RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62] (363 letters) >gnl|CDD|143922 pfam00154, RecA, recA bacterial DNA recombination protein. RecA is a DNA-dependent ATPase and functions in DNA repair systems. RecA protein catalyses an ATP-dependent DNA strand-exchange reaction that is the central step in the repair of dsDNA breaks by homologous recombination. Length = 322 Score = 594 bits (1533), Expect = e-170 Identities = 236/324 (72%), Positives = 284/324 (87%), Gaps = 2/324 (0%) Query: 14 KALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIY 73 KALEAALSQI++ +GKG+IM+LG + E +EV+S+GSLGLDIALGIGG PKGRI+EIY Sbjct: 1 KALEAALSQIEKQFGKGSIMRLGDKTV--EDVEVISTGSLGLDIALGIGGLPKGRIIEIY 58 Query: 74 GPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQA 133 GPESSGKTTLALH IA++QK GGT AF+DAEHALD +YA+KLGVD+ NLL+SQPDTGEQA Sbjct: 59 GPESSGKTTLALHAIAEAQKAGGTAAFIDAEHALDPVYAKKLGVDIDNLLVSQPDTGEQA 118 Query: 134 LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRS 193 LEI DMLVRSGAVD+IV+DSVAAL P+AEIEG+MG+S G+QARLMSQALRKLT +IS+S Sbjct: 119 LEIADMLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGNISKS 178 Query: 194 KCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVK 253 ++FINQ+RMKIGVMFG+PETTTGGNALKFY+SVRLDIRR+G+IK + + GN+T+VK Sbjct: 179 NTTVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKKGEEVIGNRTKVK 238 Query: 254 VVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGRENS 313 VVKNK+A PFKQ EFDIMYGEGIS GELIDLGVK IV+KSGAW+S+ G+++GQGREN+ Sbjct: 239 VVKNKVAPPFKQAEFDIMYGEGISKEGELIDLGVKLGIVEKSGAWYSYNGEKIGQGRENA 298 Query: 314 KIFLRENIEIAENIESLLRQNAGL 337 K +L+EN EIA IE +R+ GL Sbjct: 299 KQYLKENPEIAAEIEQKIREKLGL 322 >gnl|CDD|29984 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange.. Length = 325 Score = 516 bits (1330), Expect = e-147 Identities = 225/327 (68%), Positives = 277/327 (84%), Gaps = 2/327 (0%) Query: 11 DKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIV 70 +K KALE AL QI++ +GKG+IM+LG + +EV+ +GSL LDIALGIGG+PKGRI+ Sbjct: 1 EKQKALELALKQIEKKFGKGSIMKLGDDAV--QDVEVIPTGSLSLDIALGIGGYPKGRII 58 Query: 71 EIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTG 130 EIYGPESSGKTTLALH IA++QK GGT AF+DAEHALD +YA+KLGVDL NLLISQPDTG Sbjct: 59 EIYGPESSGKTTLALHAIAEAQKLGGTVAFIDAEHALDPVYAKKLGVDLDNLLISQPDTG 118 Query: 131 EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSI 190 EQALEI D LVRSGAVD+IV+DSVAAL P+AEIEG+MG+S G+QARLMSQALRKLT SI Sbjct: 119 EQALEIADSLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTGSI 178 Query: 191 SRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQT 250 ++S ++FINQ+R KIGVMFG+PETTTGGNALKFYSSVRLDIRR+ +IKD D + GN+T Sbjct: 179 NKSNTTVIFINQLREKIGVMFGNPETTTGGNALKFYSSVRLDIRRIETIKDGDEVIGNRT 238 Query: 251 RVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWFSFKGQRLGQGR 310 +VKVVKNK+A PFK EFDI++GEGIS GE+IDL V+ I+ KSG+W+S+ ++LGQGR Sbjct: 239 KVKVVKNKVAPPFKTAEFDILFGEGISREGEIIDLAVELGIIKKSGSWYSYGDEKLGQGR 298 Query: 311 ENSKIFLRENIEIAENIESLLRQNAGL 337 EN+K +L+EN E+A+ IE +R+ GL Sbjct: 299 ENAKEYLKENPELADEIEKKVREKLGL 325 >gnl|CDD|30816 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair]. Length = 279 Score = 296 bits (759), Expect = 6e-81 Identities = 174/286 (60%), Positives = 213/286 (74%), Gaps = 12/286 (4%) Query: 6 EMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFP 65 +D+ KALEAAL+QI++ +GKG+IM LG E IE +S+GSL LD ALG GG P Sbjct: 1 MAQGIDEEKALEAALAQIEKAFGKGSIMALGGD-ERREDIEAISTGSLALDEALG-GGLP 58 Query: 66 KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVD-LKNLLI 124 +GRI EIYGPESSGKTTLAL +A +QK GG AF+D EHALD A++LGVD L NLL+ Sbjct: 59 RGRITEIYGPESSGKTTLALQLVANAQKPGGKAAFIDTEHALDPERAKQLGVDLLDNLLV 118 Query: 125 SQPDTGEQALEITDMLVRSGA--VDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQA 182 SQPDTGEQ LEI + L RSGA +D++V+DSVAAL EIE + G++ARL+S+A Sbjct: 119 SQPDTGEQQLEIAEKLARSGAEKIDLLVVDSVAALVRAEEIE----DGHLGLRARLLSKA 174 Query: 183 LRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDK 242 LRKLT ++ ++F NQ+R KIGVMFG PETTTGGNALKFY+SVRLD+RR+ S+K+ Sbjct: 175 LRKLTRLANKYNTAVIFTNQVRAKIGVMFGDPETTTGGNALKFYASVRLDLRRIESLKED 234 Query: 243 DSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVK 288 GN+ RVKVVKNK+A PFK+ EFDI YG GI GELIDLGVK Sbjct: 235 ---VGNKRRVKVVKNKVAPPFKEAEFDITYGGGIDREGELIDLGVK 277 >gnl|CDD|30003 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57. Archaea have the RecA-like homologs radA and radB.. Length = 226 Score = 235 bits (601), Expect = 2e-62 Identities = 97/238 (40%), Positives = 126/238 (52%), Gaps = 29/238 (12%) Query: 48 VSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTG------GTCAFV 101 +S+GS LD LG GG P GRI EI+G SGKT L L ++Q G G ++ Sbjct: 1 ISTGSKALDELLG-GGIPTGRITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYI 59 Query: 102 DAEHALDSIYARKLGVD--------LKNLLISQPDTGEQALEITDMLVR---SGAVDIIV 150 D E A +L V L N+ +++P GEQ LEI + L R SG VD++V Sbjct: 60 DTEGAFRPERLVQLAVRFGLDPEEVLDNIYVARPYNGEQQLEIVEELERIMSSGRVDLVV 119 Query: 151 IDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVM 210 +DSVAAL + I M +ARL+SQALRKL + +VF NQ+R K+ VM Sbjct: 120 VDSVAALFRKEFIGRGM----LAERARLLSQALRKLLRLADKFNVAVVFTNQVRAKVDVM 175 Query: 211 FGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQVEF 268 FG PET GGNAL S+ RLD+R+ I G + KVVK+ A P + EF Sbjct: 176 FGDPETPAGGNALAHASTTRLDLRKGR------GIIGERRIAKVVKSP-ALPEAEAEF 226 >gnl|CDD|36646 KOG1433, KOG1433, KOG1433, DNA repair protein RAD51/RHP55 [Replication, recombination and repair]. Length = 326 Score = 131 bits (330), Expect = 4e-31 Identities = 66/334 (19%), Positives = 115/334 (34%), Gaps = 20/334 (5%) Query: 7 MNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSI-FEGIEVVSSGSLGLDIALGIGGFP 65 M + K AL+ AL +I A ++ G I E + ++S G L L G Sbjct: 1 MRMSQKRLALQKALEEIG---LSPAPVRFLLAGGITAEDVLLLSEGELSTVEGLAYAGKE 57 Query: 66 KGRIVEIYGPESSGKTTLALHTIAQS-QKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124 + ++ SGKT L LH + Q ALD + + L+ Sbjct: 58 ELLLIIGLSEAKSGKTVLGLHKLVPMLQLRSELGFLSTGSKALDKLLGGGIETGSLTELV 117 Query: 125 SQPDTGEQALEITD-MLVRSGAVDIIVIDSVA--ALTPRAEIEGDMGESLPGMQARLMSQ 181 P +G+ L T + G ++ ID+ + L EI G G + LM Sbjct: 118 GPPGSGKTQLCHTLAVTCGGGEGKVLYIDTESTFRLERLTEIAGRSGLRGRDTLSNLMLA 177 Query: 182 ALRKLTSSISRSKCILVFINQMRMKIGVM--FGSPETTTGGNALKFYSSVRLDIRRVGSI 239 L + + + INQ R+K+ ++ + TT + + L + + S+ Sbjct: 178 RAYNLDHQLQLIQEAEIMINQSRVKLLIVDSATALYRTTFKGRGELSARQMLLAKFLRSL 237 Query: 240 KDKDSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGVKASIVDKSGAWF 299 K G V+ N++ + IM+G + ++ + G Sbjct: 238 KKLADEFGVAV---VITNQVTAQVDGA---IMFGS--DPKKPIGGNIWAHAVTTRLGLRK 289 Query: 300 SFKGQRLGQGRENSKIFLRENIEIAENIESLLRQ 333 KG+R + L E + E + Sbjct: 290 G-KGERR-ICKIADSPCLPEAEAVFAITEDGISD 321 >gnl|CDD|29989 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .. Length = 235 Score = 74.1 bits (182), Expect = 6e-14 Identities = 66/252 (26%), Positives = 107/252 (42%), Gaps = 39/252 (15%) Query: 48 VSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQK------TGGTCAFV 101 +++GS LD LG GG G I EI+G SGKT L Q G ++ Sbjct: 1 LTTGSKALDELLG-GGIETGSITEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYI 59 Query: 102 DAEHA-----LDSIYARKLGVDLKNLL----ISQPDTGEQALEITD----MLVRSGAVDI 148 D E L I A + G+D + +L +++ + L++ + +L+ S + + Sbjct: 60 DTEGTFRPERLVQI-AERFGLDPEEVLDNIYVARAYNSDHQLQLLEELEAILIESSRIKL 118 Query: 149 IVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIG 208 +++DSV AL RAE +G GE + + +++ LR L +V NQ+ + Sbjct: 119 VIVDSVTALF-RAEFDG-RGEL--AERQQHLAKLLRTLKRLADEFNVAVVITNQVTARPD 174 Query: 209 VM---FGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMASPFKQ 265 G P+ GGN S+ RL +R+ G + K+V + P + Sbjct: 175 GAAMFGGDPKKPAGGNIWAHASTTRLYLRKGR---------GEERIAKIVDSPHL-PEGE 224 Query: 266 VEFDIMYGEGIS 277 F I EGI Sbjct: 225 AVFAI-TEEGIR 235 >gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.. Length = 165 Score = 72.8 bits (178), Expect = 1e-13 Identities = 40/175 (22%), Positives = 66/175 (37%), Gaps = 18/175 (10%) Query: 69 IVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYAR----KLGVDLKNLLI 124 ++ ++GP SGKTTLAL GG +VD E ++ + R L L NL+I Sbjct: 1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDNLII 60 Query: 125 SQPDTGEQALE----ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMS 180 + A + L G D+I++D + L E G + Sbjct: 61 VFATADDPAAARLLSKAERLRERGGDDLIILDELTRLVRALR------EIREGYP-GELD 113 Query: 181 QALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRR 235 + LR+L + ++F Q+ P T G L+ + + + R Sbjct: 114 EELRELLERARKGGVTVIFTLQVPSGDKGD---PRLTRGAQNLEDIADTVIVLSR 165 >gnl|CDD|30004 cd01394, radB, RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.. Length = 218 Score = 62.3 bits (151), Expect = 2e-10 Identities = 53/206 (25%), Positives = 90/206 (43%), Gaps = 32/206 (15%) Query: 48 VSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHAL 107 + +G GLD LG GG +G + ++YGP +GKT +A+ ++ G A++D E Sbjct: 1 LPTGCKGLDELLG-GGVERGTVTQVYGPPGTGKTNIAIQLAVETAGQGKKVAYIDTEGLS 59 Query: 108 DSIYARKLGVD----LKNLLISQP-DTGEQALEITDM--LVRSGAVDIIVIDSVAALTPR 160 + + G ++++ +P D EQ I + VD++V+DS AL R Sbjct: 60 SERFRQIAGDRPERAASSIIVFEPMDFNEQGRAIQETETFADE-KVDLVVVDSATALY-R 117 Query: 161 AEIEGDMGESLPGMQARLMSQALRKLTSSIS-------RSKCILVFINQMRMKIGVMFGS 213 E+ D + R+L ++ + +V NQ+ +G Sbjct: 118 LELGDD----------DTTIKNYRELAKQLTFLLWLARKHDVAVVITNQVYSDVGSGSVR 167 Query: 214 PETTTGGNALKFYSSV--RLDIRRVG 237 P GG+ L+ +S V RL+ RVG Sbjct: 168 P---LGGHTLEHWSKVILRLEKLRVG 190 >gnl|CDD|30815 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]. Length = 260 Score = 53.6 bits (128), Expect = 9e-08 Identities = 56/262 (21%), Positives = 99/262 (37%), Gaps = 49/262 (18%) Query: 45 IEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE 104 +E + +G GLD LG GG P+G +V I GP +GKT AL + + + G +V E Sbjct: 2 MERIPTGIPGLDEILG-GGLPRGSVVLITGPPGTGKTIFALQFLYEGAREGEPVLYVSTE 60 Query: 105 HALDSIY--ARKLGVDLKNLL---------------------ISQPDTGEQALEITDMLV 141 + + + AR G DL+ + + P E+ L+ +V Sbjct: 61 ESPEELLENARSFGWDLEVYIEKGKLAILDAFLSEKGLVSIVVGDPLDLEELLDRIREIV 120 Query: 142 RSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201 D +VIDS+ LT + + P + R++ L + + + Sbjct: 121 EKEGADRVVIDSITELT--------LYLNDPALVRRIL----LLLKRFLKKLGVTSLLTT 168 Query: 202 QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNKMAS 261 + + +G +RLD++ + D+ + + R K+ Sbjct: 169 EAPV-------EERGESGVEEYIVDGVIRLDLKEIEGGGDRRYLRILKMRGTPHSLKV-- 219 Query: 262 PFKQVEFDIMYGEGISFFGELI 283 + F+I GEGI + E Sbjct: 220 ----IPFEITDGEGIVVYPEGR 237 >gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.. Length = 372 Score = 47.9 bits (114), Expect = 4e-06 Identities = 36/114 (31%), Positives = 54/114 (47%), Gaps = 7/114 (6%) Query: 43 EGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVD 102 E E + +G LD LG GG G ++ I G GK+TL L A+ K GG +V Sbjct: 59 EEEERIPTGIEELDRVLG-GGLVPGSVILIGGDPGIGKSTLLLQVAARLAKRGGKVLYVS 117 Query: 103 AEHALDSI--YARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSV 154 E + + I A +LG+ +NL + E LE + D+++IDS+ Sbjct: 118 GEESPEQIKLRADRLGISTENLYL----LAETNLEDILASIEELKPDLVIIDSI 167 >gnl|CDD|36777 KOG1564, KOG1564, KOG1564, DNA repair protein RHP57 [Replication, recombination and repair]. Length = 351 Score = 47.7 bits (113), Expect = 5e-06 Identities = 42/186 (22%), Positives = 69/186 (37%), Gaps = 33/186 (17%) Query: 46 EVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQ------KTGGTCA 99 +++G + LD L GG P I EI G GKT L L Q GG Sbjct: 82 SKLTTGCVALDECLR-GGIPTDGITEICGESGCGKTQLLLQLSLCVQLPRSHGGLGGGAV 140 Query: 100 FVDAE--------HALDSIYARKLGVDLKNLLISQPDTG---------EQALEITD---- 138 ++ E H L ++ + + P + L I + Sbjct: 141 YICTESPFPTRRLHQLSHTLPQRPNPEKELNYNDNPGDHIFVENVHDVDHLLHIVNRQLP 200 Query: 139 MLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLP-GMQARLMSQALRKLTSSISRSKCIL 197 +L+ + +++IDSVAAL R+E + + + ++ LR+L S + Sbjct: 201 ILLNRKKIKLVIIDSVAALF-RSEFDYNPSDLKKRARHLFRLAGKLRQLASKFD---LAV 256 Query: 198 VFINQM 203 V NQ+ Sbjct: 257 VCANQV 262 >gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]. Length = 456 Score = 47.1 bits (112), Expect = 8e-06 Identities = 44/143 (30%), Positives = 63/143 (44%), Gaps = 16/143 (11%) Query: 48 VSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHAL 107 +S+G LD LG GG G ++ I G GK+TL L A+ K G +V E +L Sbjct: 75 ISTGIEELDRVLG-GGLVPGSVILIGGDPGIGKSTLLLQVAARLAKR-GKVLYVSGEESL 132 Query: 108 DSIYAR--KLGVDLKNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEG 165 I R +LG+ NL + E LE + D++VIDS+ L Sbjct: 133 QQIKLRADRLGLPTNNLYL----LAETNLEDIIAELEQEKPDLVVIDSIQTLY------S 182 Query: 166 DMGESLPG--MQARLMSQALRKL 186 + S PG Q R ++ L +L Sbjct: 183 EEITSAPGSVSQVREVAAELMRL 205 >gnl|CDD|36647 KOG1434, KOG1434, KOG1434, Meiotic recombination protein Dmc1 [Energy production and conversion, Replication, recombination and repair]. Length = 335 Score = 46.5 bits (110), Expect = 1e-05 Identities = 58/210 (27%), Positives = 94/210 (44%), Gaps = 28/210 (13%) Query: 48 VSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQK-------TGGTCAF 100 +++GS LD LG GG P I EI+G GKT L+ HT+ + + GG F Sbjct: 97 ITTGSSALDDILG-GGIPSMSITEIFGEFRCGKTQLS-HTLCVTVQLPREMGGVGGKAIF 154 Query: 101 VDAEHAL--DSI--YARKLGVD----LKNLLISQPDTGEQALEITDML----VRSGAVDI 148 +D E D I A + VD L N+L + E+ +E+ +L G + Sbjct: 155 IDTEGTFRPDRIKDIAERFKVDPDFTLDNILYFRAYNSEEQMELVYLLGDFLSEHGKYRL 214 Query: 149 IVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIG 208 +++DS+ AL R + +G S + + ++Q L+KL + NQ+ G Sbjct: 215 VIVDSIMALF-RVDYDGRGELSE---RQQKLNQMLQKLNKLAEEFNVAVFLTNQVTTDPG 270 Query: 209 --VMFGS-PETTTGGNALKFYSSVRLDIRR 235 + F S GG++ S+ RL +R+ Sbjct: 271 AGMTFASQDLKPAGGHSWAHASTTRLILRK 300 >gnl|CDD|32701 COG2874, FlaH, Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 235 Score = 35.2 bits (81), Expect = 0.026 Identities = 30/142 (21%), Positives = 56/142 (39%), Gaps = 18/142 (12%) Query: 39 GSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTC 98 + E +++ SG+ LD LG GG P G ++ I G +GK+ L+ G Sbjct: 1 MMVEELKKIIKSGNDELDKRLG-GGIPVGSLILIEGDNGTGKSVLSQRFAYGFLMNGYRV 59 Query: 99 AFVDAEHALDSIYAR--KLGVDLKNLLISQ---------------PDTGEQALEITDMLV 141 +V E + + L D+ + L+S + + L++ + Sbjct: 60 TYVSTELTVREFIKQMESLSYDVSDFLLSGRLLFFPVNLEPVNWGRRSARKLLDLLLEFI 119 Query: 142 RSGAVDIIVIDSVAALTPRAEI 163 + D+I+IDS++A Sbjct: 120 KRWEKDVIIIDSLSAFATYDSE 141 >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151 Score = 35.2 bits (81), Expect = 0.029 Identities = 25/136 (18%), Positives = 45/136 (33%), Gaps = 26/136 (19%) Query: 65 PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124 P + + +YGP +GKTTLA + + G +++A DL L+ Sbjct: 17 PPPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNAS-------------DLLEGLV 63 Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALR 184 G + + L ++ ID + +L+ A Q L+ Sbjct: 64 VAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLSRGA-------------QNALLRVLET 110 Query: 185 KLTSSISRSKCILVFI 200 I R ++ Sbjct: 111 LNDLRIDRENVRVIGA 126 >gnl|CDD|29990 cd01124, KaiC, KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.. Length = 187 Score = 34.9 bits (80), Expect = 0.036 Identities = 36/168 (21%), Positives = 57/168 (33%), Gaps = 34/168 (20%) Query: 69 IVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIY--ARKLGVDLK------ 120 + G +GKTT AL + G +V E + + + A LG DL+ Sbjct: 1 STLLSGGPGTGKTTFALQFLYAGLARGEPGLYVTLEESPEELIENAESLGWDLERLEDEG 60 Query: 121 NLLISQPDTG-----------EQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGE 169 L I D E + D + A +VIDSV+ L + Sbjct: 61 LLAIVDADPDEIGPAESSLRLELIQRLKDAIEEFKA-KRVVIDSVSGLLLMEQS------ 113 Query: 170 SLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETT 217 ARL +R+L ++ R + ++ G FG + Sbjct: 114 -----TARLE---IRRLLFALKRFGVTTLLTSEQSGLEGTGFGGGDVE 153 >gnl|CDD|29988 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.. Length = 271 Score = 31.8 bits (72), Expect = 0.28 Identities = 36/235 (15%), Positives = 73/235 (31%), Gaps = 49/235 (20%) Query: 62 GGFPKGRIVEIYGPESSGKTTL----ALHTIAQSQKTGGTCAF----------------- 100 G KG ++ + GKTT AL I Q GT + Sbjct: 25 KGLRKGELIILTAGTGVGKTTFLREYALDLITQHGVRVGTISLEEPVVRTARRLLGQYAG 84 Query: 101 ----------VDAEHALDSIYARKLGVDLKNLLISQPDTG-EQALEITDMLVRSGAVDII 149 + D+ + G + S + + LE + S + I Sbjct: 85 KRLHLPDTVFIYTLEEFDAAFDEFEGTGRLFMYDSFGEYSMDSVLEKVRYMAVSHGIQHI 144 Query: 150 VIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRM---K 206 +ID+++ + GD +M+ LR + + ++ +R Sbjct: 145 IIDNLSIMVSDERASGDE----RKALDEIMT-KLRGFA---TEHGIHITLVSHLRRPDGD 196 Query: 207 IGVMFGSPETTT---GGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKNK 258 G + + G A+ + + + R + + N T ++++KN+ Sbjct: 197 KTHEEGGEVSLSDFRGSAAIGQLADNVIALERN---QQAELDERNTTYLRILKNR 248 >gnl|CDD|31663 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]. Length = 366 Score = 31.9 bits (72), Expect = 0.29 Identities = 22/99 (22%), Positives = 39/99 (39%), Gaps = 13/99 (13%) Query: 72 IYGPESSGKTTLALHTI--AQSQKTGGTCAFVDAEHA--LDSIYARKLGVDLKNLLISQP 127 IYGP +GKT + + +++ + ++ + N L P Sbjct: 47 IYGPTGTGKTATVKFVMEELEESSANVEVVYINCLELRTPYQVLSK-----ILNKLGKVP 101 Query: 128 DTGEQALEITDMLVRS----GAVDIIVIDSVAALTPRAE 162 TG+ +LEI L + G I+++D V AL + Sbjct: 102 LTGDSSLEILKRLYDNLSKKGKTVIVILDEVDALVDKDG 140 >gnl|CDD|30527 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair]. Length = 935 Score = 31.7 bits (72), Expect = 0.30 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTI-AQSQK 93 P+ ++V I G SGK++LA TI A+ Q+ Sbjct: 23 IPRNKLVVITGLSGSGKSSLAFDTIYAEGQR 53 >gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 31.8 bits (72), Expect = 0.33 Identities = 27/142 (19%), Positives = 52/142 (36%), Gaps = 7/142 (4%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAF--VDAEHALDSIYARKLGVDLKN 121 G ++ I GP +GK+TL + G V AR V +N Sbjct: 24 LRPGEVLAILGPNGAGKSTLLKALSGELSPDSGEVTLNGVPLNSWPPEELARHRAVLPQN 83 Query: 122 LLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLP----GMQAR 177 ++ P T ++ +++ + RSG A ++ G G G Q R Sbjct: 84 SSLAFPFTVQEVVQMGRIPHRSGREPEEDERIAAQALAATDLSGLAGRDYRTLSGGEQQR 143 Query: 178 L-MSQALRKLTSSISRSKCILV 198 + +++ L +L + + + + Sbjct: 144 VQLARVLAQLWPPVPSGRWLFL 165 >gnl|CDD|30727 COG0378, HypB, Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]. Length = 202 Score = 31.7 bits (72), Expect = 0.33 Identities = 21/101 (20%), Positives = 38/101 (37%), Gaps = 9/101 (8%) Query: 68 RIVEIYGPESSGKTTLALHTIAQSQK-------TGGTCAFVDAEHALDSIYARKLGVDLK 120 + + GP SGKT L T+ + TG DA+ +GV+ Sbjct: 14 LRIGVGGPPGSGKTALIEKTLRALKDEYKIAVITGDIYTKEDADRLRKLPGEPIIGVETG 73 Query: 121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRA 161 +A+E ++++ +D++ I+SV L Sbjct: 74 KGCHLDASMNLEAIE--ELVLDFPDLDLLFIESVGNLVCPF 112 >gnl|CDD|145008 pfam01637, Arch_ATPase, Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family. Length = 223 Score = 31.5 bits (72), Expect = 0.38 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 10/94 (10%) Query: 68 RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDA-----EHALDSIY-----ARKLGV 117 I+ +YGP GKT L + + ++ G + D E LD A LG Sbjct: 21 PIIVVYGPRRCGKTALLREFLEELRELGYRVIYYDPLRREFEEKLDRFEEAKRLAEALGD 80 Query: 118 DLKNLLISQPDTGEQALEITDMLVRSGAVDIIVI 151 L + I++ +L + L++ I +I Sbjct: 81 ALPKIGIAKSKLAFLSLTLLFELLKRKGKKIAII 114 >gnl|CDD|38070 KOG2859, KOG2859, KOG2859, DNA repair protein, member of the recA/RAD51 family [Replication, recombination and repair]. Length = 293 Score = 31.6 bits (71), Expect = 0.39 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 12/82 (14%) Query: 67 GRIVEIYGPESSGKTTLALHTIAQ---SQKTGG---TCAFVDAEHALD------SIYARK 114 G +VEI GP +SGKT + +A +K GG + F+D +H D S+ R Sbjct: 38 GTLVEISGPGNSGKTLVLQQLVAHCILPKKFGGLQWSVLFIDLDHKFDRLRLAKSLRHRL 97 Query: 115 LGVDLKNLLISQPDTGEQALEI 136 + ++ ++ T EQ EI Sbjct: 98 KQYSVGEVIAAKCPTEEQLEEI 119 >gnl|CDD|48448 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.. Length = 227 Score = 31.4 bits (71), Expect = 0.42 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Query: 292 VDKSGAWFSFKGQRLGQGRENSKIFLR----ENIEIAENIESLL 331 VD SG++F++K +G+ N+K FL E++E+ + I + + Sbjct: 144 VDPSGSYFTWKATAIGKNYSNAKTFLEKRYNEDLELEDAIHTAI 187 >gnl|CDD|29985 cd00984, DnaB_C, DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.. Length = 242 Score = 31.3 bits (71), Expect = 0.44 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 13/107 (12%) Query: 61 IGGFPKGRIVEIYGPESSGKTTLALHTIAQS--QKTGGTCAFVDAEHALDSIYARKL--- 115 GG G ++ I S GKT AL+ IA++ +K G F E + + + R L Sbjct: 7 TGGLQPGDLIIIAARPSMGKTAFALN-IAENIAKKQGKPVLFFSLEMSKEQLLQRLLASE 65 Query: 116 -GVDLKNLLISQ--PDTGEQALEITDMLVRSGAVDIIVIDSVAALTP 159 G+ L L + E+ E L I ID ++LT Sbjct: 66 SGISLSKLRTGSLSDEDWERLAEAIGELKELP----IYIDDSSSLTV 108 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 31.2 bits (71), Expect = 0.50 Identities = 18/60 (30%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAF--VDAEHALDSIYARKLGVDLKN 121 KG V I GP SGK+TL T G D RK+G+ +N Sbjct: 24 IKKGEFVLIVGPNGSGKSTLLRLLNGLLGPTSGEVLVDGKDLTKLSLKELRRKVGLVFQN 83 >gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.. Length = 180 Score = 31.2 bits (71), Expect = 0.51 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQK 93 G IV I GP +GK+TL L T+A K Sbjct: 22 IEAGEIVGILGPNGAGKSTL-LKTLAGLLK 50 >gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 239 Score = 31.0 bits (70), Expect = 0.59 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQ-SQKTGGTCAFVDAEHALDSIYARKLG 116 P G +V + GP SGKTTL L IA + GT F + + R +G Sbjct: 25 IPSGELVALLGPSGSGKTTL-LRLIAGLERPDSGTILFGGEDATDVPVQERNVG 77 >gnl|CDD|32985 COG3172, NadR, Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]. Length = 187 Score = 30.7 bits (69), Expect = 0.67 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 68 RIVEIYGPESSGKTTLA 84 + V I G ESSGK+TL Sbjct: 9 KTVAILGGESSGKSTLV 25 >gnl|CDD|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 204 Score = 30.4 bits (69), Expect = 0.72 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGT 97 PKG +V I GP SGK++L + + +K G+ Sbjct: 28 VPKGELVAIVGPVGSGKSSLLSALLGELEKLSGS 61 >gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]. Length = 258 Score = 30.5 bits (69), Expect = 0.74 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQK 93 PKG I I GP SGK+TL L +A K Sbjct: 25 IPKGEITGILGPNGSGKSTL-LKCLAGLLK 53 >gnl|CDD|73029 cd03270, ABC_UvrA_I, The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 226 Score = 30.5 bits (69), Expect = 0.75 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTI-AQSQK 93 P+ ++V I G SGK++LA TI A+ Q+ Sbjct: 18 IPRNKLVVITGVSGSGKSSLAFDTIYAEGQR 48 >gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1391 Score = 30.6 bits (69), Expect = 0.75 Identities = 29/132 (21%), Positives = 47/132 (35%), Gaps = 13/132 (9%) Query: 62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCA---FVDAEHALDSIYARKLGVD 118 G F G + + G +GKTTL L +A +KTGG + +AR G Sbjct: 812 GAFKPGVLTALMGESGAGKTTL-LDVLAG-RKTGGYIEGDILISGFPKDQETFARVSGYV 869 Query: 119 LKNLLISQPDTGEQALEITDMLVRSGAVDI--------IVIDSVAALTPRAEIEGDMGES 170 + + S T ++L + L V VI+ + + G G Sbjct: 870 EQQDIHSPELTVRESLRFSAALRLPKEVSDEEKYEYVEEVIELLELKEYADALVGLPGSG 929 Query: 171 LPGMQARLMSQA 182 L Q + ++ Sbjct: 930 LSTEQRKRLTIG 941 >gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.. Length = 218 Score = 30.5 bits (69), Expect = 0.77 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 8/61 (13%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQK-TGGTCAFVD------AEHALDSIYARKLG 116 KG V I GP SGK+TL L+ + + T G +E L + R +G Sbjct: 27 IEKGEFVAIVGPSGSGKSTL-LNILGGLDRPTSGEVRVDGTDISKLSEKELAAFRRRHIG 85 Query: 117 V 117 Sbjct: 86 F 86 >gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 345 Score = 30.3 bits (68), Expect = 0.84 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 8/66 (12%) Query: 56 DIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDS----IY 111 DI+L I G +V + GP +GK+TL L IA + ++ D + Sbjct: 20 DISLDI---KSGELVALLGPSGAGKSTL-LRIIAGLETPDAGRIRLNGRVLFDVSNLAVR 75 Query: 112 ARKLGV 117 RK+G Sbjct: 76 DRKVGF 81 >gnl|CDD|33754 COG3973, COG3973, Superfamily I DNA and RNA helicases [General function prediction only]. Length = 747 Score = 30.4 bits (68), Expect = 0.91 Identities = 13/26 (50%), Positives = 18/26 (69%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIA 89 F K +I+ + G SGKTT+ALH +A Sbjct: 223 FEKNKILVVQGAAGSGKTTIALHRVA 248 >gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235 Score = 30.1 bits (68), Expect = 0.92 Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGT 97 +G I+ I GP SGK+TL + + G Sbjct: 23 VRRGEILAIIGPSGSGKSTLLRLIVGLLRPDSGE 56 >gnl|CDD|30598 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair]. Length = 843 Score = 30.3 bits (68), Expect = 0.92 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Query: 65 PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHA----LDSIYAR 113 RI+ I GP GK+T L +A +FV AE A +D I+ R Sbjct: 605 GNRRIILITGPNMGGKSTY-LRQVALIVILAQIGSFVPAEKARIGIVDRIFTR 656 >gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 226 Score = 30.1 bits (68), Expect = 0.97 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQK-TGGTCAF 100 G V I GP SGK+TL L+ + K T G Sbjct: 28 IEAGEFVAIVGPSGSGKSTL-LNLLGGLDKPTSGEVLI 64 >gnl|CDD|30201 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).. Length = 179 Score = 30.3 bits (68), Expect = 1.0 Identities = 29/146 (19%), Positives = 44/146 (30%), Gaps = 32/146 (21%) Query: 69 IVEIYGPESSGKTTLALHTIAQSQKTGGTCAFV----------DAEHALDSIY--ARKLG 116 +V I GP SGKTT A ++ + G V D Y L Sbjct: 1 VVGIAGPSGSGKTTFA-KKLSNQLRVNGIGPVVISLDDYYVPRKTPRDEDGNYDFESILD 59 Query: 117 VDLKNLLISQPDTG-EQALEITDMLVRSG---------AVDIIVIDSVAALTPRAEIEGD 166 +DL N + G E L I D +++++ + AL R Sbjct: 60 LDLLNKNLHDLLNGKEVELPIYDFRTGKRRGYRKLKLPPSGVVILEGIYALNERLR---- 115 Query: 167 MGESLPGMQARLMSQALRKLTSSISR 192 + R+ L + R Sbjct: 116 -----SLLDIRVAVSGGVHLNRLLRR 136 >gnl|CDD|73002 cd03243, ABC_MutS_homologs, The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA structures or lesions results in ADP/ATP exchange.. Length = 202 Score = 30.2 bits (68), Expect = 1.0 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHA----LDSIYAR 113 GR++ I GP GK+T L +I + FV AE A +D I+ R Sbjct: 26 LGSGRLLLITGPNMGGKSTY-LRSIGLAVLLAQIGCFVPAESASIPLVDRIFTR 78 >gnl|CDD|38335 KOG3125, KOG3125, KOG3125, Thymidine kinase [Nucleotide transport and metabolism]. Length = 234 Score = 30.0 bits (67), Expect = 1.1 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 9/91 (9%) Query: 66 KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFV----DAEHALDSIYARKLGVDLKN 121 +G I I GP SGKTT L I + G + D + SI G+++ Sbjct: 26 RGTIHVILGPMFSGKTTELLRRIRREIIAGRRVLLIKYAKDTRYESSSIVTHD-GIEMPC 84 Query: 122 LLISQPDTGEQALEITDMLVRSGAVDIIVID 152 + PD + D L +G VD+I ID Sbjct: 85 WAL--PDASFLSEFGKDAL--NGDVDVIGID 111 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 29.9 bits (67), Expect = 1.1 Identities = 21/103 (20%), Positives = 39/103 (37%), Gaps = 8/103 (7%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLL 123 G IV + GP SGK+TL + T G + A + + + Sbjct: 22 LKAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILIDGKDIAKLPLEELRRRI----GY 77 Query: 124 ISQPDTGE-QALEITDMLVRSGAVDIIVIDSV-AALTPRAEIE 164 + Q G+ Q + + L+ D++++D + L P + Sbjct: 78 VPQLSGGQRQRVALARALLL--NPDLLLLDEPTSGLDPASRER 118 >gnl|CDD|72892 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex. Decapping is a key step in both general and nonsense-mediated 5'->3' mRNA-decay pathways. Dcp2p contains an all-alpha helical N-terminal domain and a C-terminal domain which has the Nudix fold. While decapping is not dependent on the N-terminus of Dcp2p, it does affect its efficiency. Dcp1p binds the N-terminal domain of Dcp2p stimulating the decapping activity of Dcp2p. Decapping permits the degradation of the transcript and is a site of numerous control inputs. It is responsible for nonsense-mediated decay as well as AU-rich element (ARE)-mediated decay. In addition, it may also play a role in the levels of mRNA. Enzymes belonging to the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V).. Length = 145 Score = 29.8 bits (67), Expect = 1.1 Identities = 18/81 (22%), Positives = 31/81 (38%), Gaps = 9/81 (11%) Query: 186 LTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVG--SIKDKD 243 ++ I + I + I +K+ ++ G PE T F R +I ++ IKD Sbjct: 56 ISKYIDKDDYIELIIRGQNVKLYIVPGVPEDT------PFEPKTRKEISKIEWFDIKDLP 109 Query: 244 SITGNQTRVKV-VKNKMASPF 263 + + K M PF Sbjct: 110 TKKNKKIPGLNSNKFFMVIPF 130 >gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in macrophages, hepatocytes, and intestinal mucosa cells. ABCG1 (ABC8), the human homolog of the Drosophila white gene is induced in monocyte-derived macrophages during cholesterol influx mediated by acetylated low-density lipoprotein. It is possible that human ABCG1 forms heterodimers with several heterologous partners.. Length = 226 Score = 29.8 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGT 97 G+++ I G SGKTTL L I+ + GGT Sbjct: 30 VESGQVMAILGSSGSGKTTL-LDAISGRVEGGGT 62 >gnl|CDD|30132 cd01516, FBPase_glpX, Bacterial fructose-1,6-bisphosphatase, glpX-encoded. A dimeric enzyme dependent on Mg(2+). glpX-encoded FPBase (FBPase class II) differs from other members of the inositol-phosphatase superfamily by permutation of secondary structure elements. The core structure around the active site is well preserved. In E. coli, FBPase II is part of the glp regulon, which mediates growth on glycerol or sn-glycerol 3-phosphate as the sole carbon source.. Length = 309 Score = 29.4 bits (66), Expect = 1.6 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 23 IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69 I+ + GA ++L G + I GS G+D+ +GIGG P+G + Sbjct: 170 IEEIREAGARIKLIPDGDVAAAIATALPGS-GVDVLMGIGGAPEGVL 215 >gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]. Length = 539 Score = 29.4 bits (66), Expect = 1.8 Identities = 11/46 (23%), Positives = 18/46 (39%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDS 109 +G + + G SGK+TLA + G+ F + L Sbjct: 314 LREGETLGLVGESGSGKSTLARILAGLLPPSSGSIIFDGQDLDLTG 359 >gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]. Length = 231 Score = 29.1 bits (65), Expect = 1.8 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQ-SQKTGGTCAFVDAEHALDSIYAR 113 P G IV I GP +GK+TL L+ IA G +H R Sbjct: 22 VPAGEIVAILGPSGAGKSTL-LNLIAGFETPASGEILINGVDHTASPPAER 71 >gnl|CDD|39152 KOG3949, KOG3949, KOG3949, RNA polymerase II elongator complex, subunit ELP4 [Chromatin structure and dynamics, Transcription]. Length = 360 Score = 29.2 bits (65), Expect = 1.8 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 33 MQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEI 72 G + S G + SSG LD LG GG P G V I Sbjct: 14 SIAGVRPSPKNGQLITSSGIADLDQILG-GGLPLGSSVLI 52 >gnl|CDD|143485 cd06810, PLPDE_III_ODC_DapDC_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes. This family includes eukaryotic ornithine decarboxylase (ODC, EC 4.1.1.17), diaminopimelate decarboxylase (DapDC, EC 4.1.1.20), plant and prokaryotic biosynthetic arginine decarboxylase (ADC, EC 4.1.1.19), carboxynorspermidine decarboxylase (CANSDC), and ODC-like enzymes from diverse bacterial species. These proteins are fold type III PLP-dependent enzymes that catalyze essential steps in the biosynthesis of polyamine and lysine. ODC and ADC participate in alternative pathways of the biosynthesis of putrescine, which is the precursor of aliphatic polyamines in many organisms. ODC catalyzes the direct synthesis of putrescine from L-ornithine, while ADC converts L-arginine to agmatine, which is hydrolysed to putrescine by agmatinase in a pathway that exists only in plants and bacteria. DapDC converts meso-2,6-diaminoheptanedioate to L-lysine, which is the final step of lysine biosynthesis. CANSDC catalyzes the decarboxylation of carboxynorspermidine, which is the last step in the synthesis of norspermidine. The PLP-dependent decarboxylases in this family contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Prokaryotic ornithine, lysine and biodegradative arginine decarboxylases are fold type I PLP-dependent enzymes and are not included in this family. Length = 368 Score = 29.2 bits (66), Expect = 2.0 Identities = 46/215 (21%), Positives = 84/215 (39%), Gaps = 35/215 (16%) Query: 9 IVDKSKALEAAL-SQIQRVYG-KG----AIMQ-LGSQGSIFEGIEVVSSGSLGLDIALGI 61 I AL+ AL S ++ Y K +++ L G G +V S G L +AL Sbjct: 11 IRAHYAALKEALPSGVKLFYAVKANPNPHVLRTLAEAG---TGFDVASKGE--LALALAA 65 Query: 62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAF-VDAEHALDSI--YARKLGVD 118 G P+ RI+ GP K+ + S G VD+ L+ + A+KLG Sbjct: 66 GVPPE-RII-FTGP---AKSVSEIEAALAS----GVDHIVVDSLDELERLNELAKKLGPK 116 Query: 119 LKNLLISQPDTGEQALEI--TDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQA 176 + LL PD +I + + G + + + ++ L G+ Sbjct: 117 ARILLRVNPDVSAGTHKISTGGLKSKFG-LSLSEARAALERAKELDL------RLVGLHF 169 Query: 177 RLMSQALR--KLTSSISRSKCILVFINQMRMKIGV 209 + SQ L + ++S ++ ++ + +M + + Sbjct: 170 HVGSQILDLETIVQALSDARELIEELVEMGFPLEM 204 >gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 213 Score = 28.9 bits (65), Expect = 2.0 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIA 89 G + + GP GKTTL L IA Sbjct: 23 VEPGEFLALLGPSGCGKTTL-LRLIA 47 >gnl|CDD|33398 COG3598, RepA, RecA-family ATPase [DNA replication, recombination, and repair]. Length = 402 Score = 28.8 bits (64), Expect = 2.2 Identities = 37/168 (22%), Positives = 62/168 (36%), Gaps = 44/168 (26%) Query: 64 FPKGRIVEIYGPESSGKTTLALHT----------IAQSQKTGGTCAFVDAE-------HA 106 F KG + +YG GKTTL L+ K G +V E Sbjct: 86 FRKGYVSILYGDSGVGKTTLLLYLCIALAAGKNLFGNKVKEPGKVLYVSLELYREDILER 145 Query: 107 LDSIYARKLGV---DLKNLLI---SQPDTGEQALEITDMLVRSGAVDI-------IVIDS 153 L+ + AR +G+ D++N+ + S L L R + +VID Sbjct: 146 LEPVRAR-MGLSPADVRNMDLTDVSGAADESDVLS--PKLYRRFEKILEQKRPDFVVIDP 202 Query: 154 VAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN 201 A G+S+ +Q + + RKL + +C +++I+ Sbjct: 203 FVAFY--------EGKSISDVQVKEFIKKTRKLARN---LECAIIYIH 239 >gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 352 Score = 28.7 bits (64), Expect = 2.4 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 5/63 (7%) Query: 56 DIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQ-SQKTGGTCAFVDAEHALDSIYARK 114 DI+L I KG V + GP GKTTL L IA Q + G + R Sbjct: 23 DISLDI---KKGEFVTLLGPSGCGKTTL-LRMIAGFEQPSSGEILLDGEDITDVPPEKRP 78 Query: 115 LGV 117 +G+ Sbjct: 79 IGM 81 >gnl|CDD|72997 cd03238, ABC_UvrA, The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 176 Score = 28.7 bits (64), Expect = 2.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQK 93 P +V + G SGK+TL + S K Sbjct: 18 IPLNVLVVVTGVSGSGKSTLVNEGLYASGK 47 >gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235 Score = 28.3 bits (63), Expect = 3.1 Identities = 10/24 (41%), Positives = 12/24 (50%) Query: 63 GFPKGRIVEIYGPESSGKTTLALH 86 KG V + GP SGK+TL Sbjct: 26 EIEKGERVLLIGPNGSGKSTLLKL 49 >gnl|CDD|32436 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]. Length = 332 Score = 28.2 bits (63), Expect = 3.4 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 27/91 (29%) Query: 72 IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGE 131 ++GP GKTTLA I A +LGV+LK I+ E Sbjct: 57 LFGPPGLGKTTLA------------------------HIIANELGVNLK---ITSGPALE 89 Query: 132 QALEITDMLVRSGAVDIIVIDSVAALTPRAE 162 + ++ +L D++ ID + L+P E Sbjct: 90 KPGDLAAILTNLEEGDVLFIDEIHRLSPAVE 120 >gnl|CDD|30197 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.. Length = 187 Score = 28.3 bits (63), Expect = 3.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Query: 69 IVEIYGPESSGKTTLALHTI 88 IV I G +SGKTTLA Sbjct: 1 IVGISGVTNSGKTTLAKLLQ 20 >gnl|CDD|33254 COG3451, VirB4, Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion]. Length = 796 Score = 28.4 bits (63), Expect = 3.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Query: 72 IYGPESSGKTTLALHTIAQSQKTGGTCAFV 101 I GP +GKT L +AQ+ K G Sbjct: 441 IIGPTGAGKTVLLSFLLAQALKYGNPQIVA 470 >gnl|CDD|33684 COG3896, COG3896, Chloramphenicol 3-O-phosphotransferase [Defense mechanisms]. Length = 205 Score = 28.1 bits (62), Expect = 3.6 Identities = 12/23 (52%), Positives = 18/23 (78%) Query: 63 GFPKGRIVEIYGPESSGKTTLAL 85 G P+GRIV + G S+GK+++AL Sbjct: 19 GMPEGRIVLLNGGSSAGKSSIAL 41 >gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).. Length = 227 Score = 28.2 bits (63), Expect = 3.7 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Query: 56 DIALGIGGFPKGRIVEIYGPESSGKTTL 83 DI+L I PKG I + GP GK+TL Sbjct: 18 DISLDI---PKGEITALIGPSGCGKSTL 42 >gnl|CDD|144180 pfam00488, MutS_V, MutS domain V. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters. Length = 234 Score = 28.3 bits (64), Expect = 3.8 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 15/57 (26%) Query: 66 KGRIVEIYGPESSGKTTL----ALHTI-AQSQKTGGTCAFVDAEHAL----DSIYAR 113 + RI+ I GP GK+T AL I AQ G +FV AE A D I+ R Sbjct: 41 RSRILLITGPNMGGKSTYLRQVALIVIMAQ---IG---SFVPAESARIGIVDRIFTR 91 >gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 254 Score = 28.3 bits (63), Expect = 3.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 64 FPKGRIVEIYGPESSGKTTL 83 KG I + GP +GK+TL Sbjct: 27 VEKGEITALIGPNGAGKSTL 46 >gnl|CDD|37180 KOG1969, KOG1969, KOG1969, DNA replication checkpoint protein CHL12/CTF18 [Energy production and conversion, Replication, recombination and repair]. Length = 877 Score = 28.1 bits (62), Expect = 4.0 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 55 LDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQ 90 LD+ L P +I+ + GP GKTTLA H IA+ Sbjct: 314 LDMELDPSKRPPKKILLLCGPPGLGKTTLA-HVIAK 348 >gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 178 Score = 28.2 bits (63), Expect = 4.1 Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQK-TGGTCAFVDAEHALDSIYARKL 115 G IV + GP SGK+TL L IA ++ G+ + L Sbjct: 23 IEAGEIVALLGPSGSGKSTL-LRCIAGLEEPDSGSILIDGEDLTDLEDELPPL 74 >gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.. Length = 228 Score = 27.8 bits (62), Expect = 4.3 Identities = 24/107 (22%), Positives = 38/107 (35%), Gaps = 26/107 (24%) Query: 65 PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLI 124 KG + + G SGK+TLA + + T G+ F G DL L Sbjct: 29 KKGETLGLVGESGSGKSTLARAILGLLKPTSGSIIF--------------DGKDLLKLSR 74 Query: 125 SQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESL 171 +R + ++ D +++L PR I + E L Sbjct: 75 RL------------RKIRRKEIQMVFQDPMSSLNPRMTIGEQIAEPL 109 >gnl|CDD|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.. Length = 200 Score = 27.7 bits (62), Expect = 4.4 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIA 89 KG + + GP SGK+TLA TI Sbjct: 23 IKKGEVHALMGPNGSGKSTLA-KTIM 47 >gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]. Length = 240 Score = 27.8 bits (62), Expect = 4.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 64 FPKGRIVEIYGPESSGKTTL 83 KG +V I GP SGK+TL Sbjct: 25 VEKGEVVVIIGPSGSGKSTL 44 >gnl|CDD|30653 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair]. Length = 435 Score = 27.9 bits (62), Expect = 4.5 Identities = 17/84 (20%), Positives = 30/84 (35%), Gaps = 15/84 (17%) Query: 2 DYRKEMNIVDKSKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGI 61 + + + V L+ + +I+ + G+ V +G LD Sbjct: 146 ERKNSEDFVHIGDLLKETMDEIEARFE-------------NGGLIGVPTGFTDLDEI--T 190 Query: 62 GGFPKGRIVEIYGPESSGKTTLAL 85 GF G ++ + GKT LAL Sbjct: 191 SGFRPGDLIIVAARPGMGKTALAL 214 >gnl|CDD|32921 COG3107, LppC, Putative lipoprotein [General function prediction only]. Length = 604 Score = 27.7 bits (61), Expect = 5.0 Identities = 28/181 (15%), Positives = 59/181 (32%), Gaps = 8/181 (4%) Query: 57 IALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFV-----DAEHALDSIY 111 +G K + + LAL+ S+ C F +A A + ++ Sbjct: 320 ADFVVGPLLKPNVEALLASNQQPIPVLALNQPENSRNPAQLCYFALSPEDEARDAANHLW 379 Query: 112 ARKLGVDLKNLLISQPDTGEQALE-ITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGES 170 + G +L+ + D G++ + G ++ + R I G Sbjct: 380 DQ--GKRNPLVLVPRNDLGDRVANAFNQEWQKLGGGTVLQQKFGSTSELRQGINDGAGIR 437 Query: 171 LPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVR 230 L G+ A L + + + V+I ++ ++ G ++ Y+S R Sbjct: 438 LTGLPADLTTTNGLQTPPLDDQDTIDAVYIVATPSELALIKPMIAMANGSDSPPLYASSR 497 Query: 231 L 231 Sbjct: 498 S 498 >gnl|CDD|34357 COG4742, COG4742, Predicted transcriptional regulator [Transcription]. Length = 260 Score = 27.8 bits (62), Expect = 5.1 Identities = 16/103 (15%), Positives = 44/103 (42%), Gaps = 10/103 (9%) Query: 233 IRRVGSIKDKDSITGNQTRV-----KVVKNKMASPFKQVEFDIMYGEGISFFGELIDLGV 287 ++R+G + D + + + + + ++N +S + S + EL + G+ Sbjct: 106 LKRIGELGDCELLEPDLDHLFEPPPEFLENLSSSKRIMGFSSYFHPSYPSLYLELAEKGI 165 Query: 288 KASIVDKSGAWFSFKGQRLGQGRE-----NSKIFLRENIEIAE 325 S++ + K + +E N+K+++ + I++A Sbjct: 166 DVSLILTEPVFERLKSDYKEELKEFLKLENTKLYVCDGIKLAS 208 >gnl|CDD|31624 COG1435, Tdk, Thymidine kinase [Nucleotide transport and metabolism]. Length = 201 Score = 27.9 bits (62), Expect = 5.2 Identities = 20/101 (19%), Positives = 33/101 (32%), Gaps = 8/101 (7%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTI----AQSQKTGGTCAFVDAEHALDSIYARKLGVDL 119 G + IYGP SGKT L K +D + + + +R G+ Sbjct: 1 KKMGWLEFIYGPMFSGKTEELLRRARRYKEAGMKVLVFKPAIDTRYGVGKVSSRI-GLSS 59 Query: 120 KNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPR 160 + ++I + L VD ++ID Sbjct: 60 EAVVIPSD---TDIFDEIAALHEKPPVDCVLIDEAQFFDEE 97 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 27.7 bits (62), Expect = 5.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Query: 64 FPKGRIVEIYGPESSGKTTLA 84 G V I GP SGK+TL Sbjct: 25 IKPGEKVAIVGPSGSGKSTLL 45 >gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211 Score = 27.6 bits (61), Expect = 5.6 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIA 89 F +G I I GP SGK+TL L+ IA Sbjct: 21 FAQGEITAIVGPSGSGKSTL-LNLIA 45 >gnl|CDD|31949 COG1763, MobB, Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]. Length = 161 Score = 27.6 bits (61), Expect = 5.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 68 RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH 105 +I+ I G ++SGKTTL + + + G A V H Sbjct: 3 KILGIVGYKNSGKTTLIEKLVRKLKARGYRVATVKHAH 40 >gnl|CDD|30917 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism]. Length = 218 Score = 27.5 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Query: 65 PKGRIVEIYGPESSGKTTLALHTIAQ 90 K I+ I G SGKTT+A Q Sbjct: 6 EKVIIIGIAGGSGSGKTTVAKELSEQ 31 >gnl|CDD|37252 KOG2041, KOG2041, KOG2041, WD40 repeat protein [General function prediction only]. Length = 1189 Score = 27.3 bits (60), Expect = 6.6 Identities = 12/46 (26%), Positives = 22/46 (47%) Query: 102 DAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAVD 147 D E+ ++ +Y +L +L+ L + P+ E + DM G D Sbjct: 824 DTENQIECLYRLELFGELEVLARTLPEDSELLPVMADMFTSVGMCD 869 >gnl|CDD|39857 KOG4658, KOG4658, KOG4658, Apoptotic ATPase [Signal transduction mechanisms]. Length = 889 Score = 27.2 bits (60), Expect = 6.7 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 7/79 (8%) Query: 13 SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIE---VVSSGSLGLDIALG-IGGF---P 65 K + L +++ + KG +G E +E + S +GL+ L + Sbjct: 118 GKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESDVGLETMLEKLWNRLMED 177 Query: 66 KGRIVEIYGPESSGKTTLA 84 IV IYG GKTTLA Sbjct: 178 DVGIVGIYGMGGVGKTTLA 196 >gnl|CDD|145708 pfam02698, DUF218, DUF218 domain. This large family of proteins contains several highly conserved charged amino acids, suggesting this may be an enzymatic domain (Bateman A pers. obs). The family includes SanA, which is involved in Vancomycin resistance. This protein may be involved in murein synthesis. Length = 148 Score = 27.3 bits (61), Expect = 6.9 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 111 YARKLGVDLKNLLI-SQP-DTGEQALEITDMLVRSGAVDIIVIDSVAALTPRA 161 Y +LGV + +L+ Q +T E A ++L G ++++ S A RA Sbjct: 55 YLVELGVPAEAILLEPQSRNTYENARFSAELLRERGLRRVLLVTS-AFHMRRA 106 >gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.. Length = 163 Score = 27.3 bits (61), Expect = 6.9 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 9/100 (9%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIY-ARKLGVDLKNL 122 +G + + G +GK+TL + G E + S AR+ G+ Sbjct: 23 VRRGEVHALLGENGAGKSTLMKILSGLYKPDSGEILVDGKEVSFASPRDARRAGIA---- 78 Query: 123 LISQPDTGE-QALEITDMLVRSGAVDIIVID-SVAALTPR 160 ++ Q GE Q +EI L R ++++D AALTP Sbjct: 79 MVYQLSVGERQMVEIARALAR--NARLLILDEPTAALTPA 116 >gnl|CDD|31683 COG1494, GlpX, Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase and related proteins [Carbohydrate transport and metabolism]. Length = 332 Score = 27.1 bits (60), Expect = 7.2 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 23 IQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRI 69 I + GA ++L G + I + G+D+ GIGG P+G I Sbjct: 171 IAEIRAAGARVRLIPDGDVAAAILTCFPDT-GVDLLYGIGGAPEGVI 216 >gnl|CDD|37153 KOG1942, KOG1942, KOG1942, DNA helicase, TBP-interacting protein [Replication, recombination and repair]. Length = 456 Score = 27.2 bits (60), Expect = 7.6 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Query: 67 GRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFV 101 GR V + GP +GKT LAL A SQ+ G F Sbjct: 64 GRAVLLAGPPGTGKTALAL---AISQELGPKVPFC 95 >gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 263 Score = 27.1 bits (60), Expect = 7.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 65 PKGRIVEIYGPESSGKTTL 83 P+G I+ I G SGK+TL Sbjct: 32 PRGEILAILGGSGSGKSTL 50 >gnl|CDD|35871 KOG0652, KOG0652, KOG0652, 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]. Length = 424 Score = 26.9 bits (59), Expect = 8.0 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Query: 65 PKGRIVEIYGPESSGKTTLALHTIAQSQKT 94 PKG V +YGP +GKT +A AQ+ T Sbjct: 205 PKG--VLMYGPPGTGKTLMARACAAQTNAT 232 >gnl|CDD|35402 KOG0181, KOG0181, KOG0181, 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones]. Length = 233 Score = 26.8 bits (59), Expect = 8.9 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Query: 292 VDKSGAWFSFKGQRLGQGRENSKIFLR----ENIEIAENI 327 VD SG++F++K +G+ N+K FL E++E+ + I Sbjct: 149 VDPSGSYFAWKATAMGKNYVNAKTFLEKRYNEDLELDDAI 188 >gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]. Length = 338 Score = 26.8 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Query: 64 FPKGRIVEIYGPESSGKTTLALHTIA 89 G V + GP GK+TL L IA Sbjct: 26 IEDGEFVVLLGPSGCGKSTL-LRMIA 50 >gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 613 Score = 26.9 bits (59), Expect = 9.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 62 GGFPKGRIVEIYGPESSGKTTL 83 G G ++ I GP SGKTTL Sbjct: 51 GTAKPGELLAIMGPSGSGKTTL 72 >gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 252 Score = 26.7 bits (59), Expect = 9.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 64 FPKGRIVEIYGPESSGKTTL 83 PKG I I GP +GK+TL Sbjct: 24 IPKGGITSIIGPNGAGKSTL 43 >gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 26.6 bits (59), Expect = 9.9 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Query: 56 DIALGIGGFPKGRIVEIYGPESSGKTTLALHTIA 89 DI+L + +G V + GP GK+TL L IA Sbjct: 22 DISLSV---EEGEFVALVGPSGCGKSTL-LRIIA 51 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.134 0.365 Gapped Lambda K H 0.267 0.0868 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,993,359 Number of extensions: 208520 Number of successful extensions: 871 Number of sequences better than 10.0: 1 Number of HSP's gapped: 847 Number of HSP's successfully gapped: 155 Length of query: 363 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 268 Effective length of database: 4,210,882 Effective search space: 1128516376 Effective search space used: 1128516376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (25.9 bits)