RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764466|ref|YP_003064779.2| hypothetical protein CLIBASIA_01255 [Candidatus Liberibacter asiaticus str. psy62] (174 letters) >gnl|CDD|145639 pfam02600, DsbB, Disulfide bond formation protein DsbB. This family consists of disulfide bond formation protein DsbB from bacteria. The DsbB protein oxidizes the periplasmic protein DsbA which in turn oxidizes cysteines in other periplasmic proteins in order to make disulfide bonds. DsbB acts as a redox potential transducer across the cytoplasmic membrane and is an integral membrane protein. DsbB posses six cysteines four of which are necessary for it proper function in vivo. Length = 159 Score = 71.6 bits (176), Expect = 1e-13 Identities = 36/149 (24%), Positives = 59/149 (39%), Gaps = 11/149 (7%) Query: 26 IVCFLMI------QHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRLLLM 79 + ++ Q+V G PC LCI ++ LI L+A L RL L+ Sbjct: 16 LASLALLLGALYFQYVLGLEPCPLCIYQRIAMLALALIGLLALL----AGRRGRRRLALL 71 Query: 80 TLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSCNKT 139 LL I++ HVG++ G WE C + L Q+ C + Sbjct: 72 LALLLALAGAGIALYHVGLQAGPWEGPPSCGALEGFPDWLPLDEWLPQVFA-ATGDCAEV 130 Query: 140 TLYVLGLSLAFWNIIVSFFLSFITSIAML 168 LGLS+ W+++ L+ + + +L Sbjct: 131 AWTFLGLSMPGWSLVAFLLLALLLLLLLL 159 >gnl|CDD|31684 COG1495, DsbB, Disulfide bond formation protein DsbB [Posttranslational modification, protein turnover, chaperones]. Length = 170 Score = 49.2 bits (117), Expect = 6e-07 Identities = 30/160 (18%), Positives = 61/160 (38%), Gaps = 9/160 (5%) Query: 17 IILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALVADLSTRNHNSYWSTRL 76 + LL ++ ++ L Q++ G PC LC+ ++ Y +I L+A L Sbjct: 18 LALLGLALALLAALYFQYILGLEPCPLCLYQRIAMYGLGVILLLALL-------IGPLNR 70 Query: 77 LLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIPSC 136 L + L + + H G + + + + + SC Sbjct: 71 LRLYGLALALIGAGLGIYHAGEHVVLQLGPFATCSFGLTFPEWLPLGKWAPLVFQGTGSC 130 Query: 137 NK--TTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174 ++ +LGLS+ W +++ F L + + + + RKK Sbjct: 131 SEPVAAWRLLGLSMPPWLLLIFFALLLLLLLLLFRKKRKK 170 >gnl|CDD|33647 COG3857, AddB, ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair]. Length = 1108 Score = 28.0 bits (62), Expect = 1.6 Identities = 15/89 (16%), Positives = 37/89 (41%), Gaps = 18/89 (20%) Query: 65 TRNHNSYWSTRLLLMTLGLLMFFNMTIS------VIHVGIECGIWEKNAICMNNSKIESI 118 H W+ + L+ + +F + +S ++H+G+E + K I Sbjct: 501 AEEHEQVWNALIELLEEFVEVFGDEKLSLELFLEILHIGLE------------SLKFRLI 548 Query: 119 TSTVDLLTQMEQENIPSCNKTTLYVLGLS 147 +T+D ++ + + K +Y +G++ Sbjct: 549 PATLDQVSIGSYDLVKPHTKKFVYAIGMN 577 >gnl|CDD|32691 COG2864, FdnI, Cytochrome b subunit of formate dehydrogenase [Energy production and conversion]. Length = 218 Score = 27.1 bits (60), Expect = 2.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Query: 139 TTLYVLGLSLAFWNIIVSFFLSFITSIAM 167 Y G L FW I++ L IT I + Sbjct: 107 VGKYNAGQKLLFWTAILAIVLLLITGIVI 135 >gnl|CDD|34013 COG4291, COG4291, Predicted membrane protein [Function unknown]. Length = 228 Score = 25.7 bits (56), Expect = 6.8 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 52 YFGFLIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGI 102 YF F+I + A S N + R++L+ L FFN I V G+ Sbjct: 176 YFSFVIGMTAQTSDTNITTTAMRRVVLLHSILSFFFNTVIVAAAVNAAAGL 226 >gnl|CDD|144132 pfam00423, HN, Hemagglutinin-neuraminidase. Length = 545 Score = 25.4 bits (56), Expect = 9.2 Identities = 14/60 (23%), Positives = 25/60 (41%) Query: 75 RLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITSTVDLLTQMEQENIP 134 L+++ L L++ + I IH +N + S ESI V ++ + E P Sbjct: 3 VLIVLLLSLIILIAIIIIRIHSATISTGEIQNILNTLLSITESIDHQVKDISSLISELTP 62 >gnl|CDD|145980 pfam03122, Herpes_MCP, Herpes virus major capsid protein. This family represents the major capsid protein (MCP) of herpes viruses. The capsid shell consists of 150 MCP hexamers and 12 MCP pentamers. One pentamer is found at each of the 12 apices of the icosahedral shell, and the hexamers form the edges and 20 faces. Length = 1352 Score = 25.3 bits (56), Expect = 9.9 Identities = 7/21 (33%), Positives = 9/21 (42%), Gaps = 5/21 (23%) Query: 48 QKIYYFGFLIALVADLSTRNH 68 KI+Y+ L A T H Sbjct: 787 SKIFYYVVLPAF-----TNGH 802 >gnl|CDD|34893 COG5305, COG5305, Predicted membrane protein [Function unknown]. Length = 552 Score = 25.3 bits (55), Expect = 10.0 Identities = 12/51 (23%), Positives = 22/51 (43%) Query: 56 LIALVADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKN 106 L+ + ++R W LL+ L LL + ++VI G+ +W Sbjct: 184 LLRAIRLPTSRKLLPGWLIYALLLILSLLTHYFFALTVIAHGVYVLLWASL 234 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.329 0.141 0.427 Gapped Lambda K H 0.267 0.0714 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,064,925 Number of extensions: 103150 Number of successful extensions: 520 Number of sequences better than 10.0: 1 Number of HSP's gapped: 515 Number of HSP's successfully gapped: 30 Length of query: 174 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 87 Effective length of database: 4,383,754 Effective search space: 381386598 Effective search space used: 381386598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 54 (24.6 bits)