Query gi|255764469|ref|YP_003064807.2| putative permease protein [Candidatus Liberibacter asiaticus str. psy62] Match_columns 361 No_of_seqs 133 out of 2399 Neff 9.6 Searched_HMMs 39220 Date Sun May 29 17:58:23 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 255764469.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam03739 YjgP_YjgQ Predicted 100.0 0 0 410.4 29.6 344 7-357 1-353 (353) 2 COG0795 Predicted permeases [G 100.0 0 0 368.0 32.6 356 2-361 1-364 (364) 3 COG4591 LolE ABC-type transpor 90.9 0.84 2.1E-05 21.9 7.1 25 63-87 31-55 (408) 4 PRK10814 outer membrane-specif 86.0 1.9 4.8E-05 20.0 9.2 11 4-14 4-14 (396) 5 pfam02687 FtsX Predicted perme 82.1 2.8 7.2E-05 19.1 7.9 52 73-124 68-119 (174) 6 PRK11026 ftsX cell division pr 80.0 3.3 8.5E-05 18.7 7.5 12 317-328 251-262 (309) 7 TIGR02212 lolCE lipoprotein re 79.8 3.4 8.7E-05 18.7 6.7 38 106-146 27-64 (414) 8 pfam02405 DUF140 Domain of unk 77.6 4 0.0001 18.3 11.8 99 15-121 15-122 (215) 9 TIGR00439 ftsX putative protei 74.3 4.9 0.00013 17.8 5.4 46 46-95 31-79 (314) 10 TIGR01517 ATPase-IIB_Ca calciu 65.2 0.75 1.9E-05 22.1 -1.9 73 16-91 275-351 (885) 11 PRK11146 outer membrane-specif 65.2 8 0.0002 16.7 9.7 23 61-83 28-50 (412) 12 TIGR00869 sec62 protein transl 54.6 12 0.00032 15.7 3.8 32 277-308 126-157 (259) 13 PRK06591 putative monovalent c 54.3 12 0.00031 15.8 2.7 12 346-357 408-419 (433) 14 COG0598 CorA Mg2+ and Co2+ tra 49.8 8.4 0.00022 16.6 1.3 69 287-359 244-319 (322) 15 TIGR00383 corA magnesium and c 48.2 12 0.0003 15.8 1.8 67 289-358 258-335 (339) 16 PRK11085 magnesium/nickel/coba 46.7 11 0.00028 15.9 1.5 69 288-359 239-313 (316) 17 TIGR03434 ADOP Acidobacterial 44.1 19 0.00047 14.8 7.5 26 70-95 378-403 (803) 18 TIGR01193 bacteriocin_ABC ABC- 42.6 20 0.0005 14.6 2.6 53 3-55 181-236 (710) 19 pfam06835 DUF1239 Protein of u 41.3 9.3 0.00024 16.3 0.5 42 172-214 67-110 (176) 20 TIGR02840 spore_YtaF putative 34.7 27 0.00068 13.9 8.9 72 278-354 140-214 (215) 21 TIGR03024 arch_pef_cterm PEF-C 33.7 23 0.00058 14.3 1.5 23 59-81 3-25 (28) 22 PHA00442 host recBCD nuclease 33.5 25 0.00063 14.1 1.6 22 79-100 22-44 (59) 23 KOG2289 consensus 33.4 28 0.00072 13.8 2.0 62 282-346 137-201 (316) 24 COG5232 SEC62 Preprotein trans 33.1 23 0.00058 14.3 1.4 28 279-306 155-182 (259) 25 TIGR00847 ccoS cytochrome oxid 28.6 34 0.00087 13.4 2.0 14 63-76 4-17 (53) 26 PRK09546 zntB zinc transporter 27.0 33 0.00084 13.4 1.4 43 317-359 276-324 (327) 27 COG0577 SalY ABC-type antimicr 26.1 38 0.00097 13.1 5.0 38 67-104 73-111 (419) 28 TIGR02380 ECA_wecA undecapreny 25.6 39 0.001 13.0 6.1 75 45-119 46-136 (349) 29 KOG2881 consensus 25.6 39 0.001 13.0 8.0 16 342-357 275-290 (294) 30 PRK13453 F0F1 ATP synthase sub 24.4 41 0.001 12.9 3.8 54 85-138 5-58 (173) 31 pfam06738 DUF1212 Protein of u 21.7 47 0.0012 12.6 10.2 84 245-343 80-163 (193) No 1 >pfam03739 YjgP_YjgQ Predicted permease YjgP/YjgQ family. Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long and contain about 6 transmembrane regions. They are predicted to be permeases although there is no verification of this. Probab=100.00 E-value=0 Score=410.44 Aligned_cols=344 Identities=19% Similarity=0.304 Sum_probs=310.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 99999999999999999999999999999999873037999899999999986899999999999999999999987401 Q gi|255764469|r 7 RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTS 86 (361) Q Consensus 7 RYi~k~~l~~f~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~lP~~l~~~lP~a~lla~i~~~~~l~~~~ 86 (361) ||++|+++++|+.+++++++++++.|+++.++++.+ ++.++..++.++++++|..+.+++|+|+++|+++++++|++|| T Consensus 1 RYi~k~~l~~fl~~~~~~~~l~~~~~~~~~l~~~~~-~~~~~~~~~~~~~~~lP~~l~~~lP~s~lia~l~~~~~L~~~~ 79 (353) T pfam03739 1 RYILREFLKPFLLVLLVLLLLFLLVDLLRLLDLILG-GGLPLADILRLLLLLLPSILELILPLALLLAVLLTLGRLARDS 79 (353) T ss_pred CEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 923899999999999999999999999999999971-8999999999999988999999999999999999999998426 Q ss_pred CHHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCEECCCCCCHHHHHHC Q ss_conf 02577661635012332101135899999986414344288999999998530255543233652000112211233200 Q gi|255764469|r 87 ELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGA 166 (361) Q Consensus 87 El~al~a~GiS~~~i~~p~l~~~~~i~~~~~~~~~~i~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~ 166 (361) |++||+|||+|.+|+++|+++++++++++.+.+++++.|+++++.++.+++...+......+++.|.++++ +.++++ T Consensus 80 El~a~~a~GiS~~~i~~p~l~~~~~~~~~~~~~~~~v~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~i~i 156 (353) T pfam03739 80 ELTALRAAGISLKRLLRPVLILALLLSLLSFLLSEYLVPYANQKLEQLLAEILSKAPSLLLRPGLFLRDGD---GLIIYV 156 (353) T ss_pred HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCCHHCCCCCEEEECCC---CEEEEE T ss_conf 48999983899066789999999999999999854030699999999999986066200147980698699---779999 Q ss_pred CCCCCHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCC----CCCCCCCCCEEEECCCCCC-----CCCCCCCCCCCCHHHH Q ss_conf 001210122000001211112202444420111145----7851111624511232321-----0000000001013577 Q gi|255764469|r 167 KKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIY----NDKVKLKKVVEYQYGRIPI-----DKNSTTLNIPIKMDGF 237 (361) Q Consensus 167 ~~~~~~~~~~~~v~i~~~~~~~~~~~~i~A~~~~~~----~~~~~l~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~ 237 (361) ++.+++++.++|+++++.++ ++..++++|++|.++ ++.|.++|+..++.++... ..++.+.+.+.+++.. T Consensus 157 ~~~~~~~~~l~~v~i~~~~~-~~~~~~i~A~~a~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~ 235 (353) T pfam03739 157 KKVDPDGRLLEGVFIYDFRD-GGLTSVITAKSATLDSDPNGGVWILENGTIYRFDKDGEELSILSFDRYEIDLSLTPKDL 235 (353) T ss_pred EEECCCCCEEEEEEEEEECC-CCCEEEEEECEEEEEECCCCCEEEEECCEEEEECCCCCCEEEEEEEEEEEECCCCHHHH T ss_conf 99838998686589998069-98359999681899865999779997559999548997257776113785446887776 Q ss_pred HHHHHCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH Q ss_conf 75320235677899999997533116520457766777653244899999999999750412243137999999999999 Q gi|255764469|r 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFM 317 (361) Q Consensus 238 ~~~~~~~~~~s~~~l~~~i~~~~~~~~~~~~~~~~~~~~r~a~Pl~~~~l~lla~~l~~~~~R~~~~~~~i~~~i~~~~~ 317 (361) .....++++++++|+.+.++..++ .+.+..++++|+|+|++.|++|++|+++|+|++...+|+|+ +..++.|++++++ T Consensus 236 ~~~~~~~~~ls~~~L~~~i~~~~~-~~~~~~~~~~~~~~r~~~pl~~l~l~ll~~~l~~~~~R~~~-~~~~~~~l~~~~~ 313 (353) T pfam03739 236 SSLTADPEELSLSELYAYIKRLKA-SGLDVRKYRAELHRRLALPLSCLVLALLALPLGLGSPRSGR-GAGLVLAILLGFL 313 (353) T ss_pred HHHCCCHHHHHHHHHHHHHHHHHH-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC-HHHHHHHHHHHHH T ss_conf 441288788778999999999986-67761146999999999899999999999998316766772-6999999999999 Q ss_pred HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999975078379699999999999999999987 Q gi|255764469|r 318 LYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357 (361) Q Consensus 318 ~y~l~~~~~~l~~~g~l~p~~a~w~P~~~~~~~~~~ll~~ 357 (361) ||.+..++.++|++|.+||++|+|+|++++..+|++++.| T Consensus 314 y~~l~~~~~~l~~~~~i~p~~a~w~p~~i~~~i~~~l~~r 353 (353) T pfam03739 314 YYVLLFLGEALGENGVLPPLLAAWLPNLLFLLLGLYLLLR 353 (353) T ss_pred HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCC T ss_conf 9999999999997499019999999999999999999709 No 2 >COG0795 Predicted permeases [General function prediction only] Probab=100.00 E-value=0 Score=368.03 Aligned_cols=356 Identities=22% Similarity=0.323 Sum_probs=298.2 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 43788999999999999999999999999999999998730379998999999999868999999999999999999999 Q gi|255764469|r 2 PGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFN 81 (361) Q Consensus 2 pkIl~RYi~k~~l~~f~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~lP~~l~~~lP~a~lla~i~~~~~ 81 (361) +++++||+.|+++++++.+++++++++++.++++.+++....++++...++.++.+++|..+.+++|+|+++|++++++| T Consensus 1 m~~l~rYl~r~~l~~~l~~ll~l~~i~~~~~~~~~~~~~~~~g~~~~~~~~~l~~l~iP~~l~~~lP~a~lia~l~~l~~ 80 (364) T COG0795 1 MMLLDRYLLREYLKTFLAILLVLLAILLIIDLLELLNGKAVDGRYPALDVLLLLLLSLPTLLPLVLPLALLIAALLTLGR 80 (364) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 90899999999999999999999999999999999998872378799999999999878999999889999999999999 Q ss_pred HHHHCCHHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCC-CCCCCCCEECCCCCCH Q ss_conf 874010257766163501233210113589999998641434428899999999853025554-3233652000112211 Q gi|255764469|r 82 LNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDK-QKSDIIPWMQISNPQQ 160 (361) Q Consensus 82 l~~~~El~al~a~GiS~~~i~~p~l~~~~~i~~~~~~~~~~i~p~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~ 160 (361) |++|||++||+|||+|.+|+++|++..+++++++.+.+++|+.|+++++.++.+++.+++... ...+.+.|.++++. T Consensus 81 L~~~sEl~vl~A~GvS~~~li~p~l~~al~~~~l~~~~~~~l~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-- 158 (364) T COG0795 81 LSRESELVVLRASGVSLKRLLRPVLILALLLSLLSFVLGLWLAPWAEQKARELLAQAKAGGPSLGSVEGGFWAKDGND-- 158 (364) T ss_pred HHHCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-- T ss_conf 750371999988289889999999999999999999983843877999999999998448864111256512037984-- Q ss_pred HHHHHCCCCCCHHHHHCCCCCCCCCCCCCHHHHHHHCCCCC--CCCCCCCCCCEEEECCCCCCCC--CCCCCC-CCCCHH Q ss_conf 23320000121012200000121111220244442011114--5785111162451123232100--000000-010135 Q gi|255764469|r 161 DIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII--YNDKVKLKKVVEYQYGRIPIDK--NSTTLN-IPIKMD 235 (361) Q Consensus 161 ~~~i~~~~~~~~~~~~~~v~i~~~~~~~~~~~~i~A~~~~~--~~~~~~l~~~~~~~~~~~~~~~--~~~~~~-~~~~~~ 235 (361) .++++++.+.+++.+.++.++..|++++......++.+.. +|+.|.+++.+...+++..... ...+.+ ...... T Consensus 159 -~~~~~~~~~~~~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~ 237 (364) T COG0795 159 -SLIFIESIDRDGNKLQGVFIKRFDDNGRLSVVYAAEGALFELEDGSWILELVDGTRYEGTPKEGDSRIVDFDWYTLLLP 237 (364) T ss_pred -EEEEEEEECCCCCEECCEEEEEECCCCCCCEEEHHCCCCCCCCCCEEEEEECCCEEECCCCCCCCCCCCCCHHHCCCCC T ss_conf -2899988627876451578981257777413441003200168971688705540443656556635234423214673 Q ss_pred HH--HHHHHCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH Q ss_conf 77--7532023567789999999753311652045776677765324489999999999975041224313799999999 Q gi|255764469|r 236 GF--QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIF 313 (361) Q Consensus 236 ~~--~~~~~~~~~~s~~~l~~~i~~~~~~~~~~~~~~~~~~~~r~a~Pl~~~~l~lla~~l~~~~~R~~~~~~~i~~~i~ 313 (361) .. .+....++..+..++.+.....+. ...+...+++|+|+|++.|++|++|+++|+|++...+|+++.+..+..+++ T Consensus 238 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~~~~~el~~r~a~pl~~~~~~lla~~l~~~~~R~~~~~~~~~~~i~ 316 (364) T COG0795 238 DLLIREALLSPKALSLSELPTYILLNKD-NGQDRKTLLAELYRRLALPLLVLAMALLALPLSLRNPRSGRLGLRLLGGIL 316 (364) T ss_pred HHHHHHHHCCCCCCCHHHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH T ss_conf 3332114307742106777667754032-540147999999999999999999999999985125545343999999999 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 999999999999999750783796999999999999999999875079 Q gi|255764469|r 314 SGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361 (361) Q Consensus 314 ~~~~~y~l~~~~~~l~~~g~l~p~~a~w~P~~~~~~~~~~ll~~~e~~ 361 (361) ++++||.+..++..++.+|.+||++|+|.|+++++.+|.+++.|.+++ T Consensus 317 ~~~~~~~~~~~~~~~~~~~~l~p~~a~~~p~~v~l~~~~~l~~~~~~~ 364 (364) T COG0795 317 LGLLFYVLLFLLGALALAGKLPPFLAAWLPNLVFLALGLWLLRRKERR 364 (364) T ss_pred HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 999999999999999973782279999999999999999999851069 No 3 >COG4591 LolE ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane] Probab=90.89 E-value=0.84 Score=21.87 Aligned_cols=25 Identities=20% Similarity=0.268 Sum_probs=10.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 9999999999999999999874010 Q gi|255764469|r 63 IQQIIPFITLVVNIVVFFNLNRTSE 87 (361) Q Consensus 63 l~~~lP~a~lla~i~~~~~l~~~~E 87 (361) +...+-+++++-++-+.+-+.++-| T Consensus 31 ~GI~lgV~~LIv~lsvmnGf~~el~ 55 (408) T COG4591 31 IGIALGVAVLIVVLSVMNGFQKELE 55 (408) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999889999999998856799998 No 4 >PRK10814 outer membrane-specific lipoprotein transporter subunit LolC; Provisional Probab=86.01 E-value=1.9 Score=20.03 Aligned_cols=11 Identities=9% Similarity=0.032 Sum_probs=4.5 Q ss_pred HHHHHHHHHHH Q ss_conf 78899999999 Q gi|255764469|r 4 ILWRYFFKYYL 14 (361) Q Consensus 4 Il~RYi~k~~l 14 (361) =+..||.++|+ T Consensus 4 ~~~~fIA~RYl 14 (396) T PRK10814 4 PVALFIGLRYM 14 (396) T ss_pred CHHHHHHHHHC T ss_conf 19999999975 No 5 >pfam02687 FtsX Predicted permease. This is a family of predicted permeases and hypothetical transmembrane proteins. The lipoprotein-releasing system transmembrane protein lolC from Buchnera aphidicola has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both lolC and an ATP-binding cassette transporter-like protein from Streptococcus cristatus have been shown to require ATP. Probab=82.06 E-value=2.8 Score=19.09 Aligned_cols=52 Identities=23% Similarity=0.360 Sum_probs=36.7 Q ss_pred HHHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHCCCCC Q ss_conf 9999999998740102577661635012332101135899999986414344 Q gi|255764469|r 73 VVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124 (361) Q Consensus 73 la~i~~~~~l~~~~El~al~a~GiS~~~i~~p~l~~~~~i~~~~~~~~~~i~ 124 (361) +...+...-..+..|+-.+++.|.+.+++.+.++.-+++++++.....-.+. T Consensus 68 i~~~~~~~i~~r~~ei~ilka~G~~~~~i~~~~~~e~~~~~~~~~~~g~~~~ 119 (174) T pfam02687 68 LLNLLSISIAERRREIGILKALGASKKQIFKLLLLEALLLGLIGSLLGLLLG 119 (174) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999992999999999999999999999999999999 No 6 >PRK11026 ftsX cell division protein FtsX; Provisional Probab=80.03 E-value=3.3 Score=18.70 Aligned_cols=12 Identities=8% Similarity=0.207 Sum_probs=4.3 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999999 Q gi|255764469|r 317 MLYTIITIMKSF 328 (361) Q Consensus 317 ~~y~l~~~~~~l 328 (361) .++.+......+ T Consensus 251 ~~~~~~~~~~~l 262 (309) T PRK11026 251 LVLYLSSAVKYV 262 (309) T ss_pred HHHHHHHHHHHH T ss_conf 999999899999 No 7 >TIGR02212 lolCE lipoprotein releasing system, transmembrane protein, LolC/E family; InterPro: IPR011925 This entry describes the LolC protein, and its paralog LolE found in some species. These proteins are homologous to permease proteins of ABC transporters. In some species, two paralogs occur, designated LolC and LolE. In others, a single form is found and tends to be designated LolC .; GO: 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane. Probab=79.79 E-value=3.4 Score=18.66 Aligned_cols=38 Identities=16% Similarity=0.115 Sum_probs=16.3 Q ss_pred CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCCC Q ss_conf 11358999999864143442889999999985302555432 Q gi|255764469|r 106 VVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQK 146 (361) Q Consensus 106 l~~~~~i~~~~~~~~~~i~p~~~~~~~~~~~~~~~~~~~~~ 146 (361) ...|+.+|...+++ +....|--.+|++++..+-.+... T Consensus 27 S~iGI~LGVaaLIv---VlSVMNGFe~eL~~riLg~~PH~~ 64 (414) T TIGR02212 27 SIIGIALGVAALIV---VLSVMNGFERELRQRILGVIPHAI 64 (414) T ss_pred HHHHHHHHHHHHHH---HHHHHHHHHHHHHCCCEEECCCEE T ss_conf 99999998888666---666666679988207410126188 No 8 >pfam02405 DUF140 Domain of unknown function DUF140. This domain has no known function nor do any of the proteins that possess it. The aligned region is approximately 150 amino acids long. Probab=77.59 E-value=4 Score=18.29 Aligned_cols=99 Identities=14% Similarity=0.157 Sum_probs=57.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH--HH------HHHHHHHHHHHHC Q ss_conf 999999999999999999999999873037999899999999986899999999999--99------9999999987401 Q gi|255764469|r 15 KTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFIT--LV------VNIVVFFNLNRTS 86 (361) Q Consensus 15 ~~f~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~lP~~l~~~lP~a~--ll------a~i~~~~~l~~~~ 86 (361) .+.......+.+..+..+....++++.. +.-...+.-.. .+.+.-|+-. ++ +.---++.|.-+. T Consensus 15 l~iv~~~~~~~G~v~~~q~~~~l~~~G~--~~~ig~~~~~~------~vRElgP~ltalilagR~Gsa~aAElGtM~v~e 86 (215) T pfam02405 15 LPIVALTAFFIGAVLALQGAYQLRQFGA--ESFVGALVALS------LVRELGPVLTALLVAGRVGSAITAELGTMRVTE 86 (215) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCH--HHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999998491--89999999999------999998999999999987139999998726988 Q ss_pred CHHHHHHHCCCHHHH-HHHCCHHHHHHHHHHHHHCC Q ss_conf 025776616350123-32101135899999986414 Q gi|255764469|r 87 ELVISRAIGISIWQL-LNPFVVGSILLGIFTVLVIN 121 (361) Q Consensus 87 El~al~a~GiS~~~i-~~p~l~~~~~i~~~~~~~~~ 121 (361) |+.|+++.|+++.+. ..|=++.+.+.........+ T Consensus 87 eIDAL~~mgi~P~~yLv~PRvlA~~i~~p~L~i~~~ 122 (215) T pfam02405 87 EIDALEVMGIDPIRYLVLPRVLAGVIALPLLTIIAD 122 (215) T ss_pred HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999848992477659899999999999999999 No 9 >TIGR00439 ftsX putative protein insertion permease FtsX; InterPro: IPR004513 FtsX is an integral membrane protein encoded in the same operon as signal recognition particle docking protein FtsY and FtsE. FtsE is a hydrophilic nucleotide-binding protein that associates with the inner membrane by means of association with FtsX; FtsE mutants are viable only in high salt, supporting possible roles in cell division, as previously indicated, or in transport.; GO: 0007049 cell cycle, 0016021 integral to membrane. Probab=74.32 E-value=4.9 Score=17.80 Aligned_cols=46 Identities=4% Similarity=0.088 Sum_probs=29.9 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHCCHHHHHHHC Q ss_conf 9989999999998689999999999999---9999999987401025776616 Q gi|255764469|r 46 YSISRGAVLAATRVPLIIQQIIPFITLV---VNIVVFFNLNRTSELVISRAIG 95 (361) Q Consensus 46 ~~~~~~~~~~~~~lP~~l~~~lP~a~ll---a~i~~~~~l~~~~El~al~a~G 95 (361) .++..++.++.. .+.+++|.-+.+ +.-.+.++++.+.|+|+-.--- T Consensus 31 ~pFgTlLT~~vi----AvslTlP~v~Yl~~kn~~~a~t~~ypspqiTvYl~k~ 79 (314) T TIGR00439 31 KPFGTLLTVLVI----AVSLTLPLVSYLVYKNVQSALTQLYPSPQITVYLEKA 79 (314) T ss_pred CCCHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH T ss_conf 883479999999----9998657999999885777742017884035787750 No 10 >TIGR01517 ATPase-IIB_Ca calcium-translocating P-type ATPase, PMCA-type; InterPro: IPR006408 This family describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes , out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes . In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects . The calcium P-type ATPases have been characterised as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump .; GO: 0005388 calcium-transporting ATPase activity, 0005509 calcium ion binding, 0005524 ATP binding, 0015085 calcium ion transmembrane transporter activity, 0006816 calcium ion transport, 0016020 membrane. Probab=65.17 E-value=0.75 Score=22.12 Aligned_cols=73 Identities=15% Similarity=0.034 Sum_probs=43.2 Q ss_pred HHHHHHHHHHHHHHHHH-HHHHHHHHHCCCCCCHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH Q ss_conf 99999999999999999-99999987303799989999999998---689999999999999999999998740102577 Q gi|255764469|r 16 TTLYFLLGAMILVFVID-LNEIQNQMGELPNYSISRGAVLAATR---VPLIIQQIIPFITLVVNIVVFFNLNRTSELVIS 91 (361) Q Consensus 16 ~f~~~~~~~~~l~~~~~-~~~~l~~~~~~~~~~~~~~~~~~~~~---lP~~l~~~lP~a~lla~i~~~~~l~~~~El~al 91 (361) -+.+..++++.++++.. +++.. .+........++.++..- +-=.+++.||+|+=+|--+..-||.+||-++=- T Consensus 275 ~~G~g~A~l~f~~L~~~~v~~~~---~~~~~~~~~~f~~~Fi~~vTi~VVAVPEGLPLAVT~aLAy~~kkm~~DnNLVR~ 351 (885) T TIGR01517 275 KFGLGSAVLLFLVLVLRYVIEII---VEDTEEDAQTFLDLFIIAVTIVVVAVPEGLPLAVTLALAYSMKKMMKDNNLVRH 351 (885) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH---CCCCHHHHHHHHHEEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCC T ss_conf 89999999999999998786531---489888999986402577899999717986289999999864565101200000 No 11 >PRK11146 outer membrane-specific lipoprotein transporter subunit LolE; Provisional Probab=65.16 E-value=8 Score=16.70 Aligned_cols=23 Identities=13% Similarity=0.186 Sum_probs=12.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999987 Q gi|255764469|r 61 LIIQQIIPFITLVVNIVVFFNLN 83 (361) Q Consensus 61 ~~l~~~lP~a~lla~i~~~~~l~ 83 (361) .++...+.++.++.++-+++=+. T Consensus 28 S~lGIaigv~~livvlSv~nGf~ 50 (412) T PRK11146 28 STIGIALGVAVLIVGLSAMNGFE 50 (412) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999997589 No 12 >TIGR00869 sec62 protein translocation protein, Sec62 family; InterPro: IPR011553 Members of the NSCC2 family have been sequenced from various fungal and animal species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens. These proteins are the Sec62 proteins, believed to be associated with the Sec61 and Sec63 constituents of the general protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins have been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions. This family of Sec62 proteins is restricted to the Ascomycota. ; GO: 0008565 protein transporter activity, 0015031 protein transport, 0030176 integral to endoplasmic reticulum membrane. Probab=54.59 E-value=12 Score=15.67 Aligned_cols=32 Identities=19% Similarity=0.236 Sum_probs=21.8 Q ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH Q ss_conf 53244899999999999750412243137999 Q gi|255764469|r 277 LIVIPLMLVAMTLIAASVSLEFSRSNQPRIIV 308 (361) Q Consensus 277 r~a~Pl~~~~l~lla~~l~~~~~R~~~~~~~i 308 (361) .++--+..++++++..||=-.+-|+|.....+ T Consensus 126 l~~~l~v~~ilAlVlfPLWP~fmR~G~wYlS~ 157 (259) T TIGR00869 126 LLVVLVVSVILALVLFPLWPIFMRRGSWYLSL 157 (259) T ss_pred HHHHHHHHHHHHHHHHCCCHHHHHCCCHHHHH T ss_conf 99999999999987402121456355120045 No 13 >PRK06591 putative monovalent cation/H+ antiporter subunit D; Reviewed Probab=54.31 E-value=12 Score=15.77 Aligned_cols=12 Identities=17% Similarity=0.119 Sum_probs=4.3 Q ss_pred HHHHHHHHHHHH Q ss_conf 999999999987 Q gi|255764469|r 346 LTISLSILILLQ 357 (361) Q Consensus 346 ~~~~~~~~ll~~ 357 (361) +...++.+.++| T Consensus 408 i~s~lt~~Y~~r 419 (433) T PRK06591 408 LSSVGSLFYHYK 419 (433) T ss_pred HHHHHHHHHHHH T ss_conf 999999999999 No 14 >COG0598 CorA Mg2+ and Co2+ transporters [Inorganic ion transport and metabolism] Probab=49.76 E-value=8.4 Score=16.57 Aligned_cols=69 Identities=17% Similarity=0.222 Sum_probs=31.7 Q ss_pred HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CC----HHHHHHHHHHH--HHHHHHHHHHHHH Q ss_conf 99999997504122431379999999999999999999999975078-37----96999999999--9999999998750 Q gi|255764469|r 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGI-LL----PVAAALIPVIL--TISLSILILLQKE 359 (361) Q Consensus 287 l~lla~~l~~~~~R~~~~~~~i~~~i~~~~~~y~l~~~~~~l~~~g~-l~----p~~a~w~P~~~--~~~~~~~ll~~~e 359 (361) =.+.....+....|.... ..+...+. .++-....++...|-|-. +| |+ |.|+--++ .+.+..+.++||. T Consensus 244 ~~l~d~~~s~is~~~N~i-mk~LTi~s--~iflPpTlIagiyGMNf~~mPel~~~~-Gy~~~l~~m~~~~~~~~~~frrk 319 (322) T COG0598 244 SSLLDAYLSLINNNQNEI-MKILTIVS--TIFLPPTLITGFYGMNFKGMPELDWPY-GYPIALILMLLLALLLYLYFRRK 319 (322) T ss_pred HHHHHHHHHHHHHHHHHH-HHHHHHHH--HHHHHHHHHHHHCCCCCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999-99999999--999999999822136889998878825-89999999999999999999983 No 15 >TIGR00383 corA magnesium and cobalt transport protein CorA; InterPro: IPR004488 The CorA transport system is the primary Mg2+ influx system of Salmonella typhimurium and Escherichia coli. It has an unusual membrane topology, with a large, soluble, highly charged periplasmic N-terminal domain with three transmembrane segments in a shorter, hydrophobic C-terminal domain. It has been suggested that the CorA Mg2+ transport system forms the major Mg2+ uptake system in the bacteria and archaea but that some family members may have a function other than Mg2+ transport .; GO: 0015087 cobalt ion transmembrane transporter activity, 0015095 magnesium ion transmembrane transporter activity, 0006824 cobalt ion transport, 0015693 magnesium ion transport, 0016020 membrane. Probab=48.15 E-value=12 Score=15.83 Aligned_cols=67 Identities=15% Similarity=0.251 Sum_probs=35.3 Q ss_pred HHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CCHH----HHHHHHHHHHHHHHH--HHHHH Q ss_conf 999997504122431379999999999999999999999975078-----3796----999999999999999--99987 Q gi|255764469|r 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGI-----LLPV----AAALIPVILTISLSI--LILLQ 357 (361) Q Consensus 289 lla~~l~~~~~R~~~~~~~i~~~i~~~~~~y~l~~~~~~l~~~g~-----l~p~----~a~w~P~~~~~~~~~--~ll~~ 357 (361) +-=+.++....|..+. ..+++ + +..+|--...++..-|-|=. -=|. .|.|..-.+|+.+++ ++++| T Consensus 258 L~d~~~s~~s~~mN~I-mK~lT-v-vs~iFiPlTfIAg~YGMNF~pdkpwfMPEL~w~yGY~~~l~vM~~~~~~~~~~F~ 334 (339) T TIGR00383 258 LMDLYLSLVSNKMNEI-MKILT-V-VSTIFIPLTFIAGIYGMNFKPDKPWFMPELNWKYGYPAVLIVMAVIALGMLIFFR 334 (339) T ss_pred HHHHHHHHHHHHHHHH-HHHHH-H-HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 9999998887988689-99999-9-9999860245203156468887886575545777559999999999988773352 Q ss_pred H Q ss_conf 5 Q gi|255764469|r 358 K 358 (361) Q Consensus 358 ~ 358 (361) | T Consensus 335 R 335 (339) T TIGR00383 335 R 335 (339) T ss_pred C T ss_conf 0 No 16 >PRK11085 magnesium/nickel/cobalt transporter CorA; Provisional Probab=46.67 E-value=11 Score=15.94 Aligned_cols=69 Identities=14% Similarity=0.163 Sum_probs=32.9 Q ss_pred HHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH----HHHHHHHHH--HHHHHHHHHHHHH Q ss_conf 99999975041224313799999999999999999999999750783796----999999999--9999999998750 Q gi|255764469|r 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPV----AAALIPVIL--TISLSILILLQKE 359 (361) Q Consensus 288 ~lla~~l~~~~~R~~~~~~~i~~~i~~~~~~y~l~~~~~~l~~~g~l~p~----~a~w~P~~~--~~~~~~~ll~~~e 359 (361) .++-+.+++...++... ..++..+.+ ++-.-..++...|-|-.-=|. .|.|+...+ ...++.+..+||. T Consensus 239 ~llda~lg~i~i~qN~i-~Kiltv~a~--if~ppTlIagIYGMNF~~mPel~~~~gy~~~~~~m~~~~~~~~~~Fk~k 313 (316) T PRK11085 239 FLMQAAMGFINIEQNRI-IKIFSVVSV--VFLPPTLVASSYGMNFEFMPELKWSFGYPGAIILMILAGLAPYLYFKRK 313 (316) T ss_pred HHHHHHHHHHHHHHHHH-HHHHHHHHH--HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 99999988877998999-999999999--9986999982513687878554775159999999999999999999873 No 17 >TIGR03434 ADOP Acidobacterial duplicated orphan permease. Members of this protein family are found, so far, only in three species of Acidobacteria, namely Acidobacteria bacterium Ellin345, Acidobacterium capsulatum ATCC 51196, and Solibacter usitatus Ellin6076, where they form large paralogous families. Each protein contains two copies of a domain called the efflux ABC transporter permease protein (pfam02687). However, unlike other members of that family (including LolC, FtsX, and MacB), genes for these proteins are essentially never found fused or adjacent to ABC transporter ATP-binding protein (pfam00005) genes. We name this family ADOP, for Acidobacterial Duplicated Orphan Permease, to reflect the restricted lineage, internal duplication, lack of associated ATP-binding cassette proteins, and permease homology. The function is unknown. Probab=44.12 E-value=19 Score=14.75 Aligned_cols=26 Identities=12% Similarity=0.106 Sum_probs=17.0 Q ss_pred HHHHHHHHHHHHHHHHCCHHHHHHHC Q ss_conf 99999999999987401025776616 Q gi|255764469|r 70 ITLVVNIVVFFNLNRTSELVISRAIG 95 (361) Q Consensus 70 a~lla~i~~~~~l~~~~El~al~a~G 95 (361) ..+++.++--.++++-+=.-++|.++ T Consensus 378 ~~llag~~PA~~~s~~~p~~~Lk~~~ 403 (803) T TIGR03434 378 TGLLFGLAPALQATRSDLAEALKEGG 403 (803) T ss_pred HHHHHHHHHHHHHCCCCHHHHHHHCC T ss_conf 99999999999981678899987526 No 18 >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter; InterPro: IPR005897 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains ABC-type bacteriocin transporter. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. Peptide bacteriocins are exported across the cytoplasmic membrane by a dedicated ATP-binding cassette (ABC) transporter. These ABC-transporters have an N-terminal peptidase domain that belong to MEROPS peptidase family C39 (clan CA); a central multi-pass transmembrane region and a C-terminal ABC transporter domain. These transporters have dual function: (i) they remove the N-terminal leader peptide from its bacteriocin precursor by cleavage at a Gly-Gly bond and (ii) transport the mature bacteriocin across the cytoplasmic membrane. This represents a novel strategy for secretion of bacterial proteins . Many bacteria are known to regulate diverse physiological processes through this system, such as bioluminescence, regulation of sporulation, virulence factor expression, antibiotics production, competence for genetic transformation, and activation of biofilm formation .; GO: 0008234 cysteine-type peptidase activity, 0019534 toxin transporter activity, 0006810 transport, 0016020 membrane. Probab=42.62 E-value=20 Score=14.62 Aligned_cols=53 Identities=11% Similarity=0.060 Sum_probs=32.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCCCHHHHHHHH Q ss_conf 37889999999999999999999999999999999987303---799989999999 Q gi|255764469|r 3 GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGEL---PNYSISRGAVLA 55 (361) Q Consensus 3 kIl~RYi~k~~l~~f~~~~~~~~~l~~~~~~~~~l~~~~~~---~~~~~~~~~~~~ 55 (361) +|+|-||=...--+...+.+++...+.+.++++....+.-. ++++...++.|. T Consensus 181 ~iID~YIP~~m~~TLgIiS~GLI~aY~~Qq~~~y~q~fll~vlgQrL~~DIiL~YI 236 (710) T TIGR01193 181 KIIDTYIPHKMMNTLGIISIGLIVAYIIQQILSYIQSFLLIVLGQRLSIDIILSYI 236 (710) T ss_pred HHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 56655065133672357788999999999999999999998722456788998876 No 19 >pfam06835 DUF1239 Protein of unknown function (DUF1239). This family consists of several hypothetical bacterial proteins of around 190 residues in length. The function of this family is unknown. Probab=41.33 E-value=9.3 Score=16.34 Aligned_cols=42 Identities=17% Similarity=0.056 Sum_probs=25.8 Q ss_pred HHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCCC--CCCCCCCEEE Q ss_conf 012200000121111220244442011114578--5111162451 Q gi|255764469|r 172 ENHIWEDFTSITIDKKNKIIHRKDADLAIIYND--KVKLKKVVEY 214 (361) Q Consensus 172 ~~~~~~~v~i~~~~~~~~~~~~i~A~~~~~~~~--~~~l~~~~~~ 214 (361) +...+.+..+..+++++ ..+.+.|++|.+.++ ...|.+.... T Consensus 67 ~~~~l~~P~~~~~~~~~-~~w~i~A~~g~~~~~~~~i~L~g~V~i 110 (176) T pfam06835 67 DTTEFTNPVLIIYQDGK-PPWTITADRAKLNKDGQTLYLYGNVVI 110 (176) T ss_pred CCEEEEEEEEEEECCCC-CEEEEEECEEEEECCCCEEEEECCEEE T ss_conf 96899963999977998-369999794999379969999899999 No 20 >TIGR02840 spore_YtaF putative sporulation protein YtaF; InterPro: IPR014205 This entry represents YtaF, which represents a protein family identified, at the time of the publication of the Carboxydothermus hydrogenoformans genome. The phylogenetic profile of the members matches the subset of the Firmicutes capable of forming endospores. These species include Bacillus anthracis, Clostridium tetani, Thermoanaerobacter tengcongensis, and Geobacillus kaustophilus.. Probab=34.71 E-value=27 Score=13.93 Aligned_cols=72 Identities=19% Similarity=0.201 Sum_probs=40.2 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHH-HHHHHHHHHHHHHHHHH Q ss_conf 32448999999999997504122431379999999999999999999999975078--3796-99999999999999999 Q gi|255764469|r 278 IVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGI--LLPV-AAALIPVILTISLSILI 354 (361) Q Consensus 278 ~a~Pl~~~~l~lla~~l~~~~~R~~~~~~~i~~~i~~~~~~y~l~~~~~~l~~~g~--l~p~-~a~w~P~~~~~~~~~~l 354 (361) +|..+=.+...+=|.-.++ .-....+..++.-....|.-...++..++.+- ..-- .+-|+|-++.+.+|++- T Consensus 140 ~ALsLDafGaGiGAsl~G~-----~p~~~~~~~~~~S~~fv~~G~~lG~~~~~~~~G~FT~~~~s~~l~G~~Li~lG~~~ 214 (215) T TIGR02840 140 IALSLDAFGAGIGASLLGL-----NPLATSILVAVMSFIFVSLGLKLGKKVSKVSIGKFTIKKFSTFLPGILLILLGVFR 214 (215) T ss_pred HHHHHHHHHHHHHHHHHCC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999899988611-----78999999999999999999988678874045313587788664899999999973 No 21 >TIGR03024 arch_pef_cterm PEF-C-terminal archaeal protein sorting domain. This domain, distantly related to the PEP-Cterm domain described in model TIGR02595, is found in Methanosarcina mazei in four different proteins, as well as in other archaea such as Methanococcoides burtonii. Several proteins with this domain have their genes only a short distance from a distant homology of EpsH, a proposed integral membrane transpeptidase. Probab=33.74 E-value=23 Score=14.31 Aligned_cols=23 Identities=13% Similarity=0.291 Sum_probs=14.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 68999999999999999999999 Q gi|255764469|r 59 VPLIIQQIIPFITLVVNIVVFFN 81 (361) Q Consensus 59 lP~~l~~~lP~a~lla~i~~~~~ 81 (361) +|.+=...+|++.++|..+.++| T Consensus 3 iPEFPTvAlPv~ailGl~f~f~r 25 (28) T TIGR03024 3 IPEFPTVALPVAAILGLMFFFQR 25 (28) T ss_pred CCCCCHHHHHHHHHHHHHHHHHH T ss_conf 87675258799999999999731 No 22 >PHA00442 host recBCD nuclease inhibitor Probab=33.49 E-value=25 Score=14.10 Aligned_cols=22 Identities=23% Similarity=0.505 Sum_probs=14.3 Q ss_pred HHHHHHHCCH-HHHHHHCCCHHH Q ss_conf 9998740102-577661635012 Q gi|255764469|r 79 FFNLNRTSEL-VISRAIGISIWQ 100 (361) Q Consensus 79 ~~~l~~~~El-~al~a~GiS~~~ 100 (361) +.+|.+++|+ -|++|||+..|. T Consensus 22 I~sLEkd~efL~al~acgvdnwd 44 (59) T PHA00442 22 IDSLEKENEFLKALKACGVDNWD 44 (59) T ss_pred HHHHHHHHHHHHHHHHCCCCCHH T ss_conf 99999658999999972876514 No 23 >KOG2289 consensus Probab=33.38 E-value=28 Score=13.80 Aligned_cols=62 Identities=18% Similarity=0.157 Sum_probs=32.7 Q ss_pred HHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH Q ss_conf 89999999999975041--22431379999999999-9999999999999750783796999999999 Q gi|255764469|r 282 LMLVAMTLIAASVSLEF--SRSNQPRIIVAYGIFSG-FMLYTIITIMKSFGKSGILLPVAAALIPVIL 346 (361) Q Consensus 282 l~~~~l~lla~~l~~~~--~R~~~~~~~i~~~i~~~-~~~y~l~~~~~~l~~~g~l~p~~a~w~P~~~ 346 (361) +.++...++|+|+-..+ -|-+-. ..+|.+.| +.-..+..-..+.|.+|-+=..+|+++++++ T Consensus 137 ~N~~~ql~iGi~LE~~~G~~RiglI---Yl~gg~aGSlls~l~d~~~~sVGASggvfaLlgA~Ls~l~ 201 (316) T KOG2289 137 LNMLSQLFIGIPLEQVHGFLRIGLI---YLAGGVAGSLLSSLFDPNSISVGASGGVFALLGAHLSNLL 201 (316) T ss_pred HHHHHHHHCCCCHHHHCCCEEEEEE---HHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHHHHHHHH T ss_conf 9999998326017763473588531---1246555388999864677422221789999999999998 No 24 >COG5232 SEC62 Preprotein translocase subunit Sec62 [Intracellular trafficking and secretion] Probab=33.13 E-value=23 Score=14.28 Aligned_cols=28 Identities=14% Similarity=0.066 Sum_probs=15.6 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCCHHHH Q ss_conf 2448999999999997504122431379 Q gi|255764469|r 279 VIPLMLVAMTLIAASVSLEFSRSNQPRI 306 (361) Q Consensus 279 a~Pl~~~~l~lla~~l~~~~~R~~~~~~ 306 (361) .--+..+++++.-.|+=-+..|+|.... T Consensus 155 ~~~fvlv~lalVlfplWPr~mr~g~~Y~ 182 (259) T COG5232 155 CGVFVLVTLALVLFPLWPRNMRQGLFYM 182 (259) T ss_pred HHHHHHHHHHHHHHHCCCHHHHCCEEEE T ss_conf 7999999999998732706765370366 No 25 >TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type; InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation . Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. . Probab=28.57 E-value=34 Score=13.35 Aligned_cols=14 Identities=21% Similarity=0.458 Sum_probs=5.7 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999999999999 Q gi|255764469|r 63 IQQIIPFITLVVNI 76 (361) Q Consensus 63 l~~~lP~a~lla~i 76 (361) +.+.+|+|+++|.+ T Consensus 4 L~~L~Pisl~lG~~ 17 (53) T TIGR00847 4 LTILIPISLLLGGV 17 (53) T ss_pred HHHHHHHHHHHHHH T ss_conf 57788999999999 No 26 >PRK09546 zntB zinc transporter; Reviewed Probab=27.00 E-value=33 Score=13.44 Aligned_cols=43 Identities=12% Similarity=0.121 Sum_probs=19.9 Q ss_pred HHHHHHHHHHHHHHH-CCCCH---HHHHHHH--HHHHHHHHHHHHHHHH Q ss_conf 999999999999750-78379---6999999--9999999999998750 Q gi|255764469|r 317 MLYTIITIMKSFGKS-GILLP---VAAALIP--VILTISLSILILLQKE 359 (361) Q Consensus 317 ~~y~l~~~~~~l~~~-g~l~p---~~a~w~P--~~~~~~~~~~ll~~~e 359 (361) ++.-+..++.-+|-| +.+|- ..|.|+- .++.+..+.+.++||. T Consensus 276 IFLPltfltGl~GMN~~gmPg~~~~~gf~~~~~~m~~~~~~~~~~frr~ 324 (327) T PRK09546 276 VFLPSTFLTGLFGVNLGGIPGGGWPFGFSIFCILLVVLIGGVAWWLKRS 324 (327) T ss_pred HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 9987999872214677999887886079999999999999999999983 No 27 >COG0577 SalY ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Probab=26.06 E-value=38 Score=13.10 Aligned_cols=38 Identities=16% Similarity=0.124 Sum_probs=15.4 Q ss_pred HHHHHHHHHHHHHHHHHHHC-CHHHHHHHCCCHHHHHHH Q ss_conf 99999999999999987401-025776616350123321 Q gi|255764469|r 67 IPFITLVVNIVVFFNLNRTS-ELVISRAIGISIWQLLNP 104 (361) Q Consensus 67 lP~a~lla~i~~~~~l~~~~-El~al~a~GiS~~~i~~p 104 (361) ......+...........++ |.......|.+..++... T Consensus 73 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~ 111 (419) T COG0577 73 IKILAFIFIVYSVSFLLSSREEFGLLLLGGLSKAQIVGL 111 (419) T ss_pred HHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEEEEEE T ss_conf 987665566653102202442136886055023379960 No 28 >TIGR02380 ECA_wecA undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase; InterPro: IPR012750 Members of this family are the WecA enzymes of enterobacterial common antigen (ECA) biosynthesis, undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase. This family represents one narrow clade, and closely related sequences outside this clade may represent enzymes that catalyse the same specific reaction, but in the context of different pathways. A His-rich motif in a cytosolic loop of this integral membrane protein, shown to be critical to enzymatic activity for WecA is variously present or absent in the clade that includes Bacillus subtilis TagO teichoic acid biosynthesis enzyme, which may catalyse the same reaction as WecA. ; GO: 0000287 magnesium ion binding, 0016780 phosphotransferase activity for other substituted phosphate groups, 0030145 manganese ion binding, 0009103 lipopolysaccharide biosynthetic process, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane. Probab=25.58 E-value=39 Score=13.05 Aligned_cols=75 Identities=19% Similarity=0.206 Sum_probs=35.9 Q ss_pred CCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--------------HHHHHHHCCCHHHHHHHCCHHH Q ss_conf 9998999-999999868999999999999999999999874010--------------2577661635012332101135 Q gi|255764469|r 45 NYSISRG-AVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSE--------------LVISRAIGISIWQLLNPFVVGS 109 (361) Q Consensus 45 ~~~~~~~-~~~~~~~lP~~l~~~lP~a~lla~i~~~~~l~~~~E--------------l~al~a~GiS~~~i~~p~l~~~ 109 (361) |.|+... +-+++..-|+.+...-=.=+-.+++...|-+=-..+ +++|+.++++...+=.-+-.-. T Consensus 46 GiSif~~nLc~~l~~~~~~i~~~~LyL~ca~~Lv~iG~lDDrfDisv~iR~~IQa~vs~vMi~~G~~~L~sLG~i~g~~e 125 (349) T TIGR02380 46 GISIFLTNLCITLLLHDELIPHLSLYLACATILVVIGVLDDRFDISVKIRLAIQAAVSIVMIQFGNIYLHSLGNIFGSKE 125 (349) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCHHHCCCCCCHHH T ss_conf 19999999999997755565103789999999999852320226782077999999999999854725231553020468 Q ss_pred HHHH-HHHHHH Q ss_conf 8999-999864 Q gi|255764469|r 110 ILLG-IFTVLV 119 (361) Q Consensus 110 ~~i~-~~~~~~ 119 (361) +.++ .+...+ T Consensus 126 l~LgP~~g~iI 136 (349) T TIGR02380 126 LTLGPLFGYII 136 (349) T ss_pred HHHHHHHHHHH T ss_conf 88876788999 No 29 >KOG2881 consensus Probab=25.58 E-value=39 Score=13.05 Aligned_cols=16 Identities=31% Similarity=0.436 Sum_probs=7.4 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999987 Q gi|255764469|r 342 IPVILTISLSILILLQ 357 (361) Q Consensus 342 ~P~~~~~~~~~~ll~~ 357 (361) ..-++|+.+|+..++. T Consensus 275 ~ggi~Fi~Fgl~~i~~ 290 (294) T KOG2881 275 IGGILFIIFGLVYIFQ 290 (294) T ss_pred ECCHHHHHHHHHHHHC T ss_conf 5118999999999714 No 30 >PRK13453 F0F1 ATP synthase subunit B; Provisional Probab=24.44 E-value=41 Score=12.93 Aligned_cols=54 Identities=15% Similarity=0.202 Sum_probs=39.3 Q ss_pred HCCHHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH Q ss_conf 010257766163501233210113589999998641434428899999999853 Q gi|255764469|r 85 TSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQW 138 (361) Q Consensus 85 ~~El~al~a~GiS~~~i~~p~l~~~~~i~~~~~~~~~~i~p~~~~~~~~~~~~~ 138 (361) .|-++.--++|+....++.-++.|.+++.++..+...|+.-....+.+.+.... T Consensus 5 ~~~~~~~~~~gidw~t~~~q~I~F~il~~ll~kf~~~pi~~~L~~R~~~I~~~l 58 (173) T PRK13453 5 ANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDI 58 (173) T ss_pred HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 788998820699789999999999999999999989899999999999999889 No 31 >pfam06738 DUF1212 Protein of unknown function (DUF1212). This family represents a conserved region within a number of hypothetical proteins of unknown function found in eukaryotes, bacteria and archaea. Some family members are membrane proteins. Probab=21.70 E-value=47 Score=12.63 Aligned_cols=84 Identities=15% Similarity=0.159 Sum_probs=40.5 Q ss_pred CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 56778999999975331165204577667776532448999999999997504122431379999999999999999999 Q gi|255764469|r 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITI 324 (361) Q Consensus 245 ~~~s~~~l~~~i~~~~~~~~~~~~~~~~~~~~r~a~Pl~~~~l~lla~~l~~~~~R~~~~~~~i~~~i~~~~~~y~l~~~ 324 (361) ++.+..|..+.++.-.+... ++...+.++...+.+..++.-. |+...-+..+.+.++.-+.+... T Consensus 80 ~~~~~~ea~~~L~~I~~~~~------------~y~~~~~~l~~~~~~~~fa~l~---gG~~~~~~~a~i~g~~~~~~~~~ 144 (193) T pfam06738 80 GEISLEEAHERLDEIDRAPP------------PYPRWLVVLAAGLASAAFAVLF---GGDWIDFLIAFLAGLLGGLLRQI 144 (193) T ss_pred CCCCHHHHHHHHHHHHHCCC------------CCCHHHHHHHHHHHHHHHHHHH---CCCHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999985788------------9987999999999999999998---79779999999999999999999 Q ss_pred HHHHHHHCCCCHHHHHHHH Q ss_conf 9999750783796999999 Q gi|255764469|r 325 MKSFGKSGILLPVAAALIP 343 (361) Q Consensus 325 ~~~l~~~g~l~p~~a~w~P 343 (361) ......+..+.+.+++.+. T Consensus 145 ~~~~~~~~~~~~~~aaf~~ 163 (193) T pfam06738 145 LAKRGLNPFVFEALAAFVA 163 (193) T ss_pred HHHCCCHHHHHHHHHHHHH T ss_conf 8761543899999999999 Done!