RecA [Burkholderia multivorans]
 gi|157326941|gb|ABV44583.1| RecA [Burkholderia multivorans]
 gi|157326943|gb|ABV44584.1| RecA [Burkholderia multivorans]
 gi|157326945|gb|ABV44585.1| RecA [Burkholderia multivorans]
          Length = 312

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/313 (69%), Positives = 273/313 (87%), Gaps = 1/313 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQNAG 336
           A  IE+ +R++ G
Sbjct: 300 AREIENRIRESLG 312


>gi|150171062|emb|CAO01514.1| DNA recombination protein [Burkholderia seminalis]
          Length = 330

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/316 (68%), Positives = 274/316 (86%), Gaps = 1/316 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 6   EKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 64

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 65  TLQVIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 124

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 125 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 184

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 185 RMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 244

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 245 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 304

Query: 324 AENIESLLRQNAGLVA 339
           A  IE+ +R++ G+ +
Sbjct: 305 AREIENRIRESLGVAS 320


>gi|261866979|ref|YP_003254901.1| recombinase A [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391311|ref|ZP_06635645.1| protein RecA [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261412311|gb|ACX81682.1| protein RecA [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290951845|gb|EFE01964.1| protein RecA [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 352

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/336 (66%), Positives = 277/336 (82%), Gaps = 9/336 (2%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AAL QI++ +GKGAIM+LG    +   IE +S+GS GLD+ALGIGG P GRIV
Sbjct: 6   EKQKALDAALGQIEKQFGKGAIMKLGDSQKL--DIEAISTGSFGLDLALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IA++QKTG TCAF+DAEHALD IYA KLGVD+K LL+SQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAEAQKTGKTCAFIDAEHALDPIYASKLGVDVKELLVSQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD+I++DSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLTS I
Sbjct: 124 EQALEICDALVRSGAVDVIIVDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTSQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRRVGSIK+ D + GN+T
Sbjct: 184 KNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRVGSIKEGDEVIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QV+F I+YGEGIS   ELI+LGVK  ++ K+GAW++++ +++GQG+
Sbjct: 244 RVKVVKNKVAPPFRQVDFQILYGEGISKESELIELGVKHKLISKAGAWYAYQNEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEP 346
            N+  +L++N E A+ IES LR       D LL  P
Sbjct: 304 TNAMKWLKDNPEQAKFIESTLR-------DELLAHP 332


>gi|254284267|ref|ZP_04959235.1| protein RecA [gamma proteobacterium NOR51-B]
 gi|219680470|gb|EED36819.1| protein RecA [gamma proteobacterium NOR51-B]
          Length = 354

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/324 (67%), Positives = 273/324 (84%), Gaps = 2/324 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL+AALSQI+R +GKG +M++G Q  +   I  +S+GSLGLDIALGIGG PKGRI 
Sbjct: 4   NKQKALDAALSQIERQFGKGTVMRMGDQERV--AIPSISTGSLGLDIALGIGGLPKGRIC 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA++QK GGT AFVDAEHALD  YA KLGV + +L++SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQVIAEAQKAGGTAAFVDAEHALDPQYAEKLGVQVDDLIMSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALE+++MLVRSGAVD++VIDSVAALTP+AEIEG+MG+S  G+QARL+SQA+RKLT +I
Sbjct: 122 EQALEVSEMLVRSGAVDVLVIDSVAALTPKAEIEGEMGDSHVGLQARLLSQAMRKLTGAI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++KD D + GN+T
Sbjct: 182 KQTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKDGDEVIGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PFKQ EF IMYG GI   GE+ID GVK ++VDKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVSPPFKQAEFQIMYGAGIYRLGEVIDWGVKLNLVDKSGAWYAYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQN 334
            N+  FL+EN  I + IE+ +R  
Sbjct: 302 ANAARFLQENPRIGDEIENQIRHQ 325


>gi|296837359|gb|ADH59538.1| DNA recombinase [Burkholderia cenocepacia]
          Length = 312

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQN 334
           IA  IE+ +R++
Sbjct: 300 IAREIENRIRES 311


>gi|254427618|ref|ZP_05041325.1| protein RecA [Alcanivorax sp. DG881]
 gi|196193787|gb|EDX88746.1| protein RecA [Alcanivorax sp. DG881]
          Length = 344

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 276/322 (85%), Gaps = 2/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           DK KAL AALSQI+R +GKG++M++G +    E +  +S+GSLGLD+ALGIGG PKGRIV
Sbjct: 3   DKGKALSAALSQIERQFGKGSVMRMGDRKR--ERMPSISTGSLGLDVALGIGGLPKGRIV 60

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ+QK G TCAFVDAEHALD  YA KLGV++ +L++SQPDTG
Sbjct: 61  EIYGPESSGKTTLTLSVIAQAQKKGATCAFVDAEHALDPDYAEKLGVNVDDLIVSQPDTG 120

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD++++DSVAAL P+AEIEG+MG++  G+QARLMSQALRK+T ++
Sbjct: 121 EQALEITDMLVRSGAVDVVIVDSVAALVPKAEIEGEMGDTHVGLQARLMSQALRKITGNV 180

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             +  ++VFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+G++K  D +TGN+T
Sbjct: 181 KNANTLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGAVKQGDEVTGNET 240

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK++ PF+Q EF I+YG+GI+  GE++DLGV+  +VDKSGAW+++KG ++GQG+
Sbjct: 241 RVKVVKNKVSPPFRQAEFQILYGQGINQLGEVLDLGVQQGLVDKSGAWYAYKGDKIGQGK 300

Query: 311 ENSKIFLRENIEIAENIESLLR 332
           +N+  +LREN  IAE IE+ +R
Sbjct: 301 QNACEYLRENPAIAEEIETEIR 322


>gi|50084563|ref|YP_046073.1| recombinase A [Acinetobacter sp. ADP1]
 gi|1172879|sp|P42438|RECA_ACIAD RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|440089|gb|AAC27115.1| RecA [Acinetobacter sp. ADP1]
 gi|49530539|emb|CAG68251.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Acinetobacter sp. ADP1]
          Length = 349

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 215/323 (66%), Positives = 273/323 (84%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL+AALSQI++ +GK  +M+LG   +  + +E VS+GSL LDIALGIGG PKGRIV
Sbjct: 4   NKSKALQAALSQIEKQFGKNTVMRLGD--NTVQAVEAVSTGSLTLDIALGIGGLPKGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IAQ QK GGTCAF+DAEHALD  YARKLGVD+ NLL+SQPD G
Sbjct: 62  EIYGPESSGKTTMTLQAIAQCQKAGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPDHG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 122 EQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGNA 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G +K+ D I G++T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIIGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNKMA PF++  F I+YG+G++  GEL+DL V+ +IV K+GAW+S++G ++GQG+
Sbjct: 242 KVKVVKNKMAPPFREAIFQILYGKGVNQLGELVDLAVQQNIVQKAGAWYSYQGNKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N   +L EN +I+  IE+++R+
Sbjct: 302 NNVIRYLEENPQISTEIEAVIRE 324


>gi|157326929|gb|ABV44577.1| RecA [Burkholderia multivorans]
          Length = 309

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 270/308 (87%), Gaps = 1/308 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           +QI++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGK
Sbjct: 1   AQIEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGK 59

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD L
Sbjct: 60  TTLTLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDAL 119

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FI
Sbjct: 120 VRSGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFI 179

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++
Sbjct: 180 NQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVS 239

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PF++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN
Sbjct: 240 PPFREAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLREN 299

Query: 321 IEIAENIE 328
            EIA  IE
Sbjct: 300 PEIAREIE 307


>gi|169633342|ref|YP_001707078.1| recombinase A [Acinetobacter baumannii SDF]
 gi|169795694|ref|YP_001713487.1| recombinase A [Acinetobacter baumannii AYE]
 gi|184158405|ref|YP_001846744.1| recombinase A [Acinetobacter baumannii ACICU]
 gi|213158361|ref|YP_002319659.1| DNA strand exchange and recombination protein RecA [Acinetobacter
           baumannii AB0057]
 gi|215483180|ref|YP_002325387.1| protein RecA [Acinetobacter baumannii AB307-0294]
 gi|229577096|ref|YP_001084991.2| recombinase A [Acinetobacter baumannii ATCC 17978]
 gi|239501635|ref|ZP_04660945.1| recombinase A [Acinetobacter baumannii AB900]
 gi|260554756|ref|ZP_05826977.1| recA protein [Acinetobacter baumannii ATCC 19606]
 gi|294838602|ref|ZP_06783285.1| recombinase A [Acinetobacter sp. 6013113]
 gi|294842278|ref|ZP_06786961.1| recombinase A [Acinetobacter sp. 6014059]
 gi|294859590|ref|ZP_06797359.1| recombinase A [Acinetobacter sp. 6013150]
 gi|301348114|ref|ZP_07228855.1| recombinase A [Acinetobacter baumannii AB056]
 gi|301512103|ref|ZP_07237340.1| recombinase A [Acinetobacter baumannii AB058]
 gi|301597370|ref|ZP_07242378.1| recombinase A [Acinetobacter baumannii AB059]
 gi|226737747|sp|B7H1V4|RECA_ACIB3 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|226737748|sp|B7I9U0|RECA_ACIB5 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|238685519|sp|A3M645|RECA_ACIBT RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|238688039|sp|B0V6E0|RECA_ACIBY RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|238688140|sp|B0VMV7|RECA_ACIBS RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|238691026|sp|B2I316|RECA_ACIBC RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|169148621|emb|CAM86487.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Acinetobacter baumannii AYE]
 gi|169152134|emb|CAP01033.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Acinetobacter baumannii]
 gi|183209999|gb|ACC57397.1| RecA/RadA recombinase [Acinetobacter baumannii ACICU]
 gi|193077556|gb|ABO12389.2| DNA strand exchange and recombination protein [Acinetobacter
           baumannii ATCC 17978]
 gi|213057521|gb|ACJ42423.1| DNA strand exchange and recombination protein RecA [Acinetobacter
           baumannii AB0057]
 gi|213987860|gb|ACJ58159.1| protein RecA [Acinetobacter baumannii AB307-0294]
 gi|260411298|gb|EEX04595.1| recA protein [Acinetobacter baumannii ATCC 19606]
 gi|322508729|gb|ADX04183.1| recA [Acinetobacter baumannii 1656-2]
 gi|323518334|gb|ADX92715.1| recombinase A [Acinetobacter baumannii TCDC-AB0715]
          Length = 349

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/323 (66%), Positives = 270/323 (83%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +KSKAL+AALSQI++ +GK  +M+LG   +  + +E VS+GSL LDIALGIGG PKGRI+
Sbjct: 4   NKSKALQAALSQIEKQFGKNTVMRLGD--NTVQAVEAVSTGSLTLDIALGIGGLPKGRII 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTT+ L  IAQ QK+GGTCAF+DAEHALD  YARKLGVD+ NLL+SQPD G
Sbjct: 62  EIYGPESSGKTTMTLQAIAQCQKSGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPDNG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGA+D+IV+DSVAALTP+AEIEG+MG+S  G+QARLMSQALRK+T + 
Sbjct: 122 EQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGNA 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+G +K+ D I G++T
Sbjct: 182 KRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNKMA PFK+  F I+YG+G +  GEL+DL V+  IV K+GAW+S++G ++GQG+
Sbjct: 242 KVKVVKNKMAPPFKEAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N   +  EN +IAE IE  +R+
Sbjct: 302 NNVIRYFEENTQIAEEIERNIRE 324


>gi|296803044|gb|ADH51598.1| DNA recombinase [Burkholderia contaminans]
          Length = 309

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/310 (70%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAG 336
           IE+ +R++ G
Sbjct: 300 IENRIRESLG 309


>gi|296803014|gb|ADH51583.1| DNA recombinase [Burkholderia contaminans]
          Length = 314

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 271/312 (86%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGE IS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGESISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 301 IENRIRESLGVV 312


>gi|296803066|gb|ADH51609.1| DNA recombinase [Burkholderia cenocepacia]
          Length = 309

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/310 (70%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAGL 337
           E+ +R++ G+
Sbjct: 300 ENRIRESLGV 309


>gi|170664174|gb|ACB28506.1| RecA [Burkholderia pyrrocinia]
 gi|170664178|gb|ACB28508.1| RecA [Burkholderia pyrrocinia]
          Length = 310

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG+V
Sbjct: 60  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSV 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|254448272|ref|ZP_05061734.1| protein RecA [gamma proteobacterium HTCC5015]
 gi|198262139|gb|EDY86422.1| protein RecA [gamma proteobacterium HTCC5015]
          Length = 348

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/344 (64%), Positives = 278/344 (80%), Gaps = 9/344 (2%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           + KAL AAL QI+R +GKG++M++G    +   IE +S+GSL LD+ALGIGG PKGR+VE
Sbjct: 5   RKKALAAALGQIERQFGKGSVMRMGD--GVIRNIESISTGSLTLDVALGIGGLPKGRVVE 62

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTT+ L  +A+ QK GGT AFVDAEHALD  YA+KLGVD+  LL+SQPDTGE
Sbjct: 63  IYGPESSGKTTMTLQVVAECQKAGGTAAFVDAEHALDPTYAKKLGVDVDELLVSQPDTGE 122

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEI DMLVRS AVD++VIDSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I 
Sbjct: 123 QALEIADMLVRSSAVDVVVIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANIK 182

Query: 192 RSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTR 251
           RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G+IK  D + GN+T+
Sbjct: 183 RSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAIKKGDEVLGNETK 242

Query: 252 VKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRE 311
           VKVVKNK A PFK+  F+I+YGEG+SF GEL+DLGV+  +VDK+GAW+S  G+R+GQG++
Sbjct: 243 VKVVKNKTAPPFKEARFEILYGEGVSFEGELLDLGVEHKLVDKAGAWYSCNGERIGQGKD 302

Query: 312 NSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDDAD 355
           N++ +L+E+ E+A  + S LR       D LL  P     DD +
Sbjct: 303 NARNYLKEHPEMAAELNSKLR-------DILLDLPKDGEADDEE 339


>gi|170718447|ref|YP_001783664.1| recombinase A [Haemophilus somnus 2336]
 gi|189039596|sp|B0UWL1|RECA_HAES2 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|168826576|gb|ACA31947.1| recA protein [Haemophilus somnus 2336]
          Length = 355

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 272/322 (84%), Gaps = 2/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KALEAAL QI++ +GKGAIM+LG    +   IE +S+GSL LD+ALGIGG P GRIV
Sbjct: 6   EKAKALEAALGQIEKQFGKGAIMKLGETQKL--DIEAISTGSLSLDVALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G TCAF+DAEHALD IYA KLGVD+K LLISQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELLISQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD++++DSVAALTP+AEIEG+MG++  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAVDVVIVDSVAALTPKAEIEGEMGDTHVGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             S C++VFINQ+RMKIGV+FG+PETTTGGNALKFY+SVRLDIRRVGSIK+ D + GN+T
Sbjct: 184 KNSNCLVVFINQIRMKIGVVFGNPETTTGGNALKFYASVRLDIRRVGSIKNGDEVIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QV+F I+YGEGIS  GELI+LGVK  +V+KSGAWFS++G+++GQG+
Sbjct: 244 RVKVVKNKVAPPFRQVDFQILYGEGISRNGELIELGVKHKLVNKSGAWFSYEGEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLR 332
            N+  +L E+ E A  +E  LR
Sbjct: 304 TNAMKWLAEHPEQAAILEQKLR 325


>gi|296803022|gb|ADH51587.1| DNA recombinase [Burkholderia contaminans]
          Length = 316

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 271/312 (86%), Gaps = 1/312 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+ VS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 3   FGKGSIMRMGD-GEATENIQFVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 61

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 62  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 121

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 122 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 181

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 182 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 241

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 242 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 301

Query: 327 IESLLRQNAGLV 338
           IE+ +R++ G+V
Sbjct: 302 IENRIRESLGVV 313


>gi|270157136|ref|ZP_06185793.1| recombinase A [Legionella longbeachae D-4968]
 gi|289164459|ref|YP_003454597.1| RecA protein [Legionella longbeachae NSW150]
 gi|269989161|gb|EEZ95415.1| recombinase A [Legionella longbeachae D-4968]
 gi|288857632|emb|CBJ11472.1| RecA protein [Legionella longbeachae NSW150]
          Length = 347

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/322 (67%), Positives = 277/322 (86%), Gaps = 1/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AALSQI+R +GKG++M++G   S+   IE +S+GSLGLDIALGIGG PKGRIV
Sbjct: 4   NKQKALSAALSQIERQFGKGSVMRMGDS-SVARDIEAISTGSLGLDIALGIGGLPKGRIV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA+KLGV++  LL+SQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAECQKIGGTAAFIDAEHALDPSYAQKLGVNVDELLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD+I++DSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEITDMLVRSGAVDVIIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  + I G++T
Sbjct: 183 KRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK  EFDI+Y EGIS   E+I+L V+ ++++KSGAW+S+KG+++GQG+
Sbjct: 243 RVKVVKNKVAPPFKVTEFDILYNEGISRESEIINLAVQLNLIEKSGAWYSYKGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLR 332
           +N +++L+E+ ++A  +E  +R
Sbjct: 303 DNVRLYLKEHSQVAATLEQQIR 324


>gi|157326907|gb|ABV44566.1| RecA [Burkholderia cenocepacia]
          Length = 311

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQN 334
           A  IE+ +R++
Sbjct: 300 AREIENRIRES 310


>gi|296837395|gb|ADH59556.1| DNA recombinase [Burkholderia stabilis]
 gi|296837397|gb|ADH59557.1| DNA recombinase [Burkholderia contaminans]
          Length = 322

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/317 (69%), Positives = 275/317 (86%), Gaps = 1/317 (0%)

Query: 23  IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTT 82
           I++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+V+IYGPESSGKTT
Sbjct: 1   IEKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVQIYGPESSGKTT 59

Query: 83  LALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR 142
           L L  IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVR
Sbjct: 60  LTLQVIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVR 119

Query: 143 SGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQ 202
           SG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ
Sbjct: 120 SGSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQ 179

Query: 203 MRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASP 262
           +RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++ P
Sbjct: 180 IRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPP 239

Query: 263 FKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIE 322
           F++  FDI+YGEGIS  GE+IDL V+A IVDK+GAW+S+ G+++GQG++N++ FLREN E
Sbjct: 240 FREAIFDILYGEGISRQGEIIDLRVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPE 299

Query: 323 IAENIESLLRQNAGLVA 339
           IA  IE+ +R++ G+VA
Sbjct: 300 IAREIENRIRESLGVVA 316


>gi|113866572|ref|YP_725061.1| recombinase A [Ralstonia eutropha H16]
 gi|123134402|sp|Q0KE78|RECA_CUPNH RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|113525348|emb|CAJ91693.1| Recobination protein RecA [Ralstonia eutropha H16]
          Length = 354

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 286/329 (86%), Gaps = 1/329 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AALSQI++ +GKG+IM+LG  G + + I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKQKALAAALSQIEKQFGKGSIMRLGD-GEVEKDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGTCAF+DAEHALD  YA KLGV++ +LLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVSYANKLGVNVGDLLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDDVIGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNK++ PF++  FDI+YG+GIS  GE+IDLGV A IV+KSGAW+S+ G ++GQG+
Sbjct: 252 KVKVVKNKVSPPFREAFFDILYGQGISRQGEIIDLGVDAKIVEKSGAWYSYNGDKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVA 339
           +N++ +LREN +IA+ IE+ +R   G+VA
Sbjct: 312 DNAREYLRENPDIADEIENKVRAALGVVA 340


>gi|296932699|gb|ADH93503.1| recombinase A [Pseudomonas sp. In5]
          Length = 350

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/348 (64%), Positives = 277/348 (79%), Gaps = 3/348 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI+R +GKGA+M++G Q    + I  +S+GSLGLDIALGIGG PKGRIV
Sbjct: 4   NKKKALAAALGQIERQFGKGAVMRMGDQDR--QAIPAISTGSLGLDIALGIGGLPKGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ+QK G TCAFVDAEHALD  YA KLGV++ +LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLSVIAQAQKAGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRS AVD+I++DSVAAL P+AEIEG+MG+   G+QARLMSQALRK+T +I
Sbjct: 122 EQALEITDMLVRSNAVDVIIVDSVAALVPKAEIEGEMGDMHVGLQARLMSQALRKITGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR G++K+ D + G++T
Sbjct: 182 KNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+ASPF+Q EF I+YG+GI   GE+IDLGV    V+KSGAW++++G ++GQG+
Sbjct: 242 RVKVVKNKVASPFRQAEFQILYGKGIYLNGEMIDLGVLHGFVEKSGAWYAYEGTKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGLVADSLLQEPAINTKDD-ADKD 357
            NS  FL +N EIA  +E  LR      A  +   P   T DD AD D
Sbjct: 302 ANSAKFLADNPEIAAKLEKQLRDKLLTPAPDVKASPVKETADDLADAD 349


>gi|308212808|gb|ADO21632.1| RecA [Burkholderia arboris]
 gi|308212810|gb|ADO21633.1| RecA [Burkholderia arboris]
 gi|308212812|gb|ADO21634.1| RecA [Burkholderia arboris]
          Length = 316

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 29  KGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTI 88
           KG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  I
Sbjct: 1   KGSIMRMGD-GDAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVI 59

Query: 89  AQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDI 148
           A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG+VD+
Sbjct: 60  AELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSVDM 119

Query: 149 IVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIG 208
           IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKIG
Sbjct: 120 IVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIG 179

Query: 209 VMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEF 268
           VMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  F
Sbjct: 180 VMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAIF 239

Query: 269 DIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIE 328
           DI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  IE
Sbjct: 240 DILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREIE 299

Query: 329 SLLRQNAGLVA 339
           + +R++ G+V+
Sbjct: 300 NRIRESLGVVS 310


>gi|157326899|gb|ABV44562.1| RecA [Burkholderia cenocepacia]
          Length = 317

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/313 (69%), Positives = 272/313 (86%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKIGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNARDFLRENPEIARE 299

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+ +
Sbjct: 300 IENRIRESLGVFS 312


>gi|237809470|ref|YP_002893910.1| recombinase A [Tolumonas auensis DSM 9187]
 gi|259563347|sp|C4LBQ0|RECA_TOLAT RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|237501731|gb|ACQ94324.1| recA protein [Tolumonas auensis DSM 9187]
          Length = 360

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/323 (69%), Positives = 269/323 (83%), Gaps = 2/323 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKG+IM+LG   S+   I+ + +GSL LDIALGIGG P GRIV
Sbjct: 4   NKEKALAAALGQIEKQFGKGSIMRLGDTQSL--DIDSIPTGSLSLDIALGIGGLPMGRIV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G TCAF+DAEHALD IYA KLGV + +LL+SQPDTG
Sbjct: 62  EIFGPESSGKTTLTLEVIAQAQKAGKTCAFIDAEHALDPIYAGKLGVKVDDLLVSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSGAVD+I+IDSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT +I
Sbjct: 122 EQALEICDMLVRSGAVDVIIIDSVAALTPKAEIEGDMGDSHVGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             + C+ +FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR G+IKD + I GN+T
Sbjct: 182 KNANCLCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKDGEEIVGNET 241

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ +F I+YGEGIS   ELIDLGVK  ++DKSGAW+++KG ++GQG+
Sbjct: 242 RVKVVKNKVAPPFKQADFQILYGEGISKESELIDLGVKCKLIDKSGAWYAYKGDKIGQGK 301

Query: 311 ENSKIFLRENIEIAENIESLLRQ 333
            N+  +L+EN   AE IE  LR+
Sbjct: 302 ANAMKYLKENTAAAEEIELKLRE 324


>gi|296837369|gb|ADH59543.1| DNA recombinase [Burkholderia contaminans]
          Length = 309

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/310 (70%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAGL 337
           E+ +R++ G+
Sbjct: 300 ENRIRESLGV 309


>gi|52842028|ref|YP_095827.1| recombinase A [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54297714|ref|YP_124083.1| recombinase A [Legionella pneumophila str. Paris]
 gi|148359347|ref|YP_001250554.1| DNA recombination protein RecA [Legionella pneumophila str. Corby]
 gi|296107394|ref|YP_003619094.1| recombination protein RecA [Legionella pneumophila 2300/99 Alcoy]
 gi|59798138|sp|Q5X4B5|RECA_LEGPA RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|59798152|sp|Q5ZUJ7|RECA_LEGPH RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|166220654|sp|A5ICV8|RECA_LEGPC RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|13186174|emb|CAC33484.1| RecA protein [Legionella pneumophila]
 gi|52629139|gb|AAU27880.1| RecA bacterial DNA recombination protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53751499|emb|CAH12917.1| RecA protein [Legionella pneumophila str. Paris]
 gi|148281120|gb|ABQ55208.1| RecA bacterial DNA recombination protein [Legionella pneumophila
           str. Corby]
 gi|165968102|gb|ABY75873.1| RecA protein [Legionella pneumophila 2300/99 Alcoy]
 gi|295649295|gb|ADG25142.1| recombination protein RecA [Legionella pneumophila 2300/99 Alcoy]
 gi|307610503|emb|CBX00085.1| RecA protein [Legionella pneumophila 130b]
          Length = 348

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/322 (67%), Positives = 275/322 (85%), Gaps = 1/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AALSQI+R +GKG++M++G   ++   IE +S+GSLGLDIALGIGG PKGRIV
Sbjct: 4   NKQKALSAALSQIERQFGKGSVMRMGD-STVSRDIEAISTGSLGLDIALGIGGLPKGRIV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA+KLGV +  LL+SQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAECQKMGGTAAFIDAEHALDPSYAQKLGVKVDELLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRS AVD+++IDSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEITDMLVRSAAVDVVIIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  + I G++T
Sbjct: 183 KRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK  EFDI+Y EGIS   E+I+LGV+ ++++KSGAW+S+K +++GQG+
Sbjct: 243 RVKVVKNKVAPPFKMTEFDILYNEGISRESEIINLGVQLNLIEKSGAWYSYKQEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLR 332
           EN +++L+EN ++A  +E  +R
Sbjct: 303 ENVRLYLKENPQVAAELEQQIR 324


>gi|254514870|ref|ZP_05126931.1| protein RecA [gamma proteobacterium NOR5-3]
 gi|219677113|gb|EED33478.1| protein RecA [gamma proteobacterium NOR5-3]
          Length = 366

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/326 (67%), Positives = 271/326 (83%), Gaps = 3/326 (0%)

Query: 7   MNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPK 66
           MN  +K KALEAALSQI R +GKG +M++G    I   I  +S+GSLGLD+ALGIGG PK
Sbjct: 1   MN-ANKEKALEAALSQIDRQFGKGTVMRMGDNDRI--AIPAISTGSLGLDVALGIGGLPK 57

Query: 67  GRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQ 126
           GRI EI+GPESSGKTTL L  IA++QK GGT AF+DAEHALD IYA KLGV + +L++SQ
Sbjct: 58  GRICEIFGPESSGKTTLTLQVIAEAQKAGGTAAFIDAEHALDPIYAEKLGVKIDDLIVSQ 117

Query: 127 PDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKL 186
           PDTGEQALE+T+MLVRSGAVD++VIDSVAALTPRAEIEGDMG+S  G+QARL+SQA+RKL
Sbjct: 118 PDTGEQALEVTEMLVRSGAVDVLVIDSVAALTPRAEIEGDMGDSHVGLQARLLSQAMRKL 177

Query: 187 TSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSIT 246
           T++I ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFYSSVRLDIRR+G++K+ D + 
Sbjct: 178 TATIKQTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRIGAVKEGDEVV 237

Query: 247 GNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRL 306
           GN+TRVKVVKNK+A PFKQ EF IMYG GI    E+ID GVK  +VDKSGAW+++KG ++
Sbjct: 238 GNETRVKVVKNKVAPPFKQAEFQIMYGRGIYRTAEVIDWGVKLGLVDKSGAWYAYKGDKI 297

Query: 307 GQGRENSKIFLRENIEIAENIESLLR 332
           GQG+ N+  FL +N  +   IE L+R
Sbjct: 298 GQGKANAAKFLEDNPALGSEIEGLIR 323


>gi|307825705|ref|ZP_07655922.1| recA protein [Methylobacter tundripaludum SV96]
 gi|307733282|gb|EFO04142.1| recA protein [Methylobacter tundripaludum SV96]
          Length = 345

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/340 (65%), Positives = 282/340 (82%), Gaps = 2/340 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AAL QI++ +GKG++M++G   +  + I+VVS+GSLGLDIALG GG P+GR++
Sbjct: 4   NKKKALGAALMQIEKQFGKGSVMRMGDVAASRD-IDVVSTGSLGLDIALGCGGLPRGRVI 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AFVDAEHALD  YA K+GV++ +LL+SQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAEMQKLGGTAAFVDAEHALDPSYAEKIGVNVDDLLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRSGAVD++VIDSVAALTP+AEIEGDMG+S  G+QARLMSQALRKLT +I
Sbjct: 123 EQALEITDMLVRSGAVDVVVIDSVAALTPKAEIEGDMGDSHMGLQARLMSQALRKLTGNI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  + + GN+T
Sbjct: 183 KRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEVIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+Q EF+I+YGEGISF GEL+DLGV    + K+G+W+S+  +++GQG+
Sbjct: 243 RVKVVKNKVAPPFRQAEFEILYGEGISFLGELVDLGVSYGFIQKAGSWYSYGDEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNA-GLVADSLLQEPAIN 349
           +N K FLRE+ E A+ IE+ +R  A G     L++ P ++
Sbjct: 303 DNVKAFLREHPEKAKEIEAKIRAEAFGKKVAPLIEAPVVD 342


>gi|285017962|ref|YP_003375673.1| protein reca (recombinase a) [Xanthomonas albilineans GPE PC73]
 gi|283473180|emb|CBA15686.1| probable protein reca (recombinase a) [Xanthomonas albilineans]
          Length = 345

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/325 (67%), Positives = 277/325 (85%), Gaps = 4/325 (1%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K +AL AALSQI++ +GKG++M++G +  + E +EV+ +GSL LDIALGIGG PKGR+V
Sbjct: 4   NKKRALAAALSQIEKQFGKGSVMRMGDR--VIEAVEVIPTGSLMLDIALGIGGLPKGRVV 61

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ QK GGT AF+DAEHALD +YA KLGV++  LL+SQPDTG
Sbjct: 62  EIYGPESSGKTTLTLQAIAQCQKNGGTAAFIDAEHALDPVYAAKLGVNVDELLLSQPDTG 121

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSG+VDI+VIDSVAALTP+AEIEG+MG+ LPG+QARLMSQALRKLT +I
Sbjct: 122 EQALEIADMLVRSGSVDIVVIDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTGNI 181

Query: 191 SRSKCILVFINQMRMKIGVMFG--SPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGN 248
            RS  ++VFINQ+RMKIGVM    SPETTTGGNALKFY+SVRLDIRR+G+IK  D I GN
Sbjct: 182 KRSNTLVVFINQLRMKIGVMMPGQSPETTTGGNALKFYASVRLDIRRIGAIKKGDEIIGN 241

Query: 249 QTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQ 308
           QT++KVVKNK+A PFKQV  +I+YGEGIS  GELID+GV+A +V+K+GAW+S+  +R+GQ
Sbjct: 242 QTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVEKAGAWYSYGSERIGQ 301

Query: 309 GRENSKIFLRENIEIAENIESLLRQ 333
           G++N++ +LR+N ++A  +ES LR+
Sbjct: 302 GKDNARGYLRDNPQVAAKLESELRE 326


>gi|54294688|ref|YP_127103.1| RecA protein [Legionella pneumophila str. Lens]
 gi|59798134|sp|Q5WVQ0|RECA_LEGPL RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|53754520|emb|CAH16004.1| RecA protein [Legionella pneumophila str. Lens]
          Length = 348

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/322 (67%), Positives = 275/322 (85%), Gaps = 1/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AALSQI+R +GKG++M++G   ++   IE +S+GSLGLDIALGIGG PKGRIV
Sbjct: 4   NKQKALSAALSQIERQFGKGSVMRMGD-STVSRDIEAISTGSLGLDIALGIGGLPKGRIV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA+KLGV +  LL+SQPDTG
Sbjct: 63  EIYGPESSGKTTLTLQVIAECQKMGGTAAFIDAEHALDPSYAQKLGVKVDELLVSQPDTG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITDMLVRS AVD+++IDSVAALTP+AEIEG+MG+S  G+QARLMSQALRKLT++I
Sbjct: 123 EQALEITDMLVRSAAVDVVIIDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  + I G++T
Sbjct: 183 KRSNTLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEILGSET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFK  EFDI+Y EGIS   E+I+LGV+ ++++KSGAW+S+K +++GQG+
Sbjct: 243 RVKVVKNKVAPPFKMTEFDILYNEGISRESEIINLGVQLNLIEKSGAWYSYKQEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLR 332
           EN +++L+EN ++A  +E  +R
Sbjct: 303 ENVRLYLKENPQVAAELEQQIR 324


>gi|113461446|ref|YP_719515.1| recombinase A [Haemophilus somnus 129PT]
 gi|122945386|sp|Q0I4T0|RECA_HAES1 RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|112823489|gb|ABI25578.1| RecA protein [Haemophilus somnus 129PT]
          Length = 355

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 272/322 (84%), Gaps = 2/322 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KALEAAL QI++ +GKGAIM+LG    +   IE +S+GSL LD+ALGIGG P GRIV
Sbjct: 6   EKAKALEAALGQIEKQFGKGAIMKLGETQKL--DIEAISTGSLSLDVALGIGGLPMGRIV 63

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EI+GPESSGKTTL L  IAQ+QK G TCAF+DAEHALD IYA KLGVD+K LLISQPD G
Sbjct: 64  EIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIYAAKLGVDVKELLISQPDNG 123

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD++++DSVAALTP+AEIEG+MG++  G+QARLMSQALRKLT  I
Sbjct: 124 EQALEICDALVRSGAVDVVIVDSVAALTPKAEIEGEMGDTHVGLQARLMSQALRKLTGQI 183

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
             S C++VFINQ+RMKIGV+FG+PETTTGGNALKFY+SVRLDIRRVGSIK+ D + GN+T
Sbjct: 184 KNSNCLVVFINQIRMKIGVIFGNPETTTGGNALKFYASVRLDIRRVGSIKNGDEVIGNET 243

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PF+QV+F I+YGEGIS  GELI+LGVK  +V+KSGAWFS++G+++GQG+
Sbjct: 244 RVKVVKNKVAPPFRQVDFQILYGEGISRNGELIELGVKHKLVNKSGAWFSYEGEKIGQGK 303

Query: 311 ENSKIFLRENIEIAENIESLLR 332
            N+  +L E+ E A  +E  LR
Sbjct: 304 TNAMKWLAEHPEQAAILEQKLR 325


>gi|157326939|gb|ABV44582.1| RecA [Burkholderia multivorans]
          Length = 311

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 272/311 (87%), Gaps = 1/311 (0%)

Query: 24  QRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL 83
           ++ +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL
Sbjct: 1   EKQFGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTL 59

Query: 84  ALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRS 143
            L  IA+ QK GGT AF+DAEHALD  YA KLGV++ +LLISQPDTGEQALEITD LVRS
Sbjct: 60  TLQVIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPDLLISQPDTGEQALEITDALVRS 119

Query: 144 GAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203
           G++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+
Sbjct: 120 GSIDMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQI 179

Query: 204 RMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPF 263
           RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF
Sbjct: 180 RMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPF 239

Query: 264 KQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEI 323
           ++  FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EI
Sbjct: 240 REAIFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEI 299

Query: 324 AENIESLLRQN 334
           A  IE+ +R++
Sbjct: 300 AREIENRIRES 310


>gi|56477358|ref|YP_158947.1| recombinase A [Aromatoleum aromaticum EbN1]
 gi|76363319|sp|Q5P3R8|RECA_AROAE RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|56313401|emb|CAI08046.1| RecA [Aromatoleum aromaticum EbN1]
          Length = 346

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/327 (67%), Positives = 276/327 (84%), Gaps = 1/327 (0%)

Query: 21  SQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGK 80
           SQI++ +GKG+IM++G  G+I   I+ VS+GSLGLDIALG+GG P+GR+VEIYGPESSGK
Sbjct: 14  SQIEKQFGKGSIMRMGD-GTIERDIQTVSTGSLGLDIALGLGGLPRGRVVEIYGPESSGK 72

Query: 81  TTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDML 140
           TTL L  IA+ QK GGT AF+DAEHALD  YA KLGV++++LLISQPDTGEQALEI DML
Sbjct: 73  TTLTLQVIAEMQKLGGTAAFIDAEHALDVGYAEKLGVNIQDLLISQPDTGEQALEIADML 132

Query: 141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI 200
           VRSG V+I+VIDSVAALTP+AEIEG+MG+ LPG+QARLMSQALRKLT++I R+  +++FI
Sbjct: 133 VRSGGVEIVVIDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTANIKRTNTLVIFI 192

Query: 201 NQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMA 260
           NQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR G+IK  D + G++TR KVVKNK+A
Sbjct: 193 NQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAIKKGDEVVGSETRCKVVKNKVA 252

Query: 261 SPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLREN 320
            PFK+  FDI+YGEGIS  GE+IDLGV+  IVDKSGAW+++KG+++GQG++NS+ FLR N
Sbjct: 253 PPFKEAHFDILYGEGISREGEIIDLGVQHKIVDKSGAWYAYKGEKIGQGKDNSREFLRAN 312

Query: 321 IEIAENIESLLRQNAGLVADSLLQEPA 347
             +A  IE+ +R   GL A ++   PA
Sbjct: 313 PALAREIENKVRAQVGLNAMAVEAAPA 339


>gi|171057188|ref|YP_001789537.1| recombinase A [Leptothrix cholodnii SP-6]
 gi|170774633|gb|ACB32772.1| recA protein [Leptothrix cholodnii SP-6]
          Length = 353

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/327 (67%), Positives = 287/327 (87%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL+ AL+QI++ +GKG+IM+LG +G + E I+VVS+GSLGLD+ALG+GG P+GR+V
Sbjct: 12  EKAKALQVALAQIEKQFGKGSIMRLG-EGEVIEDIQVVSTGSLGLDVALGVGGLPRGRVV 70

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IAQ QK  G CAF+DAEHALD  YA+KLGV+L++LLISQPDTG
Sbjct: 71  EIYGPESSGKTTLTLQVIAQMQKLSGVCAFIDAEHALDIQYAQKLGVNLQDLLISQPDTG 130

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSG+VD+IV+DSVAALTP+AE+EG+MG+SLPG+QARLMSQALRKLTS+I
Sbjct: 131 EQALEIVDALVRSGSVDLIVVDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTSNI 190

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  + + G++T
Sbjct: 191 KKTNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGEEVIGSET 250

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNK++ PFK  EFDI+YGEGIS  GE+ID+GV A +VDKSGAW+++ G+++GQG+
Sbjct: 251 KVKVVKNKVSPPFKTAEFDILYGEGISREGEIIDMGVVAKVVDKSGAWYAYNGEKIGQGK 310

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +N + FLREN  +A  IE+ +R++ G+
Sbjct: 311 DNCREFLRENPALAHEIENKIRESLGI 337


>gi|89902707|ref|YP_525178.1| recombination protein RecA [Rhodoferax ferrireducens T118]
 gi|89347444|gb|ABD71647.1| recA protein [Rhodoferax ferrireducens T118]
          Length = 384

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/327 (68%), Positives = 286/327 (87%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K+KAL+ AL+QI++ +GKG IM+LG +G + E I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 38  EKAKALQVALAQIEKQFGKGTIMRLG-EGEVIEDIQVVSTGSLGLDIALGVGGLPRGRVV 96

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QKTGG CAF+DAEHALD  YA+ LGV+L++LLISQPDTG
Sbjct: 97  EIYGPESSGKTTLTLQVIAEMQKTGGQCAFIDAEHALDIQYAQNLGVNLQDLLISQPDTG 156

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD+IV+DSVAALTP+AE+EG+MG+SLPG+QARLMSQALRKLT+ I
Sbjct: 157 EQALEIVDSLVRSGAVDLIVVDSVAALTPKAELEGEMGDSLPGLQARLMSQALRKLTAHI 216

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            ++ C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR G+IK  D   GN+T
Sbjct: 217 KKTNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGTIKKGDVAIGNET 276

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNK+A PFK  EFDI++GEGIS  GE+ID+GV A+I+DKSGAW+++ G+++GQGR
Sbjct: 277 KVKVVKNKVAPPFKTAEFDILFGEGISRQGEIIDMGVNANILDKSGAWYAYNGEKIGQGR 336

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +N++ FLREN  +++ IE+ +R + G+
Sbjct: 337 DNARDFLRENPALSQEIENKVRASLGI 363


>gi|296837401|gb|ADH59559.1| DNA recombinase [Burkholderia contaminans]
          Length = 310

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/310 (70%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 29  KGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTI 88
           KG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  I
Sbjct: 1   KGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVI 59

Query: 89  AQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDI 148
           A+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D+
Sbjct: 60  AELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSIDM 119

Query: 149 IVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIG 208
           IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKIG
Sbjct: 120 IVIDSVAALAPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIG 179

Query: 209 VMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEF 268
           VMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  F
Sbjct: 180 VMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAIF 239

Query: 269 DIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIE 328
           DI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  IE
Sbjct: 240 DILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREIE 299

Query: 329 SLLRQNAGLV 338
           + +R++ G+V
Sbjct: 300 NRIRESLGVV 309


>gi|308212816|gb|ADO21636.1| RecA [Burkholderia arboris]
          Length = 317

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/313 (69%), Positives = 272/313 (86%), Gaps = 1/313 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           + KG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FDKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGLVA 339
           IE+ +R++ G+V+
Sbjct: 300 IENRIRESLGVVS 312


>gi|161788606|emb|CAP18003.2| DNA recombinase [Burkholderia lata]
          Length = 321

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/310 (70%), Positives = 270/310 (87%), Gaps = 1/310 (0%)

Query: 30  GAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIA 89
           G+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  IA
Sbjct: 1   GSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVIA 59

Query: 90  QSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDII 149
           + QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D+I
Sbjct: 60  ELQKIGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSIDMI 119

Query: 150 VIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGV 209
           VIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKIGV
Sbjct: 120 VIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIGV 179

Query: 210 MFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEFD 269
           MFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  FD
Sbjct: 180 MFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAIFD 239

Query: 270 IMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENIES 329
           I+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  IE+
Sbjct: 240 ILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREIEN 299

Query: 330 LLRQNAGLVA 339
            +R++ G+VA
Sbjct: 300 RIRESLGVVA 309


>gi|325983480|ref|YP_004295882.1| recA protein [Nitrosomonas sp. AL212]
 gi|325532999|gb|ADZ27720.1| recA protein [Nitrosomonas sp. AL212]
          Length = 344

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/327 (67%), Positives = 278/327 (85%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           ++SKAL+ AL+QI++ +GKG+IM+LG+    ++ I+VVS+GSLGLDIALG+GG P+GRIV
Sbjct: 4   NRSKALDVALAQIEKQFGKGSIMRLGANDVAYD-IQVVSTGSLGLDIALGVGGLPRGRIV 62

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  IA+ QK GGT AF+DAEHALD  YA+K+GV++K LLISQPD G
Sbjct: 63  EIYGPESSGKTTLTLQVIAEMQKVGGTAAFIDAEHALDPQYAQKIGVNVKELLISQPDNG 122

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI DMLVRSG+VDIIVIDSVAALTPRAEIEGDMG+   G+QARLMSQALRKLT++I
Sbjct: 123 EQALEIADMLVRSGSVDIIVIDSVAALTPRAEIEGDMGDPQMGLQARLMSQALRKLTANI 182

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            RS  +++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR GSIK  D   GN+T
Sbjct: 183 KRSNTMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIKKGDETIGNET 242

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           RVKVVKNK+A PFKQ +FDI+YGEGIS   E+I+LGV   ++DK+GAW+++KG+++GQG+
Sbjct: 243 RVKVVKNKVAPPFKQADFDILYGEGISRESEIIELGVLHKLIDKAGAWYAYKGEKIGQGK 302

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +N + +L+E+ +IA  IE  +R   G+
Sbjct: 303 DNVRDYLKEHKDIALEIEQKIRSIVGI 329


>gi|296837411|gb|ADH59564.1| DNA recombinase [Burkholderia lata]
          Length = 309

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/308 (70%), Positives = 269/308 (87%), Gaps = 1/308 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQN 334
           IE+ +R++
Sbjct: 301 IENRIRES 308


>gi|170664144|gb|ACB28491.1| RecA [Burkholderia cepacia]
 gi|170664146|gb|ACB28492.1| RecA [Burkholderia cepacia]
 gi|170664148|gb|ACB28493.1| RecA [Burkholderia cepacia]
 gi|170664152|gb|ACB28495.1| RecA [Burkholderia cepacia]
 gi|170664156|gb|ACB28497.1| RecA [Burkholderia cepacia]
 gi|170664158|gb|ACB28498.1| RecA [Burkholderia cepacia]
          Length = 310

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 271/311 (87%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKGSIMRMGD-GEAAEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYASKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|126046695|gb|ABN73105.1| RecA [Burkholderia sp. 'isolate BCCU2']
          Length = 308

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/309 (70%), Positives = 269/309 (87%), Gaps = 1/309 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAG 336
           E+ +R++ G
Sbjct: 300 ENRIRESLG 308


>gi|284097292|ref|ZP_06385430.1| recombinase A [Candidatus Poribacteria sp. WGA-A3]
 gi|283831198|gb|EFC35170.1| recombinase A [Candidatus Poribacteria sp. WGA-A3]
          Length = 349

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/326 (66%), Positives = 277/326 (84%), Gaps = 1/326 (0%)

Query: 14  KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73
           KALE A++QI++ +GKG+IM+LG+ G + + ++  S+GSL LD+ALG+GG P+GR+VEI+
Sbjct: 2   KALELAVTQIEKQFGKGSIMKLGT-GDVSDDVQATSTGSLALDLALGVGGLPRGRVVEIF 60

Query: 74  GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133
           GPESSGKTTL LH IA++QKTGG+ AF+DAEHALD  YA+KLGV + +LL++QPDTGEQA
Sbjct: 61  GPESSGKTTLCLHAIAEAQKTGGSAAFIDAEHALDVSYAKKLGVKIDDLLVAQPDTGEQA 120

Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193
           LEI + LVRSGA+D++V+DSVAAL PRAEIEG+MG+S  G+QARLMSQALRKLT +IS+S
Sbjct: 121 LEIAETLVRSGAIDLVVVDSVAALVPRAEIEGEMGDSHMGLQARLMSQALRKLTGAISKS 180

Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253
              +VFINQ+RMKIGVMFG+PETTTGGNALKFYSSVRLDIRR+ SIKD   + G++ RVK
Sbjct: 181 LTTVVFINQIRMKIGVMFGNPETTTGGNALKFYSSVRLDIRRIESIKDGQEVIGSRVRVK 240

Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313
           VVKNK A PF+Q EFDIM+ EG+S  GELIDLGV+  I+DK+GAW+S++ +RLGQGRE  
Sbjct: 241 VVKNKTAPPFRQAEFDIMFAEGVSKVGELIDLGVEKKIIDKAGAWYSYREERLGQGREAV 300

Query: 314 KIFLRENIEIAENIESLLRQNAGLVA 339
           K FL+EN E A+ IE+ +R+ AGL+A
Sbjct: 301 KAFLKENPETAKEIETKIREQAGLLA 326


>gi|296802980|gb|ADH51566.1| DNA recombinase [Burkholderia contaminans]
          Length = 309

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/308 (70%), Positives = 269/308 (87%), Gaps = 1/308 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 2   FGKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 60

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 61  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 120

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 121 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 180

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 181 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 240

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 241 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 300

Query: 327 IESLLRQN 334
           IE+ +R++
Sbjct: 301 IENRIRES 308


>gi|94309411|ref|YP_582621.1| recombinase A [Cupriavidus metallidurans CH34]
 gi|123081425|sp|Q1LR74|RECA_RALME RecName: Full=Protein RecA; AltName: Full=Recombinase A
 gi|93353263|gb|ABF07352.1| DNA strand exchange and recombination protein with protease and
           nuclease activity [Cupriavidus metallidurans CH34]
          Length = 353

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/327 (69%), Positives = 285/327 (87%), Gaps = 1/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KAL AALSQI++ +GKG+IM+LG  G I + I+VVS+GSLGLDIALG+GG P+GR+V
Sbjct: 13  EKQKALAAALSQIEKQFGKGSIMRLGD-GEIEQDIQVVSTGSLGLDIALGVGGLPRGRVV 71

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTL L  +A+ QK GGTCAF+DAEHALD  YA KLGVD+ NLLISQPDTG
Sbjct: 72  EIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAEHALDVQYAGKLGVDVGNLLISQPDTG 131

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEITD LVRSG++D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I
Sbjct: 132 EQALEITDALVRSGSIDLIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTI 191

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
            R+ C+++FINQ+RMKIGVMFGSPETTTGGNALKFY+SVRLDIRR+GSIK  D + GN+T
Sbjct: 192 KRTNCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGSIKKGDEVVGNET 251

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNK++ PF++  FDI+YG+GIS  GE+IDLGV A IV+K+GAW+S+ G+++GQG+
Sbjct: 252 KVKVVKNKVSPPFREAFFDILYGQGISRQGEIIDLGVDAKIVEKAGAWYSYNGEKIGQGK 311

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           +N++ +LREN +IA+ IE+ +R   G+
Sbjct: 312 DNAREYLRENPDIADEIENKVRLALGV 338


>gi|296803024|gb|ADH51588.1| DNA recombinase [Burkholderia contaminans]
 gi|296803072|gb|ADH51612.1| DNA recombinase [Burkholderia contaminans]
          Length = 308

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 219/309 (70%), Positives = 269/309 (87%), Gaps = 1/309 (0%)

Query: 28  GKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHT 87
           GKG+IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L  
Sbjct: 1   GKGSIMRMGD-GEATENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQV 59

Query: 88  IAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147
           IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++D
Sbjct: 60  IAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSID 119

Query: 148 IIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKI 207
           +IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMKI
Sbjct: 120 MIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKI 179

Query: 208 GVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVE 267
           GVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++  
Sbjct: 180 GVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAI 239

Query: 268 FDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAENI 327
           FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  I
Sbjct: 240 FDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIAREI 299

Query: 328 ESLLRQNAG 336
           E+ +R++ G
Sbjct: 300 ENRIRESLG 308


>gi|296837427|gb|ADH59572.1| DNA recombinase [Burkholderia contaminans]
          Length = 310

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 270/311 (86%), Gaps = 1/311 (0%)

Query: 27  YGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALH 86
           +GK +IM++G  G   E I+VVS+GSLGLDIALG+GG P+GR+VEIYGPESSGKTTL L 
Sbjct: 1   FGKASIMRMGD-GEAAENIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQ 59

Query: 87  TIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV 146
            IA+ QK GGT AF+DAEHALD  YA KLGV++  LLISQPDTGEQALEITD LVRSG++
Sbjct: 60  VIAELQKLGGTAAFIDAEHALDVQYAAKLGVNVPELLISQPDTGEQALEITDALVRSGSI 119

Query: 147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMK 206
           D+IVIDSVAAL P+AEIEG+MG+SLPG+QARLMSQALRKLT +I R+ C+++FINQ+RMK
Sbjct: 120 DMIVIDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMK 179

Query: 207 IGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQV 266
           IGVMFG+PETTTGGNALKFYSSVRLDIRR+GSIK  D + GN+TRVKVVKNK++ PF++ 
Sbjct: 180 IGVMFGNPETTTGGNALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREA 239

Query: 267 EFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENSKIFLRENIEIAEN 326
            FDI+YGEGIS  GE+IDLGV+A IVDK+GAW+S+ G+++GQG++N++ FLREN EIA  
Sbjct: 240 IFDILYGEGISRQGEIIDLGVQAKIVDKAGAWYSYNGEKIGQGKDNAREFLRENPEIARE 299

Query: 327 IESLLRQNAGL 337
           IE+ +R++ G+
Sbjct: 300 IENRIRESLGV 310


>gi|160872478|ref|ZP_02062610.1| protein RecA [Rickettsiella grylli]
 gi|159121277|gb|EDP46615.1| protein RecA [Rickettsiella grylli]
          Length = 351

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/323 (67%), Positives = 272/323 (84%), Gaps = 2/323 (0%)

Query: 12  KSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVE 71
           + KAL+ ALSQI++ +G+GA+M+LG    +   ++V+S+GSLGLDIALGIGG P+GRIVE
Sbjct: 8   REKALKMALSQIKKQHGEGAVMRLGDSSRV--SVDVISTGSLGLDIALGIGGLPRGRIVE 65

Query: 72  IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131
           IYGPESSGKTTL L TIA+ QK GG  AFVDAEHALD+ YA KLGV   +LL+SQPDTGE
Sbjct: 66  IYGPESSGKTTLTLQTIAECQKMGGVAAFVDAEHALDANYAEKLGVKKDDLLVSQPDTGE 125

Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSIS 191
           QALEI DMLVRS A+DIIV+DSVAALTPRAEIEG+MG+S  G+QARLMSQALRKL  +I 
Sbjct: 126 QALEIVDMLVRSNAIDIIVVDSVAALTPRAEIEGEMGDSHMGLQARLMSQALRKLAGNIK 185

Query: 192 RSKCILVFINQMRMKIGVMFGS