>gi|62317152|ref|YP_223005.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 1 str. 9-941] Length = 157
>gi|83269135|ref|YP_418426.1| cytidine/deoxycytidylate deaminase [Brucella melitensis biovar Abortus 2308] Length = 157
>gi|161620282|ref|YP_001594168.1| CMP/dCMP deaminase zinc-binding [Brucella canis ATCC 23365] Length = 157
>gi|189022411|ref|YP_001932152.1| Cytidine/deoxycytidylate deaminase, zinc-binding region [Brucella abortus S19] Length = 157
>gi|254691365|ref|ZP_05154619.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 6 str. 870] Length = 157
>gi|254695335|ref|ZP_05157163.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 3 str. Tulya] Length = 157
>gi|254698431|ref|ZP_05160259.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 2 str. 86/8/59] Length = 157
>gi|254699495|ref|ZP_05161323.1| cytidine and deoxycytidylate deaminase family protein [Brucella suis bv. 5 str. 513] Length = 157
>gi|254702619|ref|ZP_05164447.1| cytidine and deoxycytidylate deaminase family protein [Brucella suis bv. 3 str. 686] Length = 157
>gi|254706250|ref|ZP_05168078.1| cytidine and deoxycytidylate deaminase family protein [Brucella pinnipedialis M163/99/10] Length = 157
>gi|254711456|ref|ZP_05173267.1| cytidine and deoxycytidylate deaminase family protein [Brucella pinnipedialis B2/94] Length = 157
>gi|254712059|ref|ZP_05173870.1| cytidine and deoxycytidylate deaminase family protein [Brucella ceti M644/93/1] Length = 157
>gi|254715129|ref|ZP_05176940.1| cytidine and deoxycytidylate deaminase family protein [Brucella ceti M13/05/1] Length = 157
>gi|254731878|ref|ZP_05190456.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 4 str. 292] Length = 157
>gi|256014990|ref|YP_003104999.1| cytidine and deoxycytidylate deaminase family protein [Brucella microti CCM 4915] Length = 157
>gi|256029913|ref|ZP_05443527.1| cytidine and deoxycytidylate deaminase family protein [Brucella pinnipedialis M292/94/1] Length = 157
>gi|256043124|ref|ZP_05446066.1| cytidine and deoxycytidylate deaminase family protein [Brucella melitensis bv. 1 str. Rev.1] Length = 157
>gi|256059562|ref|ZP_05449761.1| cytidine and deoxycytidylate deaminase family protein [Brucella neotomae 5K33] Length = 157
>gi|256111894|ref|ZP_05452850.1| cytidine and deoxycytidylate deaminase family protein [Brucella melitensis bv. 3 str. Ether] Length = 157
>gi|256158082|ref|ZP_05456000.1| cytidine and deoxycytidylate deaminase family protein [Brucella ceti M490/95/1] Length = 157
>gi|256252963|ref|ZP_05458499.1| cytidine and deoxycytidylate deaminase family protein [Brucella ceti B1/94] Length = 157
>gi|256256550|ref|ZP_05462086.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 9 str. C68] Length = 157
>gi|260166985|ref|ZP_05753796.1| cytidine and deoxycytidylate deaminase family protein [Brucella sp. F5/99] Length = 157
>gi|260544385|ref|ZP_05820206.1| cytidine/deoxycytidylate deaminase [Brucella abortus NCTC 8038] Length = 157
>gi|260564346|ref|ZP_05834831.1| cytidine/deoxycytidylate deaminase [Brucella melitensis bv. 1 str. 16M] Length = 157
>gi|260568473|ref|ZP_05838942.1| cytidine/deoxycytidylate deaminase [Brucella suis bv. 4 str. 40] Length = 157
>gi|260756977|ref|ZP_05869325.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 6 str. 870] Length = 157
>gi|260759649|ref|ZP_05871997.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 4 str. 292] Length = 157
>gi|260762892|ref|ZP_05875224.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] Length = 157
>gi|260882788|ref|ZP_05894402.1| cytidine/deoxycytidylate deaminase [Brucella abortus bv. 9 str. C68] Length = 157
>gi|261215706|ref|ZP_05929987.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 3 str. Tulya] Length = 157
>gi|261216837|ref|ZP_05931118.1| CMP/dCMP deaminase zinc-binding protein [Brucella ceti M13/05/1] Length = 157
>gi|261220056|ref|ZP_05934337.1| cytidine/deoxycytidylate deaminase [Brucella ceti B1/94] Length = 157
>gi|261313693|ref|ZP_05952890.1| CMP/dCMP deaminase zinc-binding protein [Brucella pinnipedialis M163/99/10] Length = 157
>gi|261319065|ref|ZP_05958262.1| CMP/dCMP deaminase zinc-binding protein [Brucella pinnipedialis B2/94] Length = 157
>gi|261319704|ref|ZP_05958901.1| CMP/dCMP deaminase zinc-binding protein [Brucella ceti M644/93/1] Length = 157
>gi|261323530|ref|ZP_05962727.1| cytidine/deoxycytidylate deaminase [Brucella neotomae 5K33] Length = 157
>gi|261749950|ref|ZP_05993659.1| CMP/dCMP deaminase zinc-binding protein [Brucella suis bv. 5 str. 513] Length = 157
>gi|261753203|ref|ZP_05996912.1| CMP/dCMP deaminase zinc-binding protein [Brucella suis bv. 3 str. 686] Length = 157
>gi|261756372|ref|ZP_06000081.1| cytidine/deoxycytidylate deaminase [Brucella sp. F5/99] Length = 157
>gi|265986931|ref|ZP_06099488.1| CMP/dCMP deaminase zinc-binding protein [Brucella pinnipedialis M292/94/1] Length = 157
>gi|265989556|ref|ZP_06102113.1| CMP/dCMP deaminase zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] Length = 157
>gi|265993342|ref|ZP_06105899.1| cytidine/deoxycytidylate deaminase [Brucella melitensis bv. 3 str. Ether] Length = 157
>gi|265996597|ref|ZP_06109154.1| CMP/dCMP deaminase zinc-binding protein [Brucella ceti M490/95/1] Length = 157
>gi|294853219|ref|ZP_06793891.1| cytosine deaminase [Brucella sp. NVSL 07-0026] Length = 157
>gi|62197345|gb|AAX75644.1| cytidine and deoxycytidylate deaminase family protein [Brucella abortus bv. 1 str. 9-941] Length = 157
>gi|82939409|emb|CAJ12363.1| Cytidine/deoxycytidylate deaminase, zinc-binding region [Brucella melitensis biovar Abortus 2308] Length = 157
>gi|161337093|gb|ABX63397.1| CMP/dCMP deaminase zinc-binding [Brucella canis ATCC 23365] Length = 157
>gi|189020985|gb|ACD73706.1| Cytidine/deoxycytidylate deaminase, zinc-binding region [Brucella abortus S19] Length = 157
>gi|255997650|gb|ACU49337.1| cytidine and deoxycytidylate deaminase family protein [Brucella microti CCM 4915] Length = 157
>gi|260097656|gb|EEW81530.1| cytidine/deoxycytidylate deaminase [Brucella abortus NCTC 8038] Length = 157
>gi|260151989|gb|EEW87082.1| cytidine/deoxycytidylate deaminase [Brucella melitensis bv. 1 str. 16M] Length = 157
>gi|260155138|gb|EEW90219.1| cytidine/deoxycytidylate deaminase [Brucella suis bv. 4 str. 40] Length = 157
>gi|260669967|gb|EEX56907.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 4 str. 292] Length = 157
>gi|260673313|gb|EEX60134.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] Length = 157
>gi|260677085|gb|EEX63906.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 6 str. 870] Length = 157
>gi|260872316|gb|EEX79385.1| cytidine/deoxycytidylate deaminase [Brucella abortus bv. 9 str. C68] Length = 157
>gi|260917313|gb|EEX84174.1| CMP/dCMP deaminase zinc-binding protein [Brucella abortus bv. 3 str. Tulya] Length = 157
>gi|260918640|gb|EEX85293.1| cytidine/deoxycytidylate deaminase [Brucella ceti B1/94] Length = 157
>gi|260921926|gb|EEX88494.1| CMP/dCMP deaminase zinc-binding protein [Brucella ceti M13/05/1] Length = 157
>gi|261292394|gb|EEX95890.1| CMP/dCMP deaminase zinc-binding protein [Brucella ceti M644/93/1] Length = 157
>gi|261298288|gb|EEY01785.1| CMP/dCMP deaminase zinc-binding protein [Brucella pinnipedialis B2/94] Length = 157
>gi|261299510|gb|EEY03007.1| cytidine/deoxycytidylate deaminase [Brucella neotomae 5K33] Length = 157
>gi|261302719|gb|EEY06216.1| CMP/dCMP deaminase zinc-binding protein [Brucella pinnipedialis M163/99/10] Length = 157
>gi|261736356|gb|EEY24352.1| cytidine/deoxycytidylate deaminase [Brucella sp. F5/99] Length = 157
>gi|261739703|gb|EEY27629.1| CMP/dCMP deaminase zinc-binding protein [Brucella suis bv. 5 str. 513] Length = 157
>gi|261742956|gb|EEY30882.1| CMP/dCMP deaminase zinc-binding protein [Brucella suis bv. 3 str. 686] Length = 157
>gi|262550894|gb|EEZ07055.1| CMP/dCMP deaminase zinc-binding protein [Brucella ceti M490/95/1] Length = 157
>gi|262764212|gb|EEZ10244.1| cytidine/deoxycytidylate deaminase [Brucella melitensis bv. 3 str. Ether] Length = 157
>gi|263000225|gb|EEZ12915.1| CMP/dCMP deaminase zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] Length = 157
>gi|264659128|gb|EEZ29389.1| CMP/dCMP deaminase zinc-binding protein [Brucella pinnipedialis M292/94/1] Length = 157
>gi|294818874|gb|EFG35874.1| cytosine deaminase [Brucella sp. NVSL 07-0026] Length = 157

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 110/142 (77%)

Query: 8   MSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIRMGCRILS 67
           M  ALEEA  A  R E+P+GAV V + +II+RAGNR RE  DVTAHAEIL IR    +L 
Sbjct: 16  MDIALEEAHAAGERGEVPIGAVIVRDGEIIARAGNRTREFNDVTAHAEILTIRQAGEMLG 75

Query: 68  QEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLATCHHSPE 127
            E L + DLYVTLEPC MCAAAIS ARIRRLYYGAS+PKGGGIE+G +FYT  TCHH+PE
Sbjct: 76  SERLIDCDLYVTLEPCAMCAAAISFARIRRLYYGASDPKGGGIEHGGRFYTQPTCHHAPE 135

Query: 128 IYPGISEQRSRQIIQDFFKERR 149
           IYPG  E  +R+I++DFF+E+R
Sbjct: 136 IYPGFCEADARKILKDFFREKR 157