RPSBLAST alignment for GI: 255764460 and conserved domain: cd01393

>gnl|CDD|30003 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57. Archaea have the RecA-like homologs radA and radB.. Length = 226
 Score =  235 bits (601), Expect = 2e-62
 Identities = 97/238 (40%), Positives = 126/238 (52%), Gaps = 29/238 (12%)

Query: 48  VSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTG------GTCAFV 101
           +S+GS  LD  LG GG P GRI EI+G   SGKT L L    ++Q  G      G   ++
Sbjct: 1   ISTGSKALDELLG-GGIPTGRITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYI 59

Query: 102 DAEHALDSIYARKLGVD--------LKNLLISQPDTGEQALEITDMLVR---SGAVDIIV 150
           D E A       +L V         L N+ +++P  GEQ LEI + L R   SG VD++V
Sbjct: 60  DTEGAFRPERLVQLAVRFGLDPEEVLDNIYVARPYNGEQQLEIVEELERIMSSGRVDLVV 119

Query: 151 IDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVM 210
           +DSVAAL  +  I   M       +ARL+SQALRKL     +    +VF NQ+R K+ VM
Sbjct: 120 VDSVAALFRKEFIGRGM----LAERARLLSQALRKLLRLADKFNVAVVFTNQVRAKVDVM 175

Query: 211 FGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEF 268
           FG PET  GGNAL   S+ RLD+R+         I G +   KVVK+  A P  + EF
Sbjct: 176 FGDPETPAGGNALAHASTTRLDLRKGR------GIIGERRIAKVVKSP-ALPEAEAEF 226