RPSBLAST alignment for GI: 255764460 and conserved domain: PRK11823

>gnl|CDD|183326 PRK11823, PRK11823, DNA repair protein RadA; Provisional. Length = 446
 Score = 39.7 bits (94), Expect = 0.001
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 48  VSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHAL 107
           +S+G   LD  LG GG   G +V I G    GK+TL L   A+    GG   +V  E + 
Sbjct: 62  ISTGIGELDRVLG-GGLVPGSVVLIGGDPGIGKSTLLLQVAARLAAAGGKVLYVSGEESA 120

Query: 108 DSIY--ARKLGVDLKNLLISQPDTG-EQALEITDMLVRSGAVDIIVIDSV 154
             I   A +LG+   NL +   +T  E  L      +     D++VIDS+
Sbjct: 121 SQIKLRAERLGLPSDNLYLL-AETNLEAILAT----IEEEKPDLVVIDSI 165