BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764464|ref|YP_003064771.2| Cytidine/deoxycytidylate deaminase, zinc-binding region [Candidatus Liberibacter asiaticus str. psy62] (149 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764464|ref|YP_003064771.2| Cytidine/deoxycytidylate deaminase, zinc-binding region [Candidatus Liberibacter asiaticus str. psy62] Length = 149 Score = 308 bits (789), Expect = 3e-86, Method: Compositional matrix adjust. Identities = 149/149 (100%), Positives = 149/149 (100%) Query: 1 MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIR 60 MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIR Sbjct: 1 MKKGNVFMSCALEEAQNAALRNEIPVGAVAVLNNKIISRAGNRNRELKDVTAHAEILAIR 60 Query: 61 MGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLA 120 MGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLA Sbjct: 61 MGCRILSQEILPEVDLYVTLEPCTMCAAAISLARIRRLYYGASNPKGGGIENGTQFYTLA 120 Query: 121 TCHHSPEIYPGISEQRSRQIIQDFFKERR 149 TCHHSPEIYPGISEQRSRQIIQDFFKERR Sbjct: 121 TCHHSPEIYPGISEQRSRQIIQDFFKERR 149 >gi|254780222|ref|YP_003064635.1| DNA topoisomerase IV subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 686 Score = 22.3 bits (46), Expect = 4.4, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Query: 98 LYYGASNPKGGGIENGTQFYTLATCHHSPEI 128 ++ G + KG GT + +A C +PEI Sbjct: 287 IFTGKTEKKG--THRGTVEWAIAWCEENPEI 315 >gi|254780348|ref|YP_003064761.1| 5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 21.6 bits (44), Expect = 7.2, Method: Compositional matrix adjust. Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 77 YVTLEPCT 84 YVTLEPC+ Sbjct: 73 YVTLEPCS 80 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.135 0.394 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,535 Number of Sequences: 1233 Number of extensions: 3264 Number of successful extensions: 8 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 5 length of query: 149 length of database: 328,796 effective HSP length: 66 effective length of query: 83 effective length of database: 247,418 effective search space: 20535694 effective search space used: 20535694 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 34 (17.7 bits)