RPSBLAST alignment for GI: 255764460 and conserved domain: cd01120

>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.. Length = 165
 Score = 72.8 bits (178), Expect = 1e-13
 Identities = 40/175 (22%), Positives = 66/175 (37%), Gaps = 18/175 (10%)

Query: 69  IVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYAR----KLGVDLKNLLI 124
           ++ ++GP  SGKTTLAL         GG   +VD E  ++ +  R     L   L NL+I
Sbjct: 1   LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDNLII 60

Query: 125 SQPDTGEQALE----ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180
                 + A        + L   G  D+I++D +  L           E   G     + 
Sbjct: 61  VFATADDPAAARLLSKAERLRERGGDDLIILDELTRLVRALR------EIREGYP-GELD 113

Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRR 235
           + LR+L     +    ++F  Q+          P  T G   L+  +   + + R
Sbjct: 114 EELRELLERARKGGVTVIFTLQVPSGDKGD---PRLTRGAQNLEDIADTVIVLSR 165