BLAST/PSIBLAST alignment of GI: 255764469 and GI: 190891135 at iteration 1
>gi|190891135|ref|YP_001977677.1| permease [Rhizobium etli CIAT 652] Length = 362
>gi|190696414|gb|ACE90499.1| putative permease protein [Rhizobium etli CIAT 652] Length = 362
 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ Y+ TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYVATTGWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362