RPSBLAST alignment for GI: 255764466 and conserved domain: PRK02110

>gnl|CDD|179370 PRK02110, PRK02110, disulfide bond formation protein B; Provisional. Length = 169
 Score = 37.7 bits (88), Expect = 0.002
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 43/170 (25%)

Query: 26  IVCF------LMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLST--RNHNSYWSTRLL 77
           ++C       L +Q+V G  PC LCI ++   Y   LIA+ A L+   RN    W    L
Sbjct: 20  LICLALVGGALYLQYVKGEDPCPLCIIQR---YAFLLIAIFAFLAAAMRNTRGVWVLEGL 76

Query: 78  LMTLGLLMFFNMTISVIHV------GIECGIWEKNAICMNNSKIESITSTVDLLTQMEQE 131
           ++   L     + ++  HV      G  CG             I+++   VD L   +  
Sbjct: 77  IVLSALG---GIAVAGRHVYIQLNPGFSCG-------------IDALQPIVDSLPPAKW- 119

Query: 132 NIPSCNK-----TTLY--VLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174
            +P   K      T Y  +LGLSL  W +I +F L  +     L  +R++
Sbjct: 120 -LPGVFKVDGLCETPYPPILGLSLPGWALI-AFVLIAVAVAVSLIRNRRR 167