RPSBLAST alignment for GI: 255764460 and conserved domain: cd00983

>gnl|CDD|29984 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange.. Length = 325
 Score =  516 bits (1330), Expect = e-147
 Identities = 225/327 (68%), Positives = 277/327 (84%), Gaps = 2/327 (0%)

Query: 11  DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70
           +K KALE AL QI++ +GKG+IM+LG      + +EV+ +GSL LDIALGIGG+PKGRI+
Sbjct: 1   EKQKALELALKQIEKKFGKGSIMKLGDDAV--QDVEVIPTGSLSLDIALGIGGYPKGRII 58

Query: 71  EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130
           EIYGPESSGKTTLALH IA++QK GGT AF+DAEHALD +YA+KLGVDL NLLISQPDTG
Sbjct: 59  EIYGPESSGKTTLALHAIAEAQKLGGTVAFIDAEHALDPVYAKKLGVDLDNLLISQPDTG 118

Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190
           EQALEI D LVRSGAVD+IV+DSVAAL P+AEIEG+MG+S  G+QARLMSQALRKLT SI
Sbjct: 119 EQALEIADSLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGSI 178

Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250
           ++S   ++FINQ+R KIGVMFG+PETTTGGNALKFYSSVRLDIRR+ +IKD D + GN+T
Sbjct: 179 NKSNTTVIFINQLREKIGVMFGNPETTTGGNALKFYSSVRLDIRRIETIKDGDEVIGNRT 238

Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310
           +VKVVKNK+A PFK  EFDI++GEGIS  GE+IDL V+  I+ KSG+W+S+  ++LGQGR
Sbjct: 239 KVKVVKNKVAPPFKTAEFDILFGEGISREGEIIDLAVELGIIKKSGSWYSYGDEKLGQGR 298

Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337
           EN+K +L+EN E+A+ IE  +R+  GL
Sbjct: 299 ENAKEYLKENPELADEIEKKVREKLGL 325