RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764468|ref|YP_003064806.2| permease protein [Candidatus Liberibacter asiaticus str. psy62] (361 letters) >gnl|CDD|130897 TIGR01838, PHA_synth_I, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. Length = 532 Score = 27.3 bits (61), Expect = 5.6 Identities = 23/84 (27%), Positives = 32/84 (38%), Gaps = 25/84 (29%) Query: 100 IKPVLFLAILL------SIFLFISENIIEPKCRSTIKQLSAKA-----QLALTFSYLEEN 148 IK F LL + +F+ E I+ +Q Q+A+TFS L EN Sbjct: 292 IKSATFFTTLLDFSDPGELGVFVDEEIV----AGIERQNGGGGYLDGRQMAVTFSLLREN 347 Query: 149 LFFRLDDDLYIKISKYNPNNTLQG 172 DL Y +N L+G Sbjct: 348 -------DLIW---NYYVDNYLKG 361 >gnl|CDD|177744 PLN00135, PLN00135, malate dehydrogenase. Length = 309 Score = 27.4 bits (61), Expect = 6.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Query: 210 RKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQNLSFLL 251 RK +SK++SI K ++ L+ +A +++ AN N + L+ Sbjct: 76 RKDVMSKNVSIYKSQASALEKHAAPDCKVLVVANPANTNALI 117 >gnl|CDD|107039 PHA01519, PHA01519, hypothetical protein. Length = 115 Score = 27.5 bits (60), Expect = 6.0 Identities = 8/28 (28%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 253 PNP-NNPNYRPELLETYRSEFHKRLTQW 279 P+ N+P+ ++E +R +LT+W Sbjct: 56 PDYCNDPSASWPIIEKHRISILDQLTEW 83 >gnl|CDD|173163 PRK14700, PRK14700, recombination factor protein RarA; Provisional. Length = 300 Score = 26.9 bits (59), Expect = 9.5 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Query: 151 FRLDDDLYIKISKYNPN------NTLQGIFIVDSRDTQTH 184 F++DD LY + YN N L+ +F++ +R + + Sbjct: 63 FKIDDGLYNAMHNYNEGDCRKILNLLERMFLISTRGDEIY 102 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.141 0.408 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,713,046 Number of extensions: 364657 Number of successful extensions: 1223 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1218 Number of HSP's successfully gapped: 50 Length of query: 361 Length of database: 5,994,473 Length adjustment: 95 Effective length of query: 266 Effective length of database: 3,941,713 Effective search space: 1048495658 Effective search space used: 1048495658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 58 (26.1 bits)