BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764466|ref|YP_003064779.2| hypothetical protein CLIBASIA_01255 [Candidatus Liberibacter asiaticus str. psy62] (174 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764466|ref|YP_003064779.2| hypothetical protein CLIBASIA_01255 [Candidatus Liberibacter asiaticus str. psy62] Length = 174 Score = 353 bits (905), Expect = 1e-99, Method: Compositional matrix adjust. Identities = 174/174 (100%), Positives = 174/174 (100%) Query: 1 MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALV 60 MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALV Sbjct: 1 MIKSLLSTLANIPLPRIILLNISGVIVCFLMIQHVGGYPPCDLCIQEQKIYYFGFLIALV 60 Query: 61 ADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITS 120 ADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITS Sbjct: 61 ADLSTRNHNSYWSTRLLLMTLGLLMFFNMTISVIHVGIECGIWEKNAICMNNSKIESITS 120 Query: 121 TVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174 TVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK Sbjct: 121 TVDLLTQMEQENIPSCNKTTLYVLGLSLAFWNIIVSFFLSFITSIAMLKISRKK 174 >gi|254780762|ref|YP_003065175.1| recombination protein RecR [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 23.1 bits (48), Expect = 2.8, Method: Compositional matrix adjust. Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 40 PCDLCIQEQKIYYFGFLIALVADL 63 PC +CI +Q+ ++ VADL Sbjct: 71 PCAICIDQQRDASVIIVVEDVADL 94 >gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Score = 23.1 bits (48), Expect = 3.0, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 8 TLANIPLPRIILLNISGV 25 TL+ P+PR + L I+GV Sbjct: 778 TLSATPIPRTLQLAITGV 795 >gi|254780299|ref|YP_003064712.1| acyl-CoA dehydrogenase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 23.1 bits (48), Expect = 3.0, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 94 IHVGIECGIWEKNAICMNNSKIESI-TSTVDLLTQMEQENIPSCNKTTLYVLGL 146 IH G+ C IW+++ + + I + + L+ Q+E ++ S + T+ ++ L Sbjct: 111 IHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSASMVAL 164 Score = 22.3 bits (46), Expect = 4.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 17 IILLNISGVIVCFLMIQHVGGYPPCDLCIQEQK 49 I+L + G + CFL+ + + P LC Q K Sbjct: 244 IMLAQVEGRVGCFLVPRLLEDGSPNGLCYQRLK 276 >gi|254781158|ref|YP_003065571.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 631 Score = 21.9 bits (45), Expect = 6.1, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 35 VGGYPPCDLCIQEQKIYYF 53 VGG P +L + + K +YF Sbjct: 169 VGGMRPSNLLLDQAKRFYF 187 >gi|254781097|ref|YP_003065510.1| N-acetylglucosaminyl transferase [Candidatus Liberibacter asiaticus str. psy62] Length = 369 Score = 21.9 bits (45), Expect = 6.4, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 150 FWNIIVSFFLSFITSIAMLK 169 FWN +V + +FI S+ ++K Sbjct: 71 FWNSLVILWKAFIASLRLIK 90 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.141 0.427 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,975 Number of Sequences: 1233 Number of extensions: 4012 Number of successful extensions: 24 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 10 length of query: 174 length of database: 328,796 effective HSP length: 68 effective length of query: 106 effective length of database: 244,952 effective search space: 25964912 effective search space used: 25964912 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 35 (18.1 bits)