BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764469|ref|YP_003064807.2| putative permease protein
[Candidatus Liberibacter asiaticus str. psy62]
         (361 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764469|ref|YP_003064807.2| putative permease protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254547820|gb|ACT56867.2| putative permease protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 361

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/361 (100%), Positives = 361/361 (100%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP
Sbjct: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI
Sbjct: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT
Sbjct: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
           SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF
Sbjct: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
           SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR
Sbjct: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
           SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED
Sbjct: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360

Query: 361 G 361
           G
Sbjct: 361 G 361


>gi|315122194|ref|YP_004062683.1| putative permease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495596|gb|ADR52195.1| putative permease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 321

 Score =  451 bits (1160), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 271/322 (84%), Gaps = 1/322 (0%)

Query: 40  MGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIW 99
           M ELP YS SRGA+L+ TR+PLIIQQ IPFI+L+V+++VFFNLNRT+ELVI+RA+G+SIW
Sbjct: 1   MSELPGYSTSRGAMLSVTRLPLIIQQTIPFISLIVSMIVFFNLNRTNELVITRAVGVSIW 60

Query: 100 QLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ 159
           QLL+PF  GS LLG+FT+LVINP+A SGEK+GI ++  W+ + D++  +IIPW+ I N +
Sbjct: 61  QLLSPFTTGSFLLGMFTILVINPMAVSGEKMGISMVNNWRTH-DQKTLEIIPWIHIENKK 119

Query: 160 QDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI 219
           +D FIGAKKILPE +I EDFT IT++K+N  I R+DA  AI+  + + LK+VVEY+YG +
Sbjct: 120 EDFFIGAKKILPEKNILEDFTFITVNKENDTIFRQDAHFAIVQKNNIYLKEVVEYKYGAL 179

Query: 220 PIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIV 279
           P+ KNST LNI IKM+ FQKF+EQF S SFYEIIKK+ FS++S++F NY +ETQFYF+I 
Sbjct: 180 PVFKNSTILNIAIKMNYFQKFTEQFTSHSFYEIIKKVIFSHQSSVFRNYFSETQFYFMIS 239

Query: 280 IPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           IP MLVAMTLIAA+VSLEF+RSNQPRIIV YG+ +GFMLYTIIT+MKSFGKSGILLP AA
Sbjct: 240 IPFMLVAMTLIAAAVSLEFNRSNQPRIIVTYGVCAGFMLYTIITLMKSFGKSGILLPFAA 299

Query: 340 ALIPVILTISLSILILLQKEDG 361
           ALIP+I  I LSI ILL+KEDG
Sbjct: 300 ALIPIISIICLSIFILLKKEDG 321


>gi|218460846|ref|ZP_03500937.1| putative permease protein [Rhizobium etli Kim 5]
          Length = 362

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 148/362 (40%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTAWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PFV GS+ LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFVAGSLALGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLVDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVIMRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|325292486|ref|YP_004278350.1| permease protein [Agrobacterium sp. H13-3]
 gi|325060339|gb|ADY64030.1| putative permease protein [Agrobacterium sp. H13-3]
          Length = 362

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 142/358 (39%), Positives = 219/358 (61%), Gaps = 2/358 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF K YL T ++FLLG   ++++ D +E   +M  +P YS+     L A R+PLI+Q
Sbjct: 6   LARYFLKRYLITAIWFLLGVSAIIYLADFSETARRMSSVPGYSVPGALGLTALRLPLILQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q IPFI L V +    +LNR  ELV++RA G+S WQ + PFV+G++ LGI +VLV+NPIA
Sbjct: 66  QTIPFIALFVGMTTLISLNRRYELVVTRAAGVSAWQFILPFVLGAVFLGILSVLVLNPIA 125

Query: 125 TSGEKIGIDLIQQWKDNGD-KQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G+   + +   W++ G   ++ DIIPWM+ S+  QD  IGAK       +  D   I 
Sbjct: 126 AWGQNRSLSMEAGWRNEGSGGRQQDIIPWMRQSSGGQDTIIGAKSFEDNGTMLLDVVLIH 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
           +DK   I+ R+DA  A + +    L  V E + G +P+ + ST ++  ++ +  Q+   Q
Sbjct: 186 LDKDGNIVSRQDAKSAKLEDGYWLLNGVAETRAGHVPVRQESTRISTNLRREFVQERMTQ 245

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             + +F+++  K+  + KS    +   ETQ++FL+  PL+LVAMTLIAA+VSL+FSR  Q
Sbjct: 246 TETVAFFDLSHKIEVA-KSFGLSSKALETQYHFLLSTPLLLVAMTLIAATVSLKFSRFAQ 304

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            R ++  GI SGF+LY +  ++++FG  G++ P  A  +PVI+ ++L   ILL +EDG
Sbjct: 305 SRSVILGGIVSGFVLYVVTVLVRAFGSGGVVPPTVAVWVPVIVALALGATILLHQEDG 362


>gi|86357091|ref|YP_468983.1| putative permease protein [Rhizobium etli CFN 42]
 gi|86281193|gb|ABC90256.1| putative permease protein [Rhizobium etli CFN 42]
          Length = 362

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 147/362 (40%), Positives = 220/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTGWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PF+ GS++LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLVLGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|327188011|gb|EGE55241.1| putative permease protein [Rhizobium etli CNPAF512]
          Length = 362

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 147/362 (40%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTGWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|190891135|ref|YP_001977677.1| permease [Rhizobium etli CIAT 652]
 gi|190696414|gb|ACE90499.1| putative permease protein [Rhizobium etli CIAT 652]
          Length = 362

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ Y+ TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYVATTGWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|241203948|ref|YP_002975044.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857838|gb|ACS55505.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 362

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/362 (39%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+G   + F++D +E   +M  LP Y+I  G ++ A R+P
Sbjct: 2   MFGTLSRYFFRRYLVTTGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGVLMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS++LG+ T+  +
Sbjct: 62  LILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLVLGLLTMAAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQESGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGQVILRQDAATAKLEDGYWQLNNVVERKPGEIPVRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMT IAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTFIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|222085452|ref|YP_002543982.1| permease protein [Agrobacterium radiobacter K84]
 gi|221722900|gb|ACM26056.1| permease protein [Agrobacterium radiobacter K84]
          Length = 361

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 214/357 (59%), Gaps = 1/357 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y+ TTL+F LG   LV++ID +E   ++  LP Y++  G ++ A R+P I+Q
Sbjct: 6   LGRYFFTRYIITTLWFFLGVTSLVYLIDFSETAGRLAGLPGYTVKIGLLMTAVRLPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PFI L V + V   LNR  ELVI+RA GIS+WQ + PFVVG+  +G+ T+L +NP+A
Sbjct: 66  QTVPFIALFVGMTVLIALNRRRELVIARAAGISVWQFMTPFVVGAFCVGLLTMLALNPVA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
             G++    +    + +   + +  IPW++ S+ + DI IGAK +L       +   I  
Sbjct: 126 AWGQRQAETMEADLRGDPSYRNTLSIPWLRQSDGKSDIIIGAKAVLDNGTTLMNVVFIHF 185

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
           D +  II R+DA  A + N    L  VVE   G IP  K++T +   +K D   +   Q 
Sbjct: 186 DSQGNIILRQDAQSAKLENGYWLLNSVVERAPGEIPAHKSTTQVRTNLKQDFVSERLAQP 245

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            + +FY++  +++ + KS        ETQF+ L+  P +LVAMTLIAA+VSL+FSR NQ 
Sbjct: 246 ETIAFYDLSNRIAIA-KSFGISTKALETQFHSLLSQPFLLVAMTLIAATVSLKFSRFNQS 304

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           R ++  GI SGF+LY +  ++K+FG SG++ P  A  IPVI+ ++    ILL +EDG
Sbjct: 305 RSVILGGILSGFVLYVVTVLVKAFGSSGVVPPFVATWIPVIVALAFGATILLHQEDG 361


>gi|116251334|ref|YP_767172.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255982|emb|CAK07063.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 362

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 144/362 (39%), Positives = 218/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+G   + F++D +E   +M  LP Y+I  G ++ A R+P
Sbjct: 2   MFGTLSRYFFRRYLVTTGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGVLMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T+  +
Sbjct: 62  LILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGLLTMAAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGQVILRQDAATAKLEDGYWQLNTVVERKPGEIPVRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMT IAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTFIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|15888447|ref|NP_354128.1| hypothetical protein Atu1107 [Agrobacterium tumefaciens str. C58]
 gi|15156139|gb|AAK86913.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 362

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 139/358 (38%), Positives = 218/358 (60%), Gaps = 2/358 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF K YL TT++F+LG   ++++ D +E   +M  LP YS+     L A R+PLI+Q
Sbjct: 6   LARYFLKRYLMTTIWFVLGVSSIIYLADFSETARRMSGLPGYSVPAALGLTALRLPLILQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PFI L V +    +LNR  ELV++RA GIS WQ + PFV+G++ +GI +V+V+NPIA
Sbjct: 66  QTVPFIALFVGMTTLISLNRRYELVVTRAAGISAWQFILPFVLGAVFIGILSVMVLNPIA 125

Query: 125 TSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G+   + +    + D G  ++ +IIPWM+ S+  +D  IGAK       +  D   I 
Sbjct: 126 AWGQNKSLAMEAGLRNDAGGGRQQEIIPWMRQSSGGKDTIIGAKSFEDNGTMLLDVVLID 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
           +DK   I+ RKDA  A + +    L  V E + G +P+ + S  ++  ++ +  Q+   Q
Sbjct: 186 VDKDGNIVSRKDAKSAKLEDGYWLLNGVSETRAGHVPVRQESMQISTNLRREFVQERMTQ 245

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             + +F+++  K+  + KS    +   ETQ++FL+  PL+LVAMTLIAA+VSL+FSR  Q
Sbjct: 246 TETVAFFDLSHKIEVA-KSFGLSSKALETQYHFLLSTPLLLVAMTLIAATVSLKFSRFAQ 304

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            R ++  GI SGF+LY +  ++++FG  G++ P  A  +PVI+ ++L   ILL +EDG
Sbjct: 305 SRSVILGGIVSGFVLYVVTVLVRAFGSGGVVPPTVAVWVPVIVALALGATILLHQEDG 362


>gi|15964906|ref|NP_385259.1| hypothetical protein SMc00583 [Sinorhizobium meliloti 1021]
 gi|307300976|ref|ZP_07580745.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti BL225C]
 gi|307317711|ref|ZP_07597149.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti AK83]
 gi|15074085|emb|CAC45732.1| Hypothetical, transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896473|gb|EFN27221.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti AK83]
 gi|306903931|gb|EFN34517.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti BL225C]
          Length = 360

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 142/357 (39%), Positives = 214/357 (59%), Gaps = 2/357 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFFK Y +TT +FL+G   L+F+ID +E+ ++M  LP+Y++S   ++   R+P I+Q
Sbjct: 6   LGRYFFKRYARTTFWFLVGIFALIFIIDFSELTSRMSNLPHYTVSGALLMTTFRIPTILQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PF+ L   +    +LNR  ELV++RA GIS+WQ L PFVVG++L G+  V+VINP+A
Sbjct: 66  QTVPFVALFAAMAALISLNRRYELVVTRAAGISVWQFLRPFVVGALLFGVLAVVVINPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
             G K    L  +W        ++ IPW++      D  IGA+ +        + T I  
Sbjct: 126 AWGTKKAEALEAEWGST-RSAAANSIPWLRQIYDGTDTIIGARSVQNGGTELINVTVIHF 184

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
           D +  I  R+DA  A + +    L  VVE + GR+P    +  L   +K D  Q+   + 
Sbjct: 185 DPQGAITLRQDAKSAKLEDGYWLLNGVVETEVGRLPRRMETAQLRTNLKPDFVQERLAKA 244

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            S  F+++ +K+  + +S  F     ETQF+ L+ +PL+LVAMTLIAA VSL+FSR NQ 
Sbjct: 245 DSIQFFDLPRKIEVA-RSFGFSTNGLETQFHSLMSLPLLLVAMTLIAACVSLKFSRFNQS 303

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           R ++  GI SGF+LY +  ++K+FG SGI+ P  AA +PV++ ++L   ILL +EDG
Sbjct: 304 RSVILGGILSGFVLYVVTVLVKAFGSSGIVPPFVAAWLPVVVAMALGSTILLHQEDG 360


>gi|209548670|ref|YP_002280587.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534426|gb|ACI54361.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 362

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 217/362 (59%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ Y+ T  +FL+G   + F++D +E   +M  LP Y+I  G ++ A R+P
Sbjct: 2   MFGTLSRYFFRRYMVTMGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGILMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS++LG+ T+  +
Sbjct: 62  LILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLILGLLTMTAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA  +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAHTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGQVILRQDAATAKLEDGYWQLNNVVERKPGEIPMRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMT IAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTFIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IP+I+ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPMIVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|150395988|ref|YP_001326455.1| permease YjgP/YjgQ family protein [Sinorhizobium medicae WSM419]
 gi|150027503|gb|ABR59620.1| permease YjgP/YjgQ family protein [Sinorhizobium medicae WSM419]
          Length = 360

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 213/357 (59%), Gaps = 2/357 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFFK Y +TT +FL+G   L+F+ID +E+ ++M  LP+Y++S   ++   R+P I+Q
Sbjct: 6   LGRYFFKRYARTTFWFLIGIFALIFIIDFSELTSRMSNLPHYTVSGALLMTTFRIPTILQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PF+ L   +    +LNR  ELV++RA GIS+WQ L PFVVG+++ G   V+VINP+A
Sbjct: 66  QTVPFVALFAAMAALISLNRRYELVVTRAAGISVWQFLRPFVVGALIFGALAVVVINPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
             G K    L  +W        ++ IPW++      D  IGA+ +        + T I  
Sbjct: 126 AWGTKKAEALEAEWGST-RSAAANSIPWLRQIYDGTDTIIGARSVQNGGTELINVTVIHF 184

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
           D +  I  R+DA  A + +    L  VVE + GR+P    +  L   ++ D  Q+   + 
Sbjct: 185 DPQGAITLRQDAKSAKLEDGYWLLNGVVETEVGRLPRRMETAQLRTNLRPDFVQERLAKA 244

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            S  F+++ +K+  + +S  F     ETQF+ L+ +PL+LVAMTLIAA VSL+FSR NQ 
Sbjct: 245 DSIQFFDLPRKIEVA-RSFGFSTNGLETQFHSLMSLPLLLVAMTLIAACVSLKFSRFNQS 303

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           R ++  GI SGF+LY +  ++K+FG SGI+ P  AA +PV++ ++L   ILL +EDG
Sbjct: 304 RSVILGGILSGFVLYVVTVLIKAFGSSGIVPPFVAAWLPVVVAMALGSTILLHQEDG 360


>gi|218672883|ref|ZP_03522552.1| putative permease protein [Rhizobium etli GR56]
          Length = 340

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 204/340 (60%), Gaps = 2/340 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+G   + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T+  +
Sbjct: 62  LILQQTIPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGLLTMTAL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLVDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A
Sbjct: 301 RFNQSRPVILGGILSGFMLYVITVLVKAFGSSGVVPPFVA 340


>gi|227821475|ref|YP_002825445.1| permease YjgP/YjgQ family protein [Sinorhizobium fredii NGR234]
 gi|227340474|gb|ACP24692.1| permease YjgP/YjgQ family protein [Sinorhizobium fredii NGR234]
          Length = 360

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/357 (38%), Positives = 210/357 (58%), Gaps = 2/357 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFFK Y+ TT +FL+G   L+F+ID +E+ ++M  LP+Y++S   ++   R+P I+Q
Sbjct: 6   LGRYFFKRYIVTTFWFLVGIFALIFIIDFSELASRMSALPHYTVSGALLMTTFRIPTILQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PF+ L   +    +LNR  ELV++RA GIS+WQ L PFV+G+ L+G+  V+ +NP+A
Sbjct: 66  QTVPFVALFSAMAALISLNRRYELVVTRAAGISVWQFLRPFVLGAFLVGVLAVVALNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
             G K    L  +W  +    +S  IPW++      D  IGA+ +        + T I  
Sbjct: 126 AWGTKRAEALEAEWGSS-RSAQSSSIPWLRQIYDGTDTIIGARSVQNGGTELINVTVIHF 184

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
           D +  I  R+DA  A + +    L  V E   GR+P    +  L   +K D  Q+   + 
Sbjct: 185 DPQGTITLRQDAKSAKLEDGYWLLNGVTESGNGRLPRRLETVQLRTNLKADFVQERLAKA 244

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            S  F+++  K+  + +S  F     ETQ + L+ +PL+LVAMTLIAA VSL+FSR NQ 
Sbjct: 245 DSIQFFDLPHKIEVA-RSFGFSTDAMETQLHSLLSLPLLLVAMTLIAACVSLKFSRFNQS 303

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           R ++  GI SGF+LY +  ++K+FG SGI+ P  AA +PV++ ++L   ILL +EDG
Sbjct: 304 RSVILGGILSGFVLYVVTVLVKAFGSSGIVPPFVAAWLPVVVAMALGSTILLHQEDG 360


>gi|222148152|ref|YP_002549109.1| hypothetical protein Avi_1542 [Agrobacterium vitis S4]
 gi|221735140|gb|ACM36103.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 362

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 210/362 (58%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M   L RYF K Y  T  +F++G   ++F+ID +E+  +  +    S+    +L   R+P
Sbjct: 2   MLNTLSRYFLKRYAITVFWFVIGVAAIIFLIDFSEVSGRFSDNEQSSLFGVFLLTLMRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           L++QQ +PFI L   +V    LNR SELVI+RA GIS+WQ + PF++G+ +LG  T L+I
Sbjct: 62  LLLQQTVPFIALFSGMVTLITLNRRSELVIARAAGISVWQFMFPFLLGAFMLGCATSLLI 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKS-DIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G+K    L  ++ D G    + + +PWM+    ++D  IGA  +L +  +    
Sbjct: 122 NPLAALGQKQAATLEAEYSDPGKASNNKNSVPWMRQITGKEDTIIGATSVLEDGTLLMQA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D + +I  R+DA  A + +    LK VVE + G  P  + S  ++  +K +  Q+
Sbjct: 182 VFIHFDGQGRITSRQDARTAKLQDGYWLLKDVVETKPGETPKRETSAQVSTNLKQEFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
              Q  + +FYE+ +K++ + KS        ETQF+ L+  P + VAMTLIAA+VSL+FS
Sbjct: 242 RLAQPDTVAFYELSQKIAVA-KSYGVSTKNLETQFHTLLSTPFLFVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGF+LY    ++K+FG SG++ P  A  +PVI+  +L   ILL +E
Sbjct: 301 RFNQSRSVILGGIISGFVLYVATVLVKAFGSSGVVPPFVATWVPVIVATALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|218679276|ref|ZP_03527173.1| permease YjgP/YjgQ family protein [Rhizobium etli CIAT 894]
          Length = 312

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 188/312 (60%), Gaps = 2/312 (0%)

Query: 51  GAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSI 110
           G ++ A R+PLI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ ++PF+ GS+
Sbjct: 2   GILMTAVRLPLILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMSPFIAGSL 61

Query: 111 LLGIFTVLVINPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKI 169
           LLGI T+  +NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA  +
Sbjct: 62  LLGILTMTALNPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAHTV 121

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLN 229
                   D   I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L 
Sbjct: 122 QENGTKLIDAVLIHFDSSGQVILRQDAATAKLEDGYWQLNNVVERKPGEIPVRKASVQLR 181

Query: 230 IPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
             +K D  Q+      +  F+++  +++ + KS        ETQF  L+  PL+LVAMT 
Sbjct: 182 TNLKQDFVQERLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTF 240

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           IAA+VSL+FSR NQ R ++  GI SGF+LY I  ++K+FG SG++ P  A  IPV++ ++
Sbjct: 241 IAATVSLKFSRFNQSRSVILGGILSGFVLYVITVLVKAFGSSGVVPPFVATWIPVVVALA 300

Query: 350 LSILILLQKEDG 361
           L   ILL +EDG
Sbjct: 301 LGATILLHREDG 312


>gi|319408319|emb|CBI81972.1| conserved membrane hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 363

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 196/363 (53%), Gaps = 11/363 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y+KTT YF+L   IL  +ID  E   ++  LP+Y+     +++A RVP I+Q
Sbjct: 6   LGRYFFVRYIKTTCYFVLSIFILALLIDFTENSGRLASLPHYTAKGALLISALRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+ PFI L   + +  +LN+  ELV++R+IG+S WQ L P  +G+ L G+F++L INP+A
Sbjct: 66  QLFPFIALFSAMTMLISLNKKFELVVARSIGVSAWQFLIPACLGAFLFGLFSILFINPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
             G      +I +W+ N  +     + IPW+          IGA+ I  +     D T +
Sbjct: 126 AWGSSQAEKMIAEWRSNNVQTSINKNRIPWLTQHTNLGTTTIGARSITQQGLSLIDATFV 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
             +    + +   A  A + ND   L     Y+ G +P       +   +K +   ++  
Sbjct: 186 QYNDNATVKNWIHAKQATLTNDAWLLTNGTIYKTGYVPEKFTEFRIKTNLKPEFLTEYLA 245

Query: 243 QFASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
             A+  FY++ +K+    SF   +N F  Y        LI +P +LVAMTLIAA+VSL+F
Sbjct: 246 DPATIPFYKLPRKISAARSFGYSANKFDMYLQS-----LIALPALLVAMTLIAATVSLKF 300

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
           +R  Q + ++  G+ +GFMLY I  ++++FG +G + PV AA  PV++ +   +  LL K
Sbjct: 301 TRFGQSKALILGGVIAGFMLYVISVLVQAFGNAGYIPPVIAAWTPVVIALFFGVSFLLHK 360

Query: 359 EDG 361
           EDG
Sbjct: 361 EDG 363


>gi|121601841|ref|YP_988822.1| YjgP/YjgQ permease [Bartonella bacilliformis KC583]
 gi|120614018|gb|ABM44619.1| putative permease, YjgP/YjgQ family [Bartonella bacilliformis
           KC583]
          Length = 363

 Score =  212 bits (539), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 131/364 (35%), Positives = 194/364 (53%), Gaps = 11/364 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYFF  YL+ T YFLLGA IL F+ID  E  +++  LP+Y+     +++  R+PLI+
Sbjct: 5   ILGRYFFIQYLRITCYFLLGAFILAFLIDFIENSSRLTSLPHYTTKGALLISFLRIPLIM 64

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           QQ+ PFI L   I +  +LNR  ELVI+R+IG+S WQ L P   G+  LG+  + + NP 
Sbjct: 65  QQLFPFIALFSAITMLISLNRKFELVIARSIGVSAWQFLMPACFGAFFLGLVAIFLFNPF 124

Query: 124 ATSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           A  G      +I +W  N  +    +  IPW           IGAK I  E     +   
Sbjct: 125 AAWGYSQAEKIIAEWHSNNVQTSLNNHRIPWFTQHTDLGTTTIGAKSITDEGLSLINAIF 184

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
           +  ++   I +   A  A + N    L     Y+ G IP       +   +K +   ++ 
Sbjct: 185 VQYNEDATIKNWIHAQKATLTNSAWFLTHGTIYKTGHIPEKFAEFWIETNLKPEFLTEYL 244

Query: 242 EQFASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
              A+ SFY++ KK+    SF   +N F  Y        LI +P +LVAMTLIAA+VSL+
Sbjct: 245 ADPATTSFYKLPKKIAVARSFGYSANKFDMYLQS-----LIALPALLVAMTLIAATVSLK 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F+R  Q   ++  G+ +GF+LY I  ++++FG +G + P+ AA +PVI+ + L I  LL 
Sbjct: 300 FTRLEQSGKLILSGVIAGFVLYVISVLVRAFGNAGYIPPIIAAWVPVIIALFLGISFLLH 359

Query: 358 KEDG 361
           KEDG
Sbjct: 360 KEDG 363


>gi|319784424|ref|YP_004143900.1| permease YjgP/YjgQ family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170312|gb|ADV13850.1| permease YjgP/YjgQ family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 360

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 198/366 (54%), Gaps = 19/366 (5%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y+  T++F +G + LVF+ID  E+  +   LP ++      ++  R+P+I+ 
Sbjct: 5   LGRYFFFRYVTITIWFFIGLLALVFLIDFTELSGRTTGLPGFTYGTAVAISGLRMPMIML 64

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PF+ L   +    +LNR  ELVI+R+ G+S WQ L P  +G++L G+ +V VINP+A
Sbjct: 65  QTVPFVGLFSAMATLVSLNRRYELVIARSAGVSAWQFLLPCCIGALLFGVLSVGVINPLA 124

Query: 125 TSGEKIGIDLIQQWKDN-GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
                    +  Q +    +   +D  PW++      D  IGA+ IL +     D     
Sbjct: 125 AHAFSWSEQIETQLRSGKSNTVSADAAPWIRQKTSSGDTIIGARAILNQGLEMADVVFFI 184

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
           +D +  I+ RKDA  A + +   +L+ V  +Q G I   + S T  +P  +    +F ++
Sbjct: 185 LDPQGNIVERKDAARAFLRDGYWELQDVKTFQNGTI---QASATDRVPTNLK--PEFVQE 239

Query: 244 FASR----SFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +R     FY++  K+    SF  K+N F       QF  L+ +P +LVAMTLIAA+VS
Sbjct: 240 RLARPETIPFYDLPGKIEVARSFGLKANAF-----AMQFDSLVALPFLLVAMTLIAATVS 294

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           + F+R  Q   ++  GI +GF+LY +  ++K+FG +G +  V AA +PV++ +   +  L
Sbjct: 295 MRFARMGQSATMILGGIIAGFLLYVVSVLVKAFGVAGFVPTVVAAWVPVMVAMFFGVTFL 354

Query: 356 LQKEDG 361
           L KEDG
Sbjct: 355 LYKEDG 360


>gi|13476525|ref|NP_108095.1| hypothetical protein mll7865 [Mesorhizobium loti MAFF303099]
 gi|14027286|dbj|BAB54240.1| mll7865 [Mesorhizobium loti MAFF303099]
          Length = 360

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 198/366 (54%), Gaps = 19/366 (5%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y+  T++F LG + LVF+ID  E+  +   LP ++      ++  R+P+I+ 
Sbjct: 5   LGRYFFFRYVTITIWFFLGLLALVFLIDFTELSGRTTGLPGFTYGTAVAISGLRMPMIML 64

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PF+ L   +    +LNR  ELVI+R+ G+S WQ L P  +G++L G  +V +INP+A
Sbjct: 65  QTVPFVGLFSAMATLVSLNRRYELVIARSAGVSAWQFLLPCCIGALLFGFVSVGLINPLA 124

Query: 125 TSGEKIGIDLIQQWKDN-GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
                +   +  Q +    +   +D  PW++      D  IGA+ IL +     D     
Sbjct: 125 AHAFSLSEQIETQLRSGKSNTVSADAAPWIRQKTSTGDTIIGARAILNQGLEMSDAVFFV 184

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
           +D++  I+ RKDA  A + +   +L+ V  ++ G I   + S +  +P  +    +F ++
Sbjct: 185 LDQQGNIVERKDAAHAYLRDGYWELQDVKTFRNGTI---QPSASDRVPTNLK--PEFVQE 239

Query: 244 FASR----SFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +R     FY++  K+    SF  K+N F       QF  L+ +P +LVAMTLIAA+VS
Sbjct: 240 RLARPETIPFYDLPGKIEVARSFGLKANAF-----AMQFDSLVALPFLLVAMTLIAATVS 294

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           + F+R  Q   ++  G+ +GF+LY +  ++K+FG +G +    AA +PV++ +   +  L
Sbjct: 295 MRFARMGQSATMILGGVVAGFLLYVVSVLVKAFGVAGFVPTAIAAWVPVVVAMFFGVTFL 354

Query: 356 LQKEDG 361
           L KEDG
Sbjct: 355 LYKEDG 360


>gi|319404055|emb|CBI77643.1| conserved membrane hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 363

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 197/359 (54%), Gaps = 3/359 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  YLKT  +FLLG  ILV +ID  E  +++  LP+Y+     +++  R+PLI+Q
Sbjct: 6   LGRYFFMLYLKTVCFFLLGVFILVLLIDFTENSSKLALLPHYTAKGAFLISLLRIPLIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+ PFI L   I +  +LN+  ELV++R+IGIS WQ L P   G+ L G+F++L INP+A
Sbjct: 66  QLFPFIALFSAITMLISLNKKLELVVARSIGISAWQFLAPACFGAFLFGLFSILFINPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDK-QKSDI-IPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
                    +I +W+ N  +   +D  IPW+        I +GAK I+ ++    D T +
Sbjct: 126 AWSSSQAKKMIAEWRSNSAQISTTDTRIPWLTQHTNLGRITVGAKSIIYQDLSLIDATFV 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
             ++   + +  +   A + +    L     Y+ G+ P       +   +K +   ++  
Sbjct: 186 QYNENATVKNWINTKKATLTDGAWLLTNGTIYKIGQTPEKFTELRIKTHLKPEFLTEYLT 245

Query: 243 QFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSN 302
              +  FY + KK++ +       N + +     LI +P++LVAMTLIAA+VSL+  R  
Sbjct: 246 DPITIPFYTLPKKIAVARSLGYSAN-KFDMHLQSLIALPMLLVAMTLIAATVSLKIPRFG 304

Query: 303 QPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           Q R ++  G+ +GF+LY I  +++SFG +G + P+ AA +PVI+ +  +I  LL  EDG
Sbjct: 305 QSRTLILGGVIAGFILYVISMLVQSFGNAGYIPPIIAAWVPVIVALFFAISFLLYTEDG 363


>gi|319407067|emb|CBI80704.1| conserved membrane hypothetical protein [Bartonella sp. 1-1C]
          Length = 363

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 195/359 (54%), Gaps = 3/359 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  YLKT  +FLLG  ILV +ID  E  +++  LP+Y+     +++  R+PLI+Q
Sbjct: 6   LGRYFFMLYLKTVCFFLLGVFILVLLIDFTENSSKLAFLPHYTAKGAFLISLLRIPLIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+ PFI L   I +  +LN+  ELV++R+IGIS WQ L P   G+ L G+F++L INP+A
Sbjct: 66  QLFPFIALFSAITMLISLNKKLELVVARSIGISAWQFLAPACFGAFLFGLFSILFINPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
                    +I +W+ N  +       IPW+        I +GAK I+ ++    D T +
Sbjct: 126 AWSSFQAEKMIAEWRSNNAQTSITGTRIPWLTQHTNLGRITVGAKSIIYQDLSLIDATFV 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
             ++   + +  +   A + +    L     Y+ G+ P       +   +K +   ++  
Sbjct: 186 QYNENATVKNWINTKKATLTDGAWLLTNGTIYKIGQTPEKFTELRIKTHLKPEFLTEYLT 245

Query: 243 QFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSN 302
              +  FY + KK++ +       N + +     LI +P++LVAMTLIAA+VSL+  R  
Sbjct: 246 DPITIPFYNLPKKIAVARSLGYSAN-KFDMHLQSLIALPMLLVAMTLIAATVSLKIPRFG 304

Query: 303 QPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           Q R ++  G+ +GF+LY I  +++SFG +G + P+ AA +PVI+ +  +I  LL  EDG
Sbjct: 305 QSRTLILGGVIAGFILYVISMLVRSFGNAGYIPPIIAAWVPVIVALFFAISFLLYTEDG 363


>gi|319405492|emb|CBI79111.1| conserved membrane hypothetical protein [Bartonella sp. AR 15-3]
          Length = 363

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/359 (34%), Positives = 198/359 (55%), Gaps = 3/359 (0%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  YLKTT  FLLG  ILV +ID  E  +++  LP Y+     +++  R PLIIQ
Sbjct: 6   LGRYFFMLYLKTTCCFLLGVFILVLLIDFTENFSKLALLPYYTAKGAFLISLLRTPLIIQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+ PFI L   I +  +LN+  ELVI+R+IGIS WQ L P   G+ L G+F++L INP+A
Sbjct: 66  QLFPFIALFSAITMLISLNKRLELVIARSIGISAWQFLTPACFGAFLFGLFSILFINPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
                    ++  W+ N ++    +  IPW+          IGAK I+ ++    D T +
Sbjct: 126 AWSSSQSEKIVAAWRSNNNQISISNTRIPWLTQHTNLGRTTIGAKSIIHKDLSLIDATFV 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
             ++   + +  +   A++ +    L     Y+ G+ P   +   +   +K +   ++  
Sbjct: 186 QYNENATVKNWINTKKAMLTDGAWLLINGTIYKIGQPPKKFSELRIKTHLKPEFLTEYLA 245

Query: 243 QFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSN 302
           +  +  FYE+ KK++ + +S  +   + +     LI +P++LVAMTLIAA+VSL+  R  
Sbjct: 246 EPVTIPFYELPKKIAVA-RSFGYSANKFDMHLQSLIALPMLLVAMTLIAATVSLKIPRFG 304

Query: 303 QPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           Q + ++  GI +GF+LY I  +++SFG +G + P+ AA +PVI+ +   I  LL  EDG
Sbjct: 305 QSKTLILGGIIAGFILYVISMLVRSFGNAGYIPPIIAAWVPVIVALFFGISFLLYTEDG 363


>gi|49474100|ref|YP_032142.1| hypothetical protein BQ04620 [Bartonella quintana str. Toulouse]
 gi|49239604|emb|CAF25961.1| Hypothetical transmembrane protein [Bartonella quintana str.
           Toulouse]
          Length = 364

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 189/364 (51%), Gaps = 12/364 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  YLK T YF     +L F+ID  E  +++  LP+Y+     +++  R+P I+Q
Sbjct: 6   LGRYFFVRYLKMTCYFFGSIFVLAFLIDFTENSSRLSYLPSYTAKDAFLISVLRIPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPFI L   + +  +LNR  ELV++R+IG+S WQ L P   G+ L G+F++L++NP+A
Sbjct: 66  QLIPFIALFSAMAMLISLNRKCELVVTRSIGVSAWQFLMPACFGAFLFGLFSILLVNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNG---DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             G      +  +W+ N        + IIPW+          IGAK I  +     D T 
Sbjct: 126 AWGFSQAEKMTTEWRSNNVLTSFHNTRIIPWLTQRTNSDRTTIGAKSITDQGLSLIDATF 185

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
           +  +    + +  +   A + N    L     Y+ G  P       +   +K +   +  
Sbjct: 186 VQYNDNATVKNWINTRKATLTNGVWLLTNGTIYKIGHPPEKFTEFQIKTNLKPEFLTERL 245

Query: 242 EQFASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
              A+  FY++ KK+    SF   +N F  Y        LI +P +L+AMTLIAA+VSL 
Sbjct: 246 ANPATIPFYQLPKKIMIARSFGYSANNFDMYLQS-----LIALPALLIAMTLIAATVSLN 300

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F+R  Q   ++  G+ +GF LY I  ++++FG +G + P+ AA  PVI+ + L I  LL 
Sbjct: 301 FTRFGQSGTLIFGGVIAGFTLYVISVLVQAFGNAGYMPPIIAAWTPVIIALFLGISFLLH 360

Query: 358 KEDG 361
           KEDG
Sbjct: 361 KEDG 364


>gi|62289648|ref|YP_221441.1| hypothetical protein BruAb1_0705 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699576|ref|YP_414150.1| YjgP/YjgQ permease [Brucella melitensis biovar Abortus 2308]
 gi|189023898|ref|YP_001934666.1| permease [Brucella abortus S19]
 gi|254688958|ref|ZP_05152212.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 6
           str. 870]
 gi|254697092|ref|ZP_05158920.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254729988|ref|ZP_05188566.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 4
           str. 292]
 gi|256257206|ref|ZP_05462742.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 9
           str. C68]
 gi|260545600|ref|ZP_05821341.1| permease YjgP/YjgQ family protein [Brucella abortus NCTC 8038]
 gi|260754447|ref|ZP_05866795.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 6 str. 870]
 gi|260757666|ref|ZP_05870014.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 4 str. 292]
 gi|260761493|ref|ZP_05873836.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883476|ref|ZP_05895090.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 9 str. C68]
 gi|297248056|ref|ZP_06931774.1| YjgP/YjgQ family permease [Brucella abortus bv. 5 str. B3196]
 gi|62195780|gb|AAX74080.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615677|emb|CAJ10664.1| Predicted permease YjgP/YjgQ family [Brucella melitensis biovar
           Abortus 2308]
 gi|189019470|gb|ACD72192.1| Predicted permease YjgP/YjgQ family [Brucella abortus S19]
 gi|260097007|gb|EEW80882.1| permease YjgP/YjgQ family protein [Brucella abortus NCTC 8038]
 gi|260667984|gb|EEX54924.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 4 str. 292]
 gi|260671925|gb|EEX58746.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674555|gb|EEX61376.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 6 str. 870]
 gi|260873004|gb|EEX80073.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 9 str. C68]
 gi|297175225|gb|EFH34572.1| YjgP/YjgQ family permease [Brucella abortus bv. 5 str. B3196]
          Length = 362

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 199/365 (54%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ TLYFLLG   L  ++D  E  N++  LP Y++     L+A RVP I+Q
Sbjct: 6   LGRYFFTRYVQITLYFLLGIFALALLLDFTENANRLANLPAYTVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D++  I  R DA  A + +   +L  V+ +  G+ P  +   T  I  ++   +   E+
Sbjct: 186 FDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEP--QKLETFRISTQLRP-EYVEEK 242

Query: 244 FASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            AS     F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL
Sbjct: 243 LASPETIPFTQLCHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSL 297

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
           +F R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL
Sbjct: 298 KFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLL 357

Query: 357 QKEDG 361
            KEDG
Sbjct: 358 HKEDG 362


>gi|17987546|ref|NP_540180.1| putative permeases [Brucella melitensis bv. 1 str. 16M]
 gi|225852206|ref|YP_002732439.1| permease YjgP/YjgQ family protein [Brucella melitensis ATCC 23457]
 gi|254693440|ref|ZP_05155268.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|256044379|ref|ZP_05447283.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113222|ref|ZP_05454090.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264286|ref|ZP_05466818.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563731|ref|ZP_05834217.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           16M]
 gi|261213693|ref|ZP_05927974.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|265990797|ref|ZP_06103354.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994633|ref|ZP_06107190.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983249|gb|AAL52444.1| putative permeases [Brucella melitensis bv. 1 str. 16M]
 gi|225640571|gb|ACO00485.1| permease YjgP/YjgQ family protein [Brucella melitensis ATCC 23457]
 gi|260153747|gb|EEW88839.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260915300|gb|EEX82161.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|262765746|gb|EEZ11535.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001581|gb|EEZ14156.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094546|gb|EEZ18355.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408705|gb|ADZ65770.1| permease YjgP/YjgQ family protein [Brucella melitensis M28]
 gi|326538429|gb|ADZ86644.1| permease YjgP/YjgQ family protein [Brucella melitensis M5-90]
          Length = 362

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 199/365 (54%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ TLYFLLG   L  ++D  E  N++  LP Y++     L+A RVP I+Q
Sbjct: 6   LGRYFFTRYVQITLYFLLGIFALALLLDFTENANRLANLPAYTVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D++  I  R DA  A + +   +L  V+ +  G+ P  +   T  I  ++   +   E+
Sbjct: 186 FDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEP--QKLETFRISTQLRP-EYVEEK 242

Query: 244 FASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            AS     F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL
Sbjct: 243 LASPETIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSL 297

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
           +F R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL
Sbjct: 298 KFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLL 357

Query: 357 QKEDG 361
            KEDG
Sbjct: 358 HKEDG 362


>gi|319898730|ref|YP_004158823.1| hypothetical protein BARCL_0559 [Bartonella clarridgeiae 73]
 gi|319402694|emb|CBI76240.1| conserved membrane protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 363

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 192/363 (52%), Gaps = 11/363 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  YLK   YFLLG  IL  +ID  E  +++  LP+Y++    +++  R+P I+Q
Sbjct: 6   LGRYFFVLYLKKICYFLLGVFILTLLIDFTENSSRLELLPHYTVKGAFLISLLRIPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+ PFI L   + +  +LN+  ELV++R+IGIS WQ L P   G+ LLG+F++L +NP+A
Sbjct: 66  QLFPFIALFSAMTMLISLNQKLELVVARSIGISAWQFLMPACFGAFLLGLFSILFVNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
                    +I  W+ N  +    +  IPW+          IGAK I  +     D   +
Sbjct: 126 AWSSSQAEKMIAAWRSNNIEISTSNTRIPWLTQQTNLGRTTIGAKSITHQGLSLIDAIFV 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
             ++   + +  +   A + N    L     Y+ G+ P       L   +K +   +   
Sbjct: 186 QYNENATVKNWINTKKATLTNGAWLLTNGTIYKIGQTPEKFTELRLKTHLKPEFLTEHLA 245

Query: 243 QFASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
              +  FY++ +K+    SF   +N F     +     LI  P++LVAMTLIAA+VSL+F
Sbjct: 246 DPVTIPFYKLPEKIAVARSFGYSANKF-----DMHLQSLIASPILLVAMTLIAATVSLKF 300

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
           +R  Q R ++  G+ +GF+LY I  +++SFG +G + P+ AA +PV++ +S  I  LL  
Sbjct: 301 TRFGQSRTLILGGVIAGFILYVISVLVRSFGNAGYIPPIIAAWVPVVVALSFGISFLLHT 360

Query: 359 EDG 361
           EDG
Sbjct: 361 EDG 363


>gi|239831520|ref|ZP_04679849.1| permease YjgP/YjgQ family protein [Ochrobactrum intermedium LMG
           3301]
 gi|239823787|gb|EEQ95355.1| permease YjgP/YjgQ family protein [Ochrobactrum intermedium LMG
           3301]
          Length = 362

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 123/362 (33%), Positives = 193/362 (53%), Gaps = 10/362 (2%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ T YFLLG   L  ++D  E  +++  LP+YS+     L+A RVP I+Q
Sbjct: 6   LGRYFFIRYVQITFYFLLGIFALSLLLDFTENASKLSNLPDYSVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G+ L G+ T+ ++NP A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGAFLFGLATIFILNPFA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AYGFAKADEIASTWKTGKTTDVSALRDPWLRQKTDEGETIIGAKSILDQGATLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D+K  I  R DA  A + +   +L  V  +  G  P    S  +   ++ +  ++    
Sbjct: 186 FDEKKNIRERFDARRAQLRDGHWELTDVTRFARGEEPQKMASFQIETQLRPEYVEEKLAT 245

Query: 244 FASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
             +  F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL+F 
Sbjct: 246 PDTIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSLKFV 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R  Q   ++  G+ +GFMLY +  ++K+FG +G + P  AA +PVI+     +  LL KE
Sbjct: 301 RFGQSGAMILGGVIAGFMLYVVSVLVKAFGNAGFVPPFVAAWVPVIIATFFGVSFLLHKE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|148560142|ref|YP_001258668.1| hypothetical protein BOV_0678 [Brucella ovis ATCC 25840]
 gi|148371399|gb|ABQ61378.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 362

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/365 (33%), Positives = 199/365 (54%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RVP I+Q
Sbjct: 6   LGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D++  I  R DA  A + +   +L  V+ +  G+ P  +   T  I  ++   +   E+
Sbjct: 186 FDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEP--QKLETFRISTQLRP-EYVEEK 242

Query: 244 FASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            AS     F ++  K+    SF   +N F     + Q+  L+ +P +L+A+TLIAA+VSL
Sbjct: 243 LASPETIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAITLIAATVSL 297

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
           +F R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL
Sbjct: 298 KFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLL 357

Query: 357 QKEDG 361
            KEDG
Sbjct: 358 HKEDG 362


>gi|23501573|ref|NP_697700.1| hypothetical protein BR0686 [Brucella suis 1330]
 gi|161618655|ref|YP_001592542.1| permease YjgP/YjgQ family protein [Brucella canis ATCC 23365]
 gi|163842956|ref|YP_001627360.1| permease YjgP/YjgQ family protein [Brucella suis ATCC 23445]
 gi|254701469|ref|ZP_05163297.1| hypothetical protein Bsuib55_11506 [Brucella suis bv. 5 str. 513]
 gi|254704016|ref|ZP_05165844.1| hypothetical protein Bsuib36_08824 [Brucella suis bv. 3 str. 686]
 gi|254707610|ref|ZP_05169438.1| hypothetical protein BpinM_11731 [Brucella pinnipedialis
           M163/99/10]
 gi|254709807|ref|ZP_05171618.1| hypothetical protein BpinB_05956 [Brucella pinnipedialis B2/94]
 gi|256031298|ref|ZP_05444912.1| hypothetical protein BpinM2_11713 [Brucella pinnipedialis
           M292/94/1]
 gi|256060811|ref|ZP_05450971.1| hypothetical protein Bneo5_10662 [Brucella neotomae 5K33]
 gi|256159412|ref|ZP_05457190.1| hypothetical protein BcetM4_10688 [Brucella ceti M490/95/1]
 gi|256254706|ref|ZP_05460242.1| hypothetical protein BcetB_10505 [Brucella ceti B1/94]
 gi|256369121|ref|YP_003106629.1| permease YjgP/YjgQ family protein [Brucella microti CCM 4915]
 gi|260168437|ref|ZP_05755248.1| hypothetical protein BruF5_08723 [Brucella sp. F5/99]
 gi|260566735|ref|ZP_05837205.1| permease YjgP/YjgQ family protein [Brucella suis bv. 4 str. 40]
 gi|261221886|ref|ZP_05936167.1| permease YjgP/YjgQ family protein [Brucella ceti B1/94]
 gi|261315100|ref|ZP_05954297.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M163/99/10]
 gi|261317345|ref|ZP_05956542.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis B2/94]
 gi|261324803|ref|ZP_05964000.1| permease YjgP/YjgQ family protein [Brucella neotomae 5K33]
 gi|261752012|ref|ZP_05995721.1| permease YjgP/YjgQ family protein [Brucella suis bv. 5 str. 513]
 gi|261754671|ref|ZP_05998380.1| permease YjgP/YjgQ family protein [Brucella suis bv. 3 str. 686]
 gi|261757899|ref|ZP_06001608.1| permease YjgP/YjgQ family protein [Brucella sp. F5/99]
 gi|265988383|ref|ZP_06100940.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M292/94/1]
 gi|265997849|ref|ZP_06110406.1| permease YjgP/YjgQ family protein [Brucella ceti M490/95/1]
 gi|294852048|ref|ZP_06792721.1| hypothetical protein BAZG_00964 [Brucella sp. NVSL 07-0026]
 gi|306845287|ref|ZP_07477863.1| hypothetical protein BIBO1_1972 [Brucella sp. BO1]
 gi|23347486|gb|AAN29615.1| conserved hypothetical protein [Brucella suis 1330]
 gi|161335466|gb|ABX61771.1| permease YjgP/YjgQ family protein [Brucella canis ATCC 23365]
 gi|163673679|gb|ABY37790.1| permease YjgP/YjgQ family protein [Brucella suis ATCC 23445]
 gi|255999281|gb|ACU47680.1| permease YjgP/YjgQ family protein [Brucella microti CCM 4915]
 gi|260156253|gb|EEW91333.1| permease YjgP/YjgQ family protein [Brucella suis bv. 4 str. 40]
 gi|260920470|gb|EEX87123.1| permease YjgP/YjgQ family protein [Brucella ceti B1/94]
 gi|261296568|gb|EEY00065.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis B2/94]
 gi|261300783|gb|EEY04280.1| permease YjgP/YjgQ family protein [Brucella neotomae 5K33]
 gi|261304126|gb|EEY07623.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M163/99/10]
 gi|261737883|gb|EEY25879.1| permease YjgP/YjgQ family protein [Brucella sp. F5/99]
 gi|261741765|gb|EEY29691.1| permease YjgP/YjgQ family protein [Brucella suis bv. 5 str. 513]
 gi|261744424|gb|EEY32350.1| permease YjgP/YjgQ family protein [Brucella suis bv. 3 str. 686]
 gi|262552317|gb|EEZ08307.1| permease YjgP/YjgQ family protein [Brucella ceti M490/95/1]
 gi|264660580|gb|EEZ30841.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M292/94/1]
 gi|294820637|gb|EFG37636.1| hypothetical protein BAZG_00964 [Brucella sp. NVSL 07-0026]
 gi|306274446|gb|EFM56253.1| hypothetical protein BIBO1_1972 [Brucella sp. BO1]
          Length = 362

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 124/365 (33%), Positives = 199/365 (54%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RVP I+Q
Sbjct: 6   LGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D++  I  R DA  A + +   +L  V+ +  G+ P  +   T  I  ++   +   E+
Sbjct: 186 FDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEP--QKLETFRISTQLRP-EYVEEK 242

Query: 244 FASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            AS     F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL
Sbjct: 243 LASPETIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSL 297

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
           +F R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL
Sbjct: 298 KFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLL 357

Query: 357 QKEDG 361
            KEDG
Sbjct: 358 HKEDG 362


>gi|225627183|ref|ZP_03785221.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225618018|gb|EEH15062.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 397

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 122/365 (33%), Positives = 200/365 (54%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RVP I+Q
Sbjct: 41  LGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRVPFIMQ 100

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A
Sbjct: 101 QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLA 160

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 161 AHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQ 220

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D++  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +   E+
Sbjct: 221 FDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE---EK 277

Query: 244 FASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            AS     F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL
Sbjct: 278 LASPETIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSL 332

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
           +F R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL
Sbjct: 333 KFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLL 392

Query: 357 QKEDG 361
            KEDG
Sbjct: 393 HKEDG 397


>gi|254718822|ref|ZP_05180633.1| hypothetical protein Bru83_04670 [Brucella sp. 83/13]
 gi|265983807|ref|ZP_06096542.1| permease YjgP/YjgQ family protein [Brucella sp. 83/13]
 gi|306838744|ref|ZP_07471578.1| permease YjgP/YjgQ family protein [Brucella sp. NF 2653]
 gi|264662399|gb|EEZ32660.1| permease YjgP/YjgQ family protein [Brucella sp. 83/13]
 gi|306406146|gb|EFM62391.1| permease YjgP/YjgQ family protein [Brucella sp. NF 2653]
          Length = 362

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 124/365 (33%), Positives = 198/365 (54%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RVP I+Q
Sbjct: 6   LGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            DK+  I  R DA  A + +   +L  V+ +  G+ P  +   T  I  ++   +   E+
Sbjct: 186 FDKQKNIKDRYDARTATLQDGYWELTDVMRFARGQEP--QKLETFRISTQLRP-EYVEEK 242

Query: 244 FASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            AS     F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL
Sbjct: 243 LASPETIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSL 297

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
           +F R  Q   ++  G+ +GF+LY +  ++K+F  +G + P  AA +PV++     +  LL
Sbjct: 298 KFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFSDAGFVPPFVAAWVPVVIATFFGVSFLL 357

Query: 357 QKEDG 361
            KEDG
Sbjct: 358 HKEDG 362


>gi|254713811|ref|ZP_05175622.1| hypothetical protein BcetM6_10740 [Brucella ceti M644/93/1]
 gi|254717131|ref|ZP_05178942.1| hypothetical protein BcetM_12059 [Brucella ceti M13/05/1]
 gi|261218946|ref|ZP_05933227.1| permease YjgP/YjgQ family protein [Brucella ceti M13/05/1]
 gi|261321555|ref|ZP_05960752.1| permease YjgP/YjgQ family protein [Brucella ceti M644/93/1]
 gi|260924035|gb|EEX90603.1| permease YjgP/YjgQ family protein [Brucella ceti M13/05/1]
 gi|261294245|gb|EEX97741.1| permease YjgP/YjgQ family protein [Brucella ceti M644/93/1]
          Length = 362

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 124/365 (33%), Positives = 198/365 (54%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RVP I+Q
Sbjct: 6   LGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D++  I  R DA  A + +   +L  V+ +  G+ P  +   T  I  ++   +   E+
Sbjct: 186 FDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEP--QKLETFRISTQLRP-EYVEEK 242

Query: 244 FASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            AS     F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL
Sbjct: 243 LASPETIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSL 297

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
           +F R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++        LL
Sbjct: 298 KFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGASFLL 357

Query: 357 QKEDG 361
            KEDG
Sbjct: 358 HKEDG 362


>gi|153009929|ref|YP_001371144.1| permease YjgP/YjgQ family protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561817|gb|ABS15315.1| permease YjgP/YjgQ family protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 362

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 122/362 (33%), Positives = 193/362 (53%), Gaps = 10/362 (2%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y++ T YFLLG   L  ++D  E  +++  LP+YS+     L+A RVP I+Q
Sbjct: 6   LGRYFFIRYVQITFYFLLGIFALSLLLDFTENASKLSNLPDYSVWAALGLSAMRVPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G+ L G+ T+ ++NP A
Sbjct: 66  QMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGAFLFGLATIFILNPFA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             G     ++   WK       S +  PW++    + +  IGAK IL +     D T I 
Sbjct: 126 AYGFAKADEIASTWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILDQGATLADATFIQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D+K  I  R DA  A + +   +L  V  +  G  P    S  +   ++ +  ++    
Sbjct: 186 FDEKKNIKVRYDARTAQLKDGHWELTDVTRFARGEEPQKMASFQIETQLRPEYVEEKLAT 245

Query: 244 FASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
             +  F ++  K+    SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL+F 
Sbjct: 246 PDTIPFTQLRHKIEVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSLKFV 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R  Q   ++  G+ +GFMLY +  ++K+FG +G + P  AA +PV++     +  LL KE
Sbjct: 301 RFGQSGAMILGGVIAGFMLYVVSVLVKAFGNAGFVPPFVAAWVPVVIATFFGVSFLLHKE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|49475338|ref|YP_033379.1| hypothetical protein BH05440 [Bartonella henselae str. Houston-1]
 gi|49238144|emb|CAF27352.1| Hypothetical transmembrane protein [Bartonella henselae str.
           Houston-1]
          Length = 365

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 190/365 (52%), Gaps = 13/365 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L +YFF  YLK T YFL G  +L  +ID  E   ++  LP Y+     +++  R+P I+Q
Sbjct: 6   LGQYFFIRYLKMTCYFLGGIFVLALLIDFTENSGRLSSLPRYTAKDAFLISVLRIPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPFI L   + +  +LNR SELV++R+IGIS WQ L P   G+ L G+F++L++NP+A
Sbjct: 66  QLIPFIALFSAMAMLISLNRKSELVVTRSIGISAWQFLMPACFGAFLFGLFSILLVNPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDI----IPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             G      ++ +W+   +   + +    I W+          IGAK I  +     D T
Sbjct: 126 AWGFSQAERMMTEWRSKNNNVLTSLHNTRILWLTQRTHSGRTTIGAKSITDQGLSLIDAT 185

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
            +  +    I +  ++  A + N    L     Y+ G  P   +   +   +K +   + 
Sbjct: 186 FVQYNDNATIKNWINSRKATLINGAWLLTDGTIYKIGHPPEKFSELQIQTTLKPEFLTER 245

Query: 241 SEQFASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
               A+  FY++  K+    SF   +N F  Y        LI +P +L+AMTLIAA VSL
Sbjct: 246 LVNPATIPFYQLPTKIMIARSFGYSANNFDMYLQS-----LIALPALLIAMTLIAAVVSL 300

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
            F+R  Q +I++  G+ +GF LY I  ++++FG +G + P+ AA  PV + + L I  LL
Sbjct: 301 NFTRFGQSKILILGGVIAGFSLYVISILVQAFGNAGYIPPIIAAWTPVFIALFLGISFLL 360

Query: 357 QKEDG 361
            KEDG
Sbjct: 361 HKEDG 365


>gi|240850231|ref|YP_002971624.1| putative permease, YjgP/YjgQ family [Bartonella grahamii as4aup]
 gi|240267354|gb|ACS50942.1| putative permease, YjgP/YjgQ family [Bartonella grahamii as4aup]
          Length = 363

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 194/366 (53%), Gaps = 17/366 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  YLK T YF     +L  +ID  E   ++  +P+++      L+  R+P I+Q
Sbjct: 6   LGRYFFIRYLKITCYFWGSIFVLALLIDFTENSGRLSSIPHHTAKDAFFLSVLRIPFIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q+IPFI L   +    +LN+  ELV++R+IG+S WQ L P  +G+ LLG+F++L+INP+A
Sbjct: 66  QLIPFIALFSAMATLISLNKKLELVVTRSIGVSAWQFLMPACLGAFLLGLFSILLINPLA 125

Query: 125 TSGEKIGIDLIQQWKDNG--DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
             G       + +W++N       +  I W+          IGAK I  +     D T +
Sbjct: 126 AWGFSQAEKKMTEWRNNNVLTPLHNTDIHWLTQRTNLGRTTIGAKFITDQGLSLLDATFV 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
             +    + +  +   A + N    L     Y+ G  P  +  T L I   +   +  +E
Sbjct: 186 QYNDNATVKNWINTPKATLTNGSWLLTNGTIYKIGHPP--EKFTVLQIKTNLKP-EFLTE 242

Query: 243 QFASRS---FYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
           + A+ +   FY++ KK+    SF   +N F  Y     F  LI +P +LVAMTLIAA+VS
Sbjct: 243 RLANPATIPFYQLPKKIMIARSFGYSANNFDMY-----FQSLIALPALLVAMTLIAATVS 297

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           L F+R  Q R ++  G+ +GFMLY I  ++++FG +G + P+ AA  PV++ + L I  L
Sbjct: 298 LNFTRFGQSRTLILGGVIAGFMLYVISVLVQAFGNAGYIPPIIAAWTPVVIALFLGISFL 357

Query: 356 LQKEDG 361
           L KEDG
Sbjct: 358 LHKEDG 363


>gi|163868027|ref|YP_001609231.1| hypothetical protein Btr_0826 [Bartonella tribocorum CIP 105476]
 gi|161017678|emb|CAK01236.1| hypothetical transmembrane protein [Bartonella tribocorum CIP
           105476]
          Length = 363

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 188/361 (52%), Gaps = 11/361 (3%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYFF  YLK T YF     +L  +ID  E   ++  LP+Y+     +L+  R+P I+QQ+
Sbjct: 8   RYFFIRYLKITCYFWGSIFVLALLIDFTENSGRLPSLPHYTAKDAFLLSVLRIPFIMQQL 67

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           IPFI L   +    +LN+  ELV++R+IG+S WQ L P  +G+ LLG+F++L+INP+A  
Sbjct: 68  IPFIALFSAMTTLISLNKKLELVVTRSIGVSAWQFLMPACLGAFLLGLFSILLINPLAAW 127

Query: 127 GEKIGIDLIQQWKDNG--DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
           G      ++ +W++N       +  I W+          IGAK I  +     D T +  
Sbjct: 128 GFSQAEKMMTEWRNNNVLTSLHNTRIHWLTQRTDLGRTTIGAKFITDQGFSLLDATFVQY 187

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
                + +  +   A + +    L     Y+ G  P       +   +K +   +     
Sbjct: 188 KDDATVKNWINTPKATLTHGAWFLTNGTIYKIGHPPEKFTVLKIKTNLKPEFLTERLVNP 247

Query: 245 ASRSFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
           A+  FY++ KK+    SF   ++ F  Y        LI +P +LVAMTLIAA+VSL F+R
Sbjct: 248 ATIPFYQLPKKIMIARSFGYSAHNFDMYLQS-----LIALPALLVAMTLIAATVSLNFTR 302

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
             Q R ++  G+ +GFMLY I  ++++FG +G + P+ AA  PV++ + L I  LL KED
Sbjct: 303 FGQSRTLILGGVIAGFMLYVISVLVQAFGNAGYIPPIIAAWTPVVIALFLGISFLLHKED 362

Query: 361 G 361
           G
Sbjct: 363 G 363


>gi|260466947|ref|ZP_05813129.1| permease YjgP/YjgQ family protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029244|gb|EEW30538.1| permease YjgP/YjgQ family protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 360

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 196/366 (53%), Gaps = 19/366 (5%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF  Y+  T++F LG + LVF+ID  E+  +   LP ++      ++  R+P+I+ 
Sbjct: 5   LGRYFFFRYVAITIWFFLGLLALVFLIDFTELSGRTTGLPGFTYGTAMAISGLRMPMIML 64

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PF+ L   +    +LNR  ELVI+R+ G+S WQ L P  +G++L G+ +V +INP+A
Sbjct: 65  QTVPFVGLFSAMATLVSLNRRYELVIARSAGVSAWQFLLPCCIGALLFGVVSVGIINPLA 124

Query: 125 TSGEKIGIDLIQQWKDN-GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
                +   +  Q +    +   +D  PW++      D  IGA+ IL +     D     
Sbjct: 125 AHAFSLSEQIETQLRSGKSNTVSADAAPWIRQKTSSGDTIIGARAILNQGLEMSDAVFFI 184

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
           +D++  I  RKDA  A + +   +L+ V  ++ G I    N     +P  +    +F ++
Sbjct: 185 LDQQGNIAERKDAVRAYLRDGYWELQDVKTFRNGVIQSAAND---RVPTNLK--PEFVQE 239

Query: 244 FASR----SFYEIIKKM----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +R     FY++  K+    SF  K+N F       QF  L+ +P +LVAMTLIAA+VS
Sbjct: 240 RLARPETIPFYDLPGKIEVARSFGLKANAF-----AMQFDSLVALPFLLVAMTLIAATVS 294

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           + F+R  Q   ++  G+ +GF+LY +  ++K+FG +G +    AA +PV++ +   +  L
Sbjct: 295 MRFARMGQSATMILGGVVAGFLLYVVSVLVKAFGVAGFVPTAVAAWVPVVVAMFFGVTFL 354

Query: 356 LQKEDG 361
           L KEDG
Sbjct: 355 LYKEDG 360


>gi|163759135|ref|ZP_02166221.1| putative permease [Hoeflea phototrophica DFL-43]
 gi|162283539|gb|EDQ33824.1| putative permease [Hoeflea phototrophica DFL-43]
          Length = 345

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 186/347 (53%), Gaps = 4/347 (1%)

Query: 16  TTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVN 75
           T L + L  ++++ ++D NE   ++   P Y+++ G +++A RVP I+Q  IPF+ L+ +
Sbjct: 2   TFLTYCLAILVIILLVDFNESGRRLSAAPEYTVTTGLLVSALRVPTILQAAIPFVVLIAS 61

Query: 76  IVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLI 135
           I     LNR  ELV++RA GIS WQ L P V  ++L+G   V  +N  A S  +    +I
Sbjct: 62  IATLLQLNRKYELVVARAAGISAWQFLAPLVAANLLIGFIAVAGLNTFAASAMQWAETII 121

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKD 195
            + ++ G  Q SD  PW++    Q D  +GA+            T    D+   I  R +
Sbjct: 122 VE-RNLGSAQSSDSAPWLRQRTEQGDTVLGARASAAGGTRLSGATFFLFDEDQNIKERLE 180

Query: 196 ADLAIIYNDKVKLKKVVEYQYGRIPIDK-NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK 254
           A+ A++ + +  L  V   + G  P+++  S ++   +K +   +      +  F+E+  
Sbjct: 181 AETAVLGDGEWVLTNVRRIR-GSEPVEQVESASVPTSLKAEFVGESLTSPDTVPFFELRD 239

Query: 255 KMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFS 314
           K++ + KS        E QF+ L+  P +L AMTLIAA VSL+F R  Q   ++  GI +
Sbjct: 240 KIAVA-KSFGLSATSYEMQFHRLVAQPALLAAMTLIAAIVSLKFVRFGQSLTVILGGILA 298

Query: 315 GFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           GF+LY +  ++++F  +G + P+ AA +PV++  +L   +LL KEDG
Sbjct: 299 GFVLYVVSELIQAFANAGTIPPIVAAWLPVLVASALGTTVLLHKEDG 345


>gi|110634109|ref|YP_674317.1| permease YjgP/YjgQ [Mesorhizobium sp. BNC1]
 gi|110285093|gb|ABG63152.1| permease YjgP/YjgQ [Chelativorans sp. BNC1]
          Length = 359

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 184/368 (50%), Gaps = 25/368 (6%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYFF+ Y   T +  +G   LV+++   EI  + G+L  ++ S    LAA ++P+I+Q
Sbjct: 6   LGRYFFRRYAVITAWNFIGVAALVYIVTFTEITGRAGDLEGFTTSWALGLAALQLPIIMQ 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PFI LV  I    +LNR  ELVI+RA GIS WQ L P   G+ + G+ TVLV+NPIA
Sbjct: 66  QAVPFIGLVAAIATLISLNRKYELVIARAAGISAWQFLTPIAFGAFVFGLLTVLVLNPIA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT- 183
                    +++      D   +    W++    Q +  IGA   L         T +  
Sbjct: 126 ARAFA-SAQMLEATVRGADTSNNAKERWIKQRTDQGETIIGADAALAGG------TELVR 178

Query: 184 ----IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG--- 236
               I   ++I  R DA  A + +   +L  VV  Q G  P  +   T  +P  +     
Sbjct: 179 PVFFIIGDDRIAERLDAASAFLRDGYWELVDVVRRQGGNAP--EKIATARVPTNLKPEFV 236

Query: 237 FQKFSEQFASRSFY---EIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
            Q+ ++  A   F     I    SF  ++N F       Q + LI +P +LVAMTLIAA+
Sbjct: 237 GQELTDPDAVSIFALPGMIETAHSFGLRANAF-----AMQLHSLITLPPLLVAMTLIAAT 291

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
           VS+ F+R  Q   ++  G+ +GF+LY    ++++FG +G + P  AA  PV++ +   + 
Sbjct: 292 VSMRFTRMGQSATVILGGVVAGFLLYVSSVLVRAFGDAGFVPPPIAAWTPVMVAMFFGVT 351

Query: 354 ILLQKEDG 361
            LL +EDG
Sbjct: 352 FLLFREDG 359


>gi|90419501|ref|ZP_01227411.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336438|gb|EAS50179.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 360

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 109/355 (30%), Positives = 181/355 (50%), Gaps = 2/355 (0%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYFF+ Y+ + L  LL    L+++IDL E+  +     +      A+ +  RVP  I Q 
Sbjct: 8   RYFFRLYVVSFLSTLLTVFALIYLIDLIEVSRR-SRFEDLGFGATALFSLLRVPSFIGQA 66

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            PFI L  +I     LNR  ELV++RA G+SIWQ+L PFVVGS L+GI    V NP+   
Sbjct: 67  FPFIVLFSSIYTLLTLNRRLELVVARASGVSIWQILLPFVVGSFLIGIVATFVYNPLTAY 126

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            + +  D+       GD   SD +PW++         +GAK +     +  D T+  ++ 
Sbjct: 127 TKTLSEDMQTTMTAGGDVSSSDRVPWLRQEGDGIQSILGAKTVARSGTVLGDITAFVMND 186

Query: 187 KNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFAS 246
           +  +  R DA  A++ ++   L+K    + G  P       L   ++ +  ++      +
Sbjct: 187 EGIVKERIDAARAVLNDEYWLLEKPRVTRVGYRPEFPQEYKLPTSLRPEYVEQRIADPEA 246

Query: 247 RSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRI 306
            S +++  K+  +  S  F+      Q++ L+  P + +AMTL+AA+V+  FSR+ Q   
Sbjct: 247 ISIWQLGSKIDVA-ASLGFNTDAFRMQYHTLVAQPALFIAMTLLAATVATRFSRTGQSGR 305

Query: 307 IVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            +A G+ +GF+LY +  + K+ G + ++ PV AA  PV+      + ILL +EDG
Sbjct: 306 TIAGGVMAGFVLYVVTFLAKALGSNDVVPPVMAAWFPVLAAGLSGVTILLHQEDG 360


>gi|118590093|ref|ZP_01547496.1| permease YjgP/YjgQ [Stappia aggregata IAM 12614]
 gi|118437065|gb|EAV43703.1| permease YjgP/YjgQ [Stappia aggregata IAM 12614]
          Length = 364

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 185/358 (51%), Gaps = 7/358 (1%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YF   +LK  L   L A +L+++ D+ E+  + G+   +S+ R A+++A RVPL+++Q+I
Sbjct: 10  YFSGRFLKAILGLFLFAAVLIYLFDVLELVRRGGDREGFSVLRVAMISALRVPLLLEQVI 69

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT-- 125
           PF  L   I  F  L+R  ELV++RA GIS+WQ   P ++  I+LGI ++ V NP A   
Sbjct: 70  PFTVLFGAIAAFVTLSRALELVVARASGISVWQFSLPAILVGIILGILSITVYNPAAVWF 129

Query: 126 --SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
               +++   L    +    +  +D+  W++      +  + AK++L    +    T  T
Sbjct: 130 QQKSDEVAAGLFGSEQSFLLQSSNDV--WVRQDGLDGESVLLAKQLLEGGTLLRGVTIFT 187

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            DK      R +AD A + +    L+  + Y   + P       ++  +     ++    
Sbjct: 188 FDKDGTFRERIEADEARLGDQIWYLENAIVYTTEQDPQPYGQYQISTFLTATEVRESIGS 247

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             S SF+ + + +  +  + +   YR   Q+  L+  PL+LVAM LIAA+VSL+ SR   
Sbjct: 248 PESISFWNLPRFIELARNAGL-PAYRYNLQYQTLLARPLLLVAMILIAAAVSLKVSRFGG 306

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              ++  GI SGF+LY +  + K FG +GI+ P+ AA  P I  + + + ILL +EDG
Sbjct: 307 LGSMILGGILSGFVLYVLTELAKDFGGAGIVPPLVAAWAPGIFGVLMGLTILLNQEDG 364


>gi|218659050|ref|ZP_03514980.1| putative permease protein [Rhizobium etli IE4771]
          Length = 272

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 140/243 (57%), Gaps = 2/243 (0%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           R+PL +QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PFV GS+ LG+ T 
Sbjct: 2   RLPLNLQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFVAGSLALGVLTT 61

Query: 118 LVINPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
             +NP+A  G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +       
Sbjct: 62  TALNPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKL 121

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG 236
            D   I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D 
Sbjct: 122 VDAVLIHFDSSGRVIMRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDF 181

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            Q+      +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL
Sbjct: 182 VQERLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSL 240

Query: 297 EFS 299
           +FS
Sbjct: 241 KFS 243


>gi|114704780|ref|ZP_01437688.1| hypothetical protein FP2506_07586 [Fulvimarina pelagi HTCC2506]
 gi|114539565|gb|EAU42685.1| hypothetical protein FP2506_07586 [Fulvimarina pelagi HTCC2506]
          Length = 360

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/357 (28%), Positives = 178/357 (49%), Gaps = 6/357 (1%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYFF+ YL      ++    LV +IDL E+  +   L + S+    + +A RVP  ++Q 
Sbjct: 8   RYFFRLYLVNFFSTVVAVSALVLLIDLVEL-GRRSVLADQSLGVLLLFSALRVPAFMEQA 66

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA-- 124
            PFI L  +I    +LNR  ELV++RA G+S WQ+L PF+ GS+ LG+      NP++  
Sbjct: 67  FPFIILFSSIFTLISLNRRLELVVARAAGVSAWQILMPFIAGSLFLGLLATFAYNPLSAY 126

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
           T  +   I+   + ++          PW++ +       +GA ++     +  + ++  +
Sbjct: 127 TKAQAANIESAAEGREVASSALQT--PWLRQNADGVRSIMGATQVAENGRVLSNVSAFVM 184

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
                +  R DA  A + N +  L +    + G  P D     L   ++ +  ++     
Sbjct: 185 ADDGSVETRIDAPRAELGNQEWILLRPRVTRIGYTPRDLVEYRLPTSLRPEYIEQRLADP 244

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            + S +E+  K+  +  S  F++     Q++ LI  P + VAMTL+AA+V+  FSR+ QP
Sbjct: 245 ETISIWELGSKIDVA-ASLGFNSMAFSMQYHTLIAQPALFVAMTLLAATVATRFSRTGQP 303

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
             I   G+ +GF+LY +  + K+ G + ++ P+ AA  PV+      + ILL +EDG
Sbjct: 304 GRIFVGGVLAGFVLYVVTFLAKALGSNDVVPPIVAAWFPVLAAGLFGVTILLHQEDG 360


>gi|307946742|ref|ZP_07662077.1| permease [Roseibium sp. TrichSKD4]
 gi|307770406|gb|EFO29632.1| permease [Roseibium sp. TrichSKD4]
          Length = 364

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 107/365 (29%), Positives = 184/365 (50%), Gaps = 21/365 (5%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YF   + K+ L   L A +L+F+ D+ E+  + G+   +++ R A+++  RVPL+++Q+I
Sbjct: 10  YFSARFFKSILGLFLLAAVLIFLFDVLELVRRGGDQEGFTVVRVALISILRVPLLLEQVI 69

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT-- 125
           PF  L  +I+ F  L+R  ELV++RA GIS+WQ   P VV  +++G  +V+  NP+A   
Sbjct: 70  PFAVLFGSILAFVTLSRALELVVARASGISVWQFAAPAVVVGLIIGTLSVVAYNPLAVWL 129

Query: 126 --SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
               ++    L    +    +   D+  W++      +  + AK++L       D T   
Sbjct: 130 QHRSDEAAAGLFGSEQSFLLQTTQDV--WVRQDGLDGESVLLAKQLLDGGTRLLDVTIFA 187

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEY-------QYGRIPIDKNSTTLNIPIKMDG 236
            DK+     R +A  A + +    L+ V  Y       QYGR  +    T   +   +  
Sbjct: 188 FDKEGSFKERVEAATARLGDQIWFLEDVTVYTTERDPQQYGRYEVSTYLTATEVRESIGS 247

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            +       S SF+ + + +  +  + +   YR   Q+  L+  PL+L AM +IAA+VSL
Sbjct: 248 PE-------SISFWSLPRFIELARNAGL-PAYRYTLQYQTLLARPLLLTAMIIIAAAVSL 299

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
             SR      ++  GI +GF+LY +  + K FG +GI+ P+ AA  P I  + + + ILL
Sbjct: 300 RVSRFGGLGSMILGGIVAGFVLYVLSELAKDFGGAGIVPPIVAAWAPGIFGVLMGLTILL 359

Query: 357 QKEDG 361
           ++EDG
Sbjct: 360 KQEDG 364


>gi|254503227|ref|ZP_05115378.1| putative permease, YjgP/YjgQ family [Labrenzia alexandrii DFL-11]
 gi|222439298|gb|EEE45977.1| putative permease, YjgP/YjgQ family [Labrenzia alexandrii DFL-11]
          Length = 364

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 177/358 (49%), Gaps = 7/358 (1%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YF   ++K  L   L A +L+F+ D+ E+  +  +   +++ R A ++  RVPL+++Q+I
Sbjct: 10  YFSGRFIKAILGLFLFAAVLLFLFDVLELVRRGSDREGFTVMRVAYISLLRVPLLLEQVI 69

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT-- 125
           PF  L   I  F  L+R  ELV++RA GIS+WQ   P V+  + LGIF++ V NP A   
Sbjct: 70  PFTVLFGAIAAFVTLSRALELVVTRAAGISVWQFSTPAVLVGLFLGIFSITVYNPAAVYL 129

Query: 126 --SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
               E+    L     D     +S    W++      +  + A ++L         T  T
Sbjct: 130 QQKSEEAAAGLFG--ADQTFLLQSSGEVWVRQDGLDGESVLRASQLLDNGTRLLRVTVFT 187

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D+      R +A+ A + N+   L   + Y     P   +   ++  +     ++    
Sbjct: 188 FDEDGTFRERIEAEQARLGNETWYLDNAIVYTTENDPQSYSVYQISTFLTATEVRESIGS 247

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             S SF+ + + +  +  + +   YR   Q+  L+  PL+L+AM LIAA+VSL+ SR   
Sbjct: 248 PESISFWNLPRFIDLARNAGL-PAYRYNLQYQSLLARPLLLIAMILIAAAVSLKVSRFGG 306

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              ++  GI SGF+LY +  + K FG +GI+ P+ AA  P I  + + + ILL +EDG
Sbjct: 307 LGRMILGGILSGFVLYVLTELAKDFGGAGIVPPLVAAWAPGIFGVLMGLTILLHQEDG 364


>gi|254473284|ref|ZP_05086681.1| permease YjgP/YjgQ [Pseudovibrio sp. JE062]
 gi|211957400|gb|EEA92603.1| permease YjgP/YjgQ [Pseudovibrio sp. JE062]
          Length = 363

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/358 (27%), Positives = 183/358 (51%), Gaps = 7/358 (1%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  K +LK+ L   L A +L+ + D+ E+  + G+   +S+ R A ++A RVPL+++Q+I
Sbjct: 9   YISKRFLKSILALFLFAAVLILLFDVLELVRRGGDREGFSLLRIAAISALRVPLLLEQVI 68

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT-- 125
           PF  L  +I  F  L+R+ ELV++RA GIS+WQ   P ++  + +GI +V+  NP A   
Sbjct: 69  PFAVLFGSIWAFVTLSRSLELVVARAAGISVWQFTAPALLTGLFIGIASVIGYNPGAVYL 128

Query: 126 --SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
               +++   L    +    +   ++  W++ +    +  + A+ I  +       T  +
Sbjct: 129 QQKSDEVAEGLFSVEQTYLLEGSGEV--WLRQNGTDGESVLHARHIGGQGATLNGVTIFS 186

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D++ +   R +A  A++     +L   V Y     P   ++ +++  +     ++    
Sbjct: 187 FDRQGEFSERIEARRAVLAEGMWRLTDAVVYALDTDPQHYDNYSVSTFLTPTEVKESIGS 246

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             S SF+ + + +  S ++ +   YR   Q+  L+  PL+LVAM +IAA+VSL  SR   
Sbjct: 247 PESISFWSLPRFIELSQRAGL-PAYRYSLQYQTLLAKPLLLVAMIVIAAAVSLRVSRFGG 305

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              ++ +GI +GF+LY +  I K  G +GI+    AA  P +  + +   ILL +EDG
Sbjct: 306 IGRLIIWGIIAGFVLYAVSEISKDLGGAGIVPTAVAAWAPGVFGVLMGFTILLNQEDG 363


>gi|218508596|ref|ZP_03506474.1| putative permease protein [Rhizobium etli Brasil 5]
          Length = 239

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 135/236 (57%), Gaps = 2/236 (0%)

Query: 127 GEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
           G++  + +   W+ +N   +K+  IPW++  + + D+ IGA+ +        D   I  D
Sbjct: 5   GQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDAVLIHFD 64

Query: 186 KKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFA 245
              ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+      
Sbjct: 65  SSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQERLTAPE 124

Query: 246 SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPR 305
           +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FSR NQ R
Sbjct: 125 TIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFSRFNQSR 183

Query: 306 IIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +EDG
Sbjct: 184 SVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQEDG 239


>gi|39936125|ref|NP_948401.1| permease YjgP/YjgQ [Rhodopseudomonas palustris CGA009]
 gi|39649979|emb|CAE28503.1| predicted permease [Rhodopseudomonas palustris CGA009]
          Length = 361

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 98/364 (26%), Positives = 181/364 (49%), Gaps = 15/364 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLI 62
           L RYF + ++  +L    G  +L+  +D  ++  + G L   ++S   V  A+  RVP +
Sbjct: 6   LGRYFARRFVIASLGVFFGLFVLLVFVDYVDLLRRAGGL---AVSAFYVAQASFCRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELV++RA G+S W+ ++P +  +I +GIF   V NP
Sbjct: 63  LERLLPFCILIGGMTCYLALSRSLELVVARAAGLSAWEFISPALWSAIAIGIFATTVFNP 122

Query: 123 IATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           ++   ++    +  +   ++ G  Q ++   WM   +P     I A +   +  +    T
Sbjct: 123 LSAHMQERAKQMEAEMFGENTGGLQDANGF-WMNQVSPDGQAIINAARSQQQGAVLTGIT 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
               +   +   R +A  A++      LK V  Y     P+D++  TL +P  +    + 
Sbjct: 182 VFRFEPDFQFKDRIEAREAVLEPGHWLLKNVRRYTMDGAPVDQD--TLELPTSLT-LAQV 238

Query: 241 SEQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
              FA   S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVSL 
Sbjct: 239 RNSFATPESVSFWQLPTYIKSSENSG-FATAGYRLQYHKLLAKPFLLAAMVMLAASVSLR 297

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL 
Sbjct: 298 FFRFGGVQKMVLSGVAAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLY 357

Query: 358 KEDG 361
           +EDG
Sbjct: 358 QEDG 361


>gi|192291843|ref|YP_001992448.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris
           TIE-1]
 gi|192285592|gb|ACF01973.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris
           TIE-1]
          Length = 362

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 98/364 (26%), Positives = 181/364 (49%), Gaps = 15/364 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLI 62
           L RYF + ++  +L    G  +L+  +D  ++  + G L   ++S   V  A+  RVP +
Sbjct: 7   LGRYFARRFVIASLGVFFGLFVLLVFVDYVDLLRRAGGL---AVSAFYVAQASFCRVPQL 63

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELV++RA G+S W+ ++P +  +I +GIF   V NP
Sbjct: 64  LERLLPFCILIGGMTCYLALSRSLELVVARAAGLSAWEFISPALWSAIAIGIFATTVFNP 123

Query: 123 IATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           ++   ++    +  +   ++ G  Q ++   WM   +P     I A +   +  +    T
Sbjct: 124 LSAHMQERAKQMEAEMFGENTGGLQDANGF-WMNQVSPDGQAIINAARSQQQGAVLTGIT 182

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
               +   +   R +A  A++      LK V  Y     P+D++  TL +P  +    + 
Sbjct: 183 VFRFEPDFQFKDRIEAREAVLEPGHWLLKNVRRYTMDGAPVDQD--TLELPTSLT-LAQV 239

Query: 241 SEQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
              FA   S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVSL 
Sbjct: 240 RNSFATPESVSFWQLPTYIKSSENSG-FATAGYRLQYHKLLAKPFLLAAMVMLAASVSLR 298

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL 
Sbjct: 299 FFRFGGVQKMVLSGVAAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLY 358

Query: 358 KEDG 361
           +EDG
Sbjct: 359 QEDG 362


>gi|316933707|ref|YP_004108689.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris DX-1]
 gi|315601421|gb|ADU43956.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris DX-1]
          Length = 361

 Score =  139 bits (349), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 97/364 (26%), Positives = 179/364 (49%), Gaps = 15/364 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLI 62
           L RYF + ++  +L    G  +L+  +D  ++  + G L   ++S   V  A+  RVP +
Sbjct: 6   LGRYFARRFVVASLGVFFGLFVLLVFVDYVDLLRRAGGL---AVSAFYVAQASFCRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELV++RA G+S W+ ++P +  +I +GI    + NP
Sbjct: 63  LERLLPFCILIGGMTCYLALSRSLELVVARAAGLSAWEFISPALWSAIAIGIVATTIFNP 122

Query: 123 IATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           ++   ++    +  +   ++ G  Q ++   WM   NP     I A +   +  +    T
Sbjct: 123 LSAHMQERAKQMEAEMFGENTGGLQDANGF-WMNQVNPDGQAIINAARSQQQGAVLTGIT 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
               D   +   R +A  A++      LK V  Y     P D++  T+ +P  +    + 
Sbjct: 182 IFRFDPNFQFRDRIEAREAVLEPGHWLLKSVRRYTLDSAPTDQD--TMELPTSLT-LAQV 238

Query: 241 SEQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
              FA   S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVSL 
Sbjct: 239 RNSFATPESVSFWQLPAYIKSSENSG-FATAGYRLQYHKLLAKPFLLAAMVMLAASVSLR 297

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL 
Sbjct: 298 FFRFGGVQKMVLSGVAAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLY 357

Query: 358 KEDG 361
           +EDG
Sbjct: 358 QEDG 361


>gi|306842049|ref|ZP_07474722.1| permease YjgP/YjgQ family protein [Brucella sp. BO2]
 gi|306287890|gb|EFM59310.1| permease YjgP/YjgQ family protein [Brucella sp. BO2]
          Length = 286

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 93/289 (32%), Positives = 154/289 (53%), Gaps = 16/289 (5%)

Query: 81  NLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKD 140
           +LNR  ELV++R++G+S WQ L P   G++L G+ T+ ++NP+A  G     ++   WK 
Sbjct: 6   SLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFILNPLAAHGFSKAEEIAAMWKT 65

Query: 141 NGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLA 199
                 S +  PW++    + +  IGAK IL +     D T I  D++  I  R DA  A
Sbjct: 66  GKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLADATFIQFDEQKNIKDRYDARTA 125

Query: 200 IIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRS---FYEIIKKM 256
            + +   +L  V+ +  G+ P  +   T  I  ++   +   E+ AS     F ++  K+
Sbjct: 126 TLQDGYWELTDVMRFARGQEP--QKLETFRISTQLRP-EYVEEKLASPETIPFTQLRHKI 182

Query: 257 ----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGI 312
               SF   +N F     + Q+  L+ +P +L+AMTLIAA+VSL+F R  Q   ++  G+
Sbjct: 183 EVARSFGYSANAF-----DMQYQSLLALPALLMAMTLIAATVSLKFVRFGQSGAMILGGV 237

Query: 313 FSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL KEDG
Sbjct: 238 IAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLLHKEDG 286


>gi|146340303|ref|YP_001205351.1| putative permease [Bradyrhizobium sp. ORS278]
 gi|146193109|emb|CAL77120.1| putative permease [Bradyrhizobium sp. ORS278]
          Length = 365

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 96/364 (26%), Positives = 177/364 (48%), Gaps = 13/364 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   +L + +       +L+ ++D  E+  +   L + S    A  +  RVP +++
Sbjct: 8   LGRYFAGRFLVSAVGVFASIFLLLVLVDYIEMVRRTSGLASASALMVAETSLFRVPQLLE 67

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++PF  L+  +  +  L+R  ELV++RA G+S WQ + P +  +I+LG+    + NP++
Sbjct: 68  KMMPFCVLIGAMTCYLALSRRLELVVARAAGVSAWQFIAPALASAIVLGLMATTLYNPMS 127

Query: 125 TS----GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
            +     +++  +L       G +  S    W+   NP   + I A +   +       T
Sbjct: 128 ANLRELSKRMEAELFGSAPGGGVQDASGF--WLNQLNPDGSVIINAARSEQQGVRLTGLT 185

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ-- 238
               D KN+   R +A  A + + +   K V  +     P+D+   T  +P  +   Q  
Sbjct: 186 LFRFDTKNRFKDRIEAREASLEDGQWVFKSVRRFSLDAPPVDE--PTFILPTTLTPAQVR 243

Query: 239 -KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
             FS    + SF+++   +  S++S+ F       Q++ LI  P +L AM ++AASVSL 
Sbjct: 244 NSFSTP-ETVSFWQLPSYIR-SSESSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLR 301

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      + LL 
Sbjct: 302 FFRMGGVQKMVLSGVGAGFLLYVLSKVTEDLSKAALMDPIAAAWLPVFVGGLTGFMALLY 361

Query: 358 KEDG 361
           +EDG
Sbjct: 362 QEDG 365


>gi|209885475|ref|YP_002289332.1| permease YjgP/YjgQ [Oligotropha carboxidovorans OM5]
 gi|209873671|gb|ACI93467.1| permease YjgP/YjgQ [Oligotropha carboxidovorans OM5]
          Length = 364

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 183/363 (50%), Gaps = 14/363 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF + ++  +    LG  +L+ ++D  E+  +   +P  S    A  +  RVP +++
Sbjct: 10  LARYFARRFIVASCAVFLGIFLLLVLVDYIEMVRRTSSIPTASAFMVAQTSLFRVPQLLE 69

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++PF  L+  +  +  L+R+ ELV++RA GIS WQ + P +V ++++GI   +  NPI+
Sbjct: 70  RLMPFCILIGAMSCYLALSRSLELVVARAAGISAWQFITPALVSALVMGILATVAYNPIS 129

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII-PWM-QISNPQQDIFIGAKKILPENHIWEDFTSI 182
            + ++   ++  Q   NG  Q  D+   W+ Q+++  Q I   A   L +N      + +
Sbjct: 130 AAMQERSKEMEAQLFSNGGVQ--DVAQSWINQVTSEGQSIISAA---LSQNQ-GTRLSGV 183

Query: 183 TIDKKN---KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T+ + N       R DA  A +   + +L     Y     PI  +S  L+  +     + 
Sbjct: 184 TVFRFNPDGSFRDRIDARDANLEPGQWRLGGARIYSMTAAPIPHDSFLLSTNLTPSQVRN 243

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIF-HNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
                 + SF+++ + +  S  S +    YR   Q+  L+  P +L +M L+AA+VSL F
Sbjct: 244 SFATPETVSFWQLPEYIRSSQSSGLATAGYR--LQYQKLLARPFLLASMVLVAAAVSLRF 301

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +   +  L LL +
Sbjct: 302 FRFGGVQKMVLSGVAAGFLLYVLSKVTEDLSKAELMHPLAAAWLPVCVGGLIGFLALLHQ 361

Query: 359 EDG 361
           EDG
Sbjct: 362 EDG 364


>gi|86749599|ref|YP_486095.1| permease YjgP/YjgQ [Rhodopseudomonas palustris HaA2]
 gi|86572627|gb|ABD07184.1| permease YjgP/YjgQ [Rhodopseudomonas palustris HaA2]
          Length = 361

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 99/366 (27%), Positives = 178/366 (48%), Gaps = 19/366 (5%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLI 62
           L RYF   ++ + L    G  +L+  +D  ++  + G L   S+S   +  A+  RVP +
Sbjct: 6   LGRYFAARFVSSALGVFFGLFVLLVFVDYIDLLRRAGGL---SVSAFVIAQASFFRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R  ELVI+RA G+S WQ + P +  ++ LG+F   V NP
Sbjct: 63  LERLLPFCILIGGMTCYLALSRRLELVIARAAGLSAWQFIAPALWSALALGVFASAVFNP 122

Query: 123 IAT----SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           ++       +++  +L  Q   +G  Q ++   WM   +P+    I A +   +  +   
Sbjct: 123 MSAYMQERAKQMEAELFGQ--GSGSLQDANGF-WMNQVSPEGQSIINAARSQQQGAVLSG 179

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            +    +   +   R +A  A++      LK V +Y     P  +   TL +P  +    
Sbjct: 180 ISVFRFEPDFQFKDRIEAREAVLEPGYWLLKDVRKYTLDSAP--EEQATLRLPTALT-LA 236

Query: 239 KFSEQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
           +    FA   S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVS
Sbjct: 237 QVRNSFATPESVSFWQLPSYIKASESSG-FATAGYRLQYHKLLAKPFLLAAMVMLAASVS 295

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           L F R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L L
Sbjct: 296 LRFFRFGGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLAL 355

Query: 356 LQKEDG 361
           L +EDG
Sbjct: 356 LYQEDG 361


>gi|91977435|ref|YP_570094.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB5]
 gi|91683891|gb|ABE40193.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB5]
          Length = 361

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 93/363 (25%), Positives = 175/363 (48%), Gaps = 13/363 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLI 62
           L RYF   ++ + L    G  +L+  +D  ++  + G L   ++S   +  A+  RVP +
Sbjct: 6   LGRYFAARFVTSALGVFFGLFVLLVFVDYIDLLRRAGGL---AVSALVIAQASFYRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELVI+RA G+S W+ ++P +  ++ LG+F   V NP
Sbjct: 63  LERLMPFCILIGGMTCYLALSRSLELVIARAAGLSAWEFVSPALWSALALGVFASAVFNP 122

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIP-WMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++   ++    +  +    G     D    WM   +P+    I A +   +  +    + 
Sbjct: 123 MSAYMQERAKQMEAELFGQGSGSLQDASGFWMNQVSPEGQSIINAARSQQQGAVLSGISV 182

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              +   +   R +A  A++      L+ V  Y     P+ ++  T  +P  +    +  
Sbjct: 183 FRFEPDFQFKDRIEAREAVLEPGHWLLRDVRRYTLDSAPVQED--TFRLPTALT-LAQVR 239

Query: 242 EQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
             FA   S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVSL F
Sbjct: 240 NSFATPESVSFWQLPSYIRASESSG-FATSGYRLQYHKLLAKPFLLAAMVMLAASVSLRF 298

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +
Sbjct: 299 FRFGGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLYQ 358

Query: 359 EDG 361
           EDG
Sbjct: 359 EDG 361


>gi|299133713|ref|ZP_07026907.1| permease YjgP/YjgQ family protein [Afipia sp. 1NLS2]
 gi|298591549|gb|EFI51750.1| permease YjgP/YjgQ family protein [Afipia sp. 1NLS2]
          Length = 360

 Score =  132 bits (332), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 183/362 (50%), Gaps = 12/362 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF + ++  +L   LG  +L+ ++D  E+  +   +P  S    A  +  RVP +++
Sbjct: 6   LARYFARRFIIASLAVFLGIFLLLVLVDYIEMVRRTSSIPTASAIMVAETSLFRVPQLLE 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++PF  L+  +  +  L+R+ ELV++RA GIS WQ + P +V ++L+G+   +V NPI+
Sbjct: 66  KLMPFCILIGAMSCYLALSRSLELVVARAAGISAWQFITPALVAALLMGVLATVVYNPIS 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWM-QISNPQQDIFIGAKKILPENHIWEDFTSIT 183
            + ++   ++  +   NG  Q  +   W+ Q+++  Q I   A   L +N      + +T
Sbjct: 126 AAMQERSKEMEAKLFSNGGVQNVE-QSWINQVTSEGQSIISAA---LSQNQ-GTRLSGVT 180

Query: 184 IDKKN---KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
           + + N       R DA+ A +   + +L     +     P+ +++  L   +     +  
Sbjct: 181 VFRFNPDGSFRDRIDANEANLEPGEWRLGGARIHSMTAAPVIQDNLLLKTNLTPAQVRNS 240

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIF-HNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                + SF+++   +  S  S +    YR   Q+  L+  P +L +M L+AA+VSL F 
Sbjct: 241 FATPETVSFWQLPGYIQSSASSGLATAGYR--LQYQKLLARPFLLASMVLVAAAVSLRFF 298

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +E
Sbjct: 299 RFGGVQKMVLSGVAAGFLLYVLSKVTEDLSKAELMYPLAAAWLPVCVGGLTGFLALLHQE 358

Query: 360 DG 361
           DG
Sbjct: 359 DG 360


>gi|328544012|ref|YP_004304121.1| permease YjgP/YjgQ [polymorphum gilvum SL003B-26A1]
 gi|326413756|gb|ADZ70819.1| Permease YjgP/YjgQ [Polymorphum gilvum SL003B-26A1]
          Length = 363

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 101/357 (28%), Positives = 187/357 (52%), Gaps = 5/357 (1%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YF + +LK  L   L A +L+F+ D+ E+  + GE  ++S+ R  +++  RVPL+++Q++
Sbjct: 9   YFSRRFLKAILGLFLLAAVLIFLFDVLELLRRAGERGDFSVLRITLISLLRVPLLLEQVL 68

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           PF  L   I  F  L+R  ELV++RA GIS+WQ   P V+ ++++G+ +V + NP+A   
Sbjct: 69  PFAVLFGAIWAFVTLSRALELVVARAAGISVWQFGAPAVLVALIIGLVSVTLYNPMAVWM 128

Query: 128 EKIGIDLIQQWKDNGDK---QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
           ++   ++        +    Q ++ + W++      +  + A+++L         T  T 
Sbjct: 129 QERSNEVAAGIFGTEETFLLQTTNAV-WIRQDGLDGESVLNAEQLLDHGERLLGVTIFTF 187

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
           D+      R +A  A + N    LK V+ Y     P    +  ++  +     ++     
Sbjct: 188 DRAGSFQERIEAREARLRNQFWHLKDVIVYTTESDPQRYGTYEVSTYLTPTEVRESIGAP 247

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            S SF+ + + +  ++++ +   YR   Q++ L+  PL+L+AM LIAA+VSL  SR    
Sbjct: 248 ESISFWNLPRFIELASRAGL-PAYRYTLQYHSLLARPLLLLAMVLIAAAVSLRVSRFGGL 306

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
             ++  GI +GF+LY +  + + FG +GI+ P+ AA  P    + + + ILL +EDG
Sbjct: 307 GGMILGGIIAGFVLYVLSELGRDFGGAGIVPPLVAAWAPGAFGVLMGLTILLNREDG 363


>gi|75675870|ref|YP_318291.1| permease YjgP/YjgQ [Nitrobacter winogradskyi Nb-255]
 gi|74420740|gb|ABA04939.1| permease YjgP/YjgQ [Nitrobacter winogradskyi Nb-255]
          Length = 365

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 94/362 (25%), Positives = 175/362 (48%), Gaps = 9/362 (2%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   ++   L       +L+ ++D  E+  +   L + S    A  +  RVP +++
Sbjct: 8   LGRYFAGRFMVAALGVFASIFLLLVLVDYIEMVRRTSGLASASALMVAETSLFRVPQLLE 67

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           ++ PF  L+  +  +  L+R  ELV++RA G+S WQ ++P +  +I LG+F   V NP++
Sbjct: 68  KLTPFCVLIGAMTCYLALSRKLELVVARAAGVSAWQFISPTLACAIALGVFATTVYNPLS 127

Query: 125 TS----GEKIGIDLIQQWKDNGDKQKSDIIPWM-QISNPQQDIFIGAKKILPENHIWEDF 179
           ++     +++  ++       G    S    W+ Q+++  Q I I A     +       
Sbjct: 128 SNLRELSKRMEAEMFGGASGGGLHDASGF--WINQVTDDGQAI-INAALSEQQGVRLTGL 184

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T    D  ++   R +A  A + + +   K V  +     P+++ +  L   +     Q 
Sbjct: 185 TVFRFDPDSRFRERIEAREAALEDGRWLFKGVRRFTLDNPPVEQETFVLPTSLTPAQVQN 244

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 + SF+++   +  S++S+ F       Q++ LI  P +L AM ++AASVSL F 
Sbjct: 245 SFSTPETVSFWQLPDYIR-SSESSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLRFF 303

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R    + +V  G+ SGF+LY +  + +   K+ ++ P+AAA +PV +      L+LL +E
Sbjct: 304 RFGGVQKMVLSGVGSGFLLYVLSKVTEDLSKAELMNPIAAAWLPVCVGGLTGFLVLLHQE 363

Query: 360 DG 361
           DG
Sbjct: 364 DG 365


>gi|288958014|ref|YP_003448355.1| hypothetical protein AZL_011730 [Azospirillum sp. B510]
 gi|288910322|dbj|BAI71811.1| hypothetical protein AZL_011730 [Azospirillum sp. B510]
          Length = 364

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/339 (26%), Positives = 163/339 (48%), Gaps = 17/339 (5%)

Query: 32  DLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVIS 91
           D  E+  + G  P+ +      +A  ++P I QQI PF+ L   +  F+ L R++ELV++
Sbjct: 34  DTVELLRRAGTKPHVTFGLVVEMALLKLPEIGQQIFPFVILFAGMFTFWRLTRSAELVVA 93

Query: 92  RAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP 151
           RA+G+S WQ L P +  +  +G+  V ++NP+      + I    Q +D   K +S  + 
Sbjct: 94  RAVGVSAWQFLMPVMFAAAAIGVVKVTLVNPVGA----VFIAKYDQLQDRYLKLQSSSLN 149

Query: 152 ------WMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDK 205
                 W++ +N  +  FI A+ + P      +      D     + R DA  A++   K
Sbjct: 150 ISRSGLWLRQTNETEQFFIHAELVNPATFELSNVVVFLFDADQNYLARVDAPSAVLRERK 209

Query: 206 VKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFA---SRSFYEIIKKMSFSNKS 262
            +L+  +  +  + P   +S T  IP ++D      E FA   + SF+E + +   + ++
Sbjct: 210 WELQDAILNRAKKDPEKLDSYT--IPTELD-MATIEESFAPPETISFWE-LPRFIHTLET 265

Query: 263 NIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
             F   R    +  L+  P + +AM L AA+ SL   R      +V  G+ +GF+L+ + 
Sbjct: 266 TGFPAVRHRLHYQSLLAQPFLFLAMVLFAAAFSLRLPRRGGTMAMVTGGVLTGFVLFVMT 325

Query: 323 TIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            ++++FG S  +  + AA  P  +++ L I  LL  EDG
Sbjct: 326 DVVRTFGMSETIPIIMAAWSPAGISLLLGIAALLHLEDG 364


>gi|300023218|ref|YP_003755829.1| permease YjgP/YjgQ family protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525039|gb|ADJ23508.1| permease YjgP/YjgQ family protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 364

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 98/362 (27%), Positives = 173/362 (47%), Gaps = 9/362 (2%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEI---QNQMGELPNYSISRGAVLAATRVPL 61
           L RY  + ++   +  L    +L+F+ID  E+     + G +P  ++ R A+L   R+P 
Sbjct: 7   LTRYIARMFIVAIVTTLTVCALLIFMIDFVELLRMAGKYGAVPGTTLLRIALL---RLPA 63

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            I+ +I F  LV +I     LNR SEL + RA G+S+WQ L P +   + +GIF + V N
Sbjct: 64  YIEFLIGFAVLVGSISALIYLNRKSELAVMRAGGMSVWQFLGPGLFVGLAVGIFAMAVFN 123

Query: 122 PIATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           P+A+ G      L  +   N     +      W++ +    +  +GA     +       
Sbjct: 124 PLASRGRATSEKLYAKAFGNEANLLRAQGGGSWIRQNGADGESVLGAAAASNQGLTLTGV 183

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
                D++     R DA  A + +   +L+     + G+ P    S  L+  +  D  Q 
Sbjct: 184 LVFAYDREGHFSERIDAGSAELKDGYWELQDAWVTRLGQEPEKFKSYLLSTYLTPDRVQD 243

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 S SF+++ + +  ++K+ +    R   Q+  L+V P++ +AM L+AA+VSL   
Sbjct: 244 ALGTVFSISFWDLPELIQAADKAKL-STERLRVQYQSLLVRPMLCLAMVLLAATVSLRSF 302

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           RS   + +VA G+  G   + +  I +  G +G+     AA +PV+L +++S  +LL +E
Sbjct: 303 RSGGIQTMVATGMIGGVGFFLLSEIARQIGIAGLAPAWVAAWMPVVLVLAISTTVLLHQE 362

Query: 360 DG 361
           DG
Sbjct: 363 DG 364


>gi|92117864|ref|YP_577593.1| permease YjgP/YjgQ [Nitrobacter hamburgensis X14]
 gi|91800758|gb|ABE63133.1| permease YjgP/YjgQ [Nitrobacter hamburgensis X14]
          Length = 365

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 178/365 (48%), Gaps = 15/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   ++   L       +L+ ++D  E+  +   L + S    A  +  RVP +++
Sbjct: 8   LGRYFASRFVVAALGVFASIFLLLVLVDYIEMVRRTSGLASASAIMVAETSLFRVPQLLE 67

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           ++ PF  L+  +  +  L+R  ELV++RA GIS WQ ++P +  +++LG+      NP++
Sbjct: 68  KLTPFCVLIGAMTCYLALSRRLELVVARAAGISAWQFISPALACALVLGVLATTAYNPMS 127

Query: 125 TS----GEKIGIDLIQQWKDNGDKQKSDIIPWM-QISNPQQDIFIGAKKILPENHIWEDF 179
            +     +K+  +L       G ++ S    W+ Q+++  Q I I A +   +       
Sbjct: 128 ANLRELSKKMEAELFGSVSGGGLQEASGF--WINQVTDDGQAI-INAARSEQQGVRLTGL 184

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ- 238
           T    D  +    R +A  A + + +   K V  +     P+++   T  +P  +   Q 
Sbjct: 185 TVFRFDPDSTFRERIEAREATLEDGRWLFKGVRRFTLDSPPVEQE--TFVLPTSLTAAQV 242

Query: 239 --KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
              FS    + SF+++   +  S++S+ F       Q++ LI  P +L AM ++AASVSL
Sbjct: 243 RNSFSTP-ETVSFWQLPGYIR-SSESSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSL 300

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
            F R    + +V  G+ SGF+LY +  + +   K+ ++ P+AAA +PV +      L+LL
Sbjct: 301 RFFRFGGVQKMVLSGVGSGFLLYVLSKVTEDLSKAELMNPIAAAWLPVCVGGLAGFLVLL 360

Query: 357 QKEDG 361
            +EDG
Sbjct: 361 HQEDG 365


>gi|148255227|ref|YP_001239812.1| putative permease [Bradyrhizobium sp. BTAi1]
 gi|146407400|gb|ABQ35906.1| putative permease [Bradyrhizobium sp. BTAi1]
          Length = 365

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 93/364 (25%), Positives = 174/364 (47%), Gaps = 13/364 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   +L + +       +L+ ++D  E+  +   L + S    A  +  RVP +++
Sbjct: 8   LGRYFAGRFLVSAVGVFASIFVLLVLVDYIEMVRKTSGLASASALMVAETSLFRVPQLLE 67

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++PF  L+  +  +  L+R  ELV++RA G+S WQ + P +  +I+LG+    + NP++
Sbjct: 68  KMMPFCVLIGAMTCYLALSRRLELVVARAAGVSAWQFIAPALASAIVLGLMATTLYNPMS 127

Query: 125 TS----GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
            +     +++  +L       G +  S    W+   NP   + I A +   +       T
Sbjct: 128 ANLRELSKRMEAELFGAAPGGGVQDASGF--WLNQINPDGSVIINAARSEQQGVRLTGLT 185

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ-- 238
               D +     R +A  A + + +   K V  +     P+D+   T  +P  +   Q  
Sbjct: 186 LFRFDTEKHFKDRIEAREATLEDGQWVFKSVRRFSLDAPPVDE--PTFILPTSLTPAQVR 243

Query: 239 -KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
             FS    + SF+++   +  S++S+ F       Q++ LI  P +L AM ++AASVSL 
Sbjct: 244 NSFSTP-ETVSFWQLPSYIR-SSESSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLR 301

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F R    + +V  G+ +GF+LY +  + +   K+ ++ P+ AA +PV +      + LL 
Sbjct: 302 FFRMGGVQKMVLSGVGAGFLLYVLSKVTEDLSKAALMDPIVAAWLPVFVGGLTGFMALLY 361

Query: 358 KEDG 361
           +EDG
Sbjct: 362 QEDG 365


>gi|90423815|ref|YP_532185.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB18]
 gi|90105829|gb|ABD87866.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB18]
          Length = 362

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 93/363 (25%), Positives = 176/363 (48%), Gaps = 12/363 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   ++   L    G  +L+  +D  ++  + G  P+ S       +  RVP +++
Sbjct: 6   LSRYFAGRFVTAALAVFAGLFVLLVFVDYIDLLRRAGGRPSISALLIVQTSVYRVPQLLE 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++PF  L+  +  +  L+R  ELV++RA GIS WQ + P +  ++ LG+F  +V NP++
Sbjct: 66  RLMPFCILIGAMTCYLALSRRLELVVARAAGISAWQFMAPALWSALALGVFATVVFNPMS 125

Query: 125 TSGEKIGIDL-IQQWKDNGDKQKSDIIPWM-QISNPQQDIFIGAKKILPENHIWEDFTSI 182
            + ++    +  + + D+    +     W+ Q++   Q I I A +   +  +    +  
Sbjct: 126 ANMQERAKQMEAEMFGDSSGSLQDASGFWINQVTTEGQAI-INAARSQQQGALLTGLSVF 184

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN----STTLNIPIKMDGFQ 238
             +       R +A  A +     + K +  Y     P+D++     TTL +    + F 
Sbjct: 185 RFEPDFSFSERIEAREATLEPGFWRFKNLRRYTLDGPPVDQDVFLLPTTLTLAQVRNSFS 244

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
                  + SF+++   +  S++S+ F       QF+ L+  P +L AM ++AASVSL F
Sbjct: 245 TPE----TVSFWQLPGYIR-SSESSGFATAGYRLQFHKLLARPFLLAAMVMLAASVSLRF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +
Sbjct: 300 FRFGGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGSLAGFLALLHQ 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|85716330|ref|ZP_01047303.1| permease YjgP/YjgQ [Nitrobacter sp. Nb-311A]
 gi|85696846|gb|EAQ34731.1| permease YjgP/YjgQ [Nitrobacter sp. Nb-311A]
          Length = 365

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 94/362 (25%), Positives = 177/362 (48%), Gaps = 9/362 (2%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   +L   L   +   +L+ ++D  E+  +   L + S    A  +  RVP +++
Sbjct: 8   LGRYFAGRFLVAALGVFVSIFLLLVLVDYIEMVRRTSGLASASALVVAETSLFRVPQLLE 67

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           ++ PF  L+  +  +  L+R  ELV++RA G+S WQ ++P +  +I+LG     V NP++
Sbjct: 68  KLTPFCVLIGAMTCYLALSRQLELVVARAAGVSAWQFISPALACAIVLGALATTVYNPLS 127

Query: 125 TS----GEKIGIDLIQQWKDNGDKQKSDIIPWM-QISNPQQDIFIGAKKILPENHIWEDF 179
            +     +++  +L       G +  S    W+ Q+++  Q I I A +   +       
Sbjct: 128 ANLRELSKRMEAELFGGVSGGGLQDASGF--WINQVTDDGQAI-INAARSEQQGVRLTGL 184

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T    +  ++   R +A  A + + +   K V  +     P+++ +  L+  +     Q 
Sbjct: 185 TVFRFNPHSRFEERIEAREAALEDGRWLFKGVRRFTLDNPPVEQETFVLSTSLTPAQVQN 244

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 + SF+++   +  S++S+ F       Q++ LI  P +L AM ++AASVSL F 
Sbjct: 245 SFSTPETVSFWQLPGYIK-SSESSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLRFF 303

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R    + +V  G+ SGF+LY +  + +   K+ ++ P+AAA +PV +      L+LL +E
Sbjct: 304 RFGGVQKMVLSGVGSGFLLYVLSKVTEDLSKAELMNPIAAAWLPVCVGGLTGFLVLLYQE 363

Query: 360 DG 361
           DG
Sbjct: 364 DG 365


>gi|296116657|ref|ZP_06835267.1| permease YjgP/YjgQ family protein [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976869|gb|EFG83637.1| permease YjgP/YjgQ family protein [Gluconacetobacter hansenii ATCC
           23769]
          Length = 371

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 174/362 (48%), Gaps = 15/362 (4%)

Query: 10  FKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPF 69
           F Y +   + FL G   L+ + D  ++  ++   PN   S  + +A   +P  + +I+PF
Sbjct: 15  FTYAVLAVIAFLTG---LITLFDFIDLLRRVSSRPNVPASLVSEIAVLHIPFAMLEILPF 71

Query: 70  ITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEK 129
             L+  I+ F+ L R+SELV++RA GIS WQ L   V  ++L+G  +  VI+P++++  +
Sbjct: 72  GVLLGGIICFWRLARSSELVVARAAGISAWQFLAGPVGCALLIGALSTTVISPLSSAMYR 131

Query: 130 IGIDLIQQWKDNGDKQK---SDIIPWMQISNP----QQDIFIGAKKILPENHIWEDFTSI 182
               L QQ+      +    S    WM+ S+          I A+++   +++    + I
Sbjct: 132 RAEILDQQYLRESTVKTINMSGGALWMRQSDSGLVDHGVAIIHARRVRLRDNVMR-ISGI 190

Query: 183 TI---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           +I   D ++ ++ R +A    + N +  L+          P+D    TL   + + G Q 
Sbjct: 191 SIFRLDGQDHMLARIEAGHGYLGNGRWVLEGARLLHPDENPVDMGHMTLRADLTLAGVQD 250

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 + S + +   +   N+S  F + R   +F  L+ +P++   M L+AA  S+  +
Sbjct: 251 SLASPNTLSVWALPGFIKLLNRSG-FSSIRHRLRFQSLLTLPVLCGTMALVAAGFSMRPA 309

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R      +++ G+ +GF L+ I  I   FG+SG L PV AA  P    + L++ +LL  E
Sbjct: 310 RRGGVVRMISLGVGAGFALFAISKIAAQFGESGALPPVLAAWAPTGAGLCLAVSLLLHLE 369

Query: 360 DG 361
           DG
Sbjct: 370 DG 371


>gi|158425948|ref|YP_001527240.1| permease precursor [Azorhizobium caulinodans ORS 571]
 gi|158332837|dbj|BAF90322.1| permease precursor [Azorhizobium caulinodans ORS 571]
          Length = 363

 Score =  129 bits (323), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 93/372 (25%), Positives = 166/372 (44%), Gaps = 35/372 (9%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YF + +  +        + L+ ++D  E+  +  +    S    A+L   R P   +Q++
Sbjct: 9   YFARRFFASVTMIFFSCVGLIMLVDFLEMARRTADRDTVSAVTVALLTIYRTPAFTEQLL 68

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           PF  L   +  F  L+R  ELV++RA+G+S+WQ  +P ++ + L+G+F   V NP++   
Sbjct: 69  PFAVLFGGMATFVTLSRKLELVVARAVGLSVWQFTSPALLVAFLIGVFATCVFNPVSAD- 127

Query: 128 EKIGIDLIQQWKDNGDKQKSDIIP-------------WMQISNPQQDIFIGAKKILPENH 174
                     +K+  ++ +++I               W++  +      I A        
Sbjct: 128 ----------FKERANRMEAEIFNTASGVFTQGTSGFWIRQQSVDGQAIIQAAASQQGGR 177

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST--TLNIPI 232
                T    D+  K+  R +A  AI+ +    +K+        +P     T  T  +  
Sbjct: 178 QLTGVTVFEFDRNGKLTDRVEAKSAILGDGYWTMKEARVL----VPGSDQQTFETYLLAT 233

Query: 233 KMDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
           K+D  ++  E   S    SF+++   +S + +S  F   R   Q   L+  P +LVAM L
Sbjct: 234 KLDP-KQIQESLVSPETVSFWQLPDAISNAEQSG-FGAARYRLQLQSLLARPFLLVAMVL 291

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           IAA V L   R       +  G+ +GF+LY    + +  G +G++ P+AAA  P +  I 
Sbjct: 292 IAAVVGLRVFRFGGVGQTILGGVLAGFLLYLGTKLAEDLGDAGVVHPIAAAWFPALAGIF 351

Query: 350 LSILILLQKEDG 361
           + +LILL +EDG
Sbjct: 352 MGVLILLHREDG 363


>gi|115525295|ref|YP_782206.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisA53]
 gi|115519242|gb|ABJ07226.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris
           BisA53]
          Length = 361

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 89/360 (24%), Positives = 173/360 (48%), Gaps = 7/360 (1%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMG--ELPNYSISRGAVLAATRVPLI 62
           L RYF   ++   +   LG  +L+  +D  ++  + G   +P   I++ ++    RVP +
Sbjct: 6   LGRYFAGKFVTAAVGVFLGLFVLLVFVDYIDLLRRSGGRAIPALLIAQTSMF---RVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R  ELV++RA G+S WQ + P +  ++LLG F  +V NP
Sbjct: 63  LERLMPFCILIGAMTCYLALSRRLELVVARAAGVSAWQFMAPALWSALLLGTFATMVFNP 122

Query: 123 IATS-GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++ +  E+   +    + D+    +     W+   N +    I A     +  +    T 
Sbjct: 123 VSANLQERAKQNEASMFGDSSGSLQDASGFWINQVNSEGQAIINASHSQQQGVLLTGLTV 182

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
                      R +A  A +     +LK V  Y     P+++++  L   +     +   
Sbjct: 183 FRFATDFSFKDRLEAREATLEPGFWRLKSVRRYSLDAPPVEEDTLLLPTTLTQAQVRNSF 242

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               + SF+++   +  S++S+ F       Q++ L+  P +L AM ++AASVSL F R 
Sbjct: 243 STPETVSFWQLPSYIR-SSESSGFATAGYRLQYHKLLARPFLLAAMVMLAASVSLRFFRF 301

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      + LL +EDG
Sbjct: 302 GGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVFVGGLAGFMALLYQEDG 361


>gi|312113657|ref|YP_004011253.1| permease YjgP/YjgQ family protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218786|gb|ADP70154.1| permease YjgP/YjgQ family protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 363

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 94/376 (25%), Positives = 168/376 (44%), Gaps = 42/376 (11%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K +  T L      ++L+F +D  E+    G   + S    A++   R+P+  +  
Sbjct: 9   RYMAKRFAITILGVFFVTLLLIFFVDFVEVLRS-GARKDVSAGTLALITLLRIPIFAELT 67

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +PF  L+  I  F +L+RTSEL I RA G+S+WQ + P ++ +I  G+F V V NP+A++
Sbjct: 68  LPFAILIGTIAAFLSLSRTSELTIMRAAGLSVWQFVQPALIVAIFFGVFAVTVYNPVASA 127

Query: 127 ----GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
                EKI  ++ Q  K     + +    W++  +      + AK            T +
Sbjct: 128 MKAKSEKIQAEIFQSEKSFATSRGTG--SWLRQESVDGPTILHAKTSADRGLTLAGVTLL 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
             D  N+   +  A+ A +     +L+ V+    G                 D  +++ E
Sbjct: 186 QFDPANRFYEQIQANKAELRQGYWRLEGVIVQSSG-----------------DAVRRYDE 228

Query: 243 QFASR-----------------SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
            F S                  SF+++   ++F+ K+ +    + E Q    +  P+++ 
Sbjct: 229 YFVSTYLGPAQIMNSLGSLETLSFWDLPGFIAFAGKAGL-PTRQYELQHQLFLARPILMA 287

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
           AM LIAA+ SL+  R  + + +V  G+  GF  +    + +  G SG++    AA  P +
Sbjct: 288 AMVLIAATCSLKAFRFGKIQTMVLTGLTGGFGFFIFSELSRKVGASGLVPVTVAAWGPAL 347

Query: 346 LTISLSILILLQKEDG 361
           + + LS  +LL +EDG
Sbjct: 348 VALLLSATVLLYQEDG 363


>gi|114328862|ref|YP_746019.1| hypothetical protein GbCGDNIH1_2198 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317036|gb|ABI63096.1| hypothetical membrane spanning protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 370

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 98/353 (27%), Positives = 166/353 (47%), Gaps = 39/353 (11%)

Query: 32  DLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVIS 91
           D  E+  +    P+ S    + +AA R+P +   I+PF  L+  I  F+ L R+SELV++
Sbjct: 34  DFIELLRRAATKPDVSFGLVSTIAALRLPWMSITILPFAVLLGGIGAFWRLTRSSELVVA 93

Query: 92  RAIGISIWQLLNPFVVGSILLGIFTVLVINPIA----------------TSGEKIGIDLI 135
           RA GIS WQ L   V  + LLG+  + VI+P++                TSG  + +   
Sbjct: 94  RAAGISAWQFLALPVGAAALLGMLAMTVISPLSSVMLSRAEQLDNTYLRTSGGPMRLAGG 153

Query: 136 QQW---KDNG-DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKII 191
           Q W    D G D     II  MQ++          K  L  + I    T   +D +++++
Sbjct: 154 QLWLRQSDPGLDPHGVSIIHAMQVA--------AHKNSLQASSI----TVFRLDSEDRLV 201

Query: 192 HRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASR---S 248
            R +A  A + + +  L      +   +P   +  T+ IP  +   ++  E FAS    S
Sbjct: 202 QRIEAATARLVSGQWVLDNARVLRPSHLPDPPH--TVEIPTDLT-VRRIQESFASPDTLS 258

Query: 249 FYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIV 308
           F+ +   +   ++S  F + R   +F  L+ +PL+   M L+AA  S+  SR      ++
Sbjct: 259 FWSLPDFIRLLDRSG-FSSLRHRLRFQSLLALPLLCATMALVAAGFSMRPSRRGGVAKMI 317

Query: 309 AYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
             G+ +GF L+ +  + + FG+SG +  V AA  P +  + L++ +LL  EDG
Sbjct: 318 GSGVAAGFCLFVVSKVAEEFGQSGTVPVVLAAWAPSVAGLMLAVALLLHLEDG 370


>gi|27379217|ref|NP_770746.1| permease [Bradyrhizobium japonicum USDA 110]
 gi|27352368|dbj|BAC49371.1| bll4106 [Bradyrhizobium japonicum USDA 110]
          Length = 363

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 177/365 (48%), Gaps = 15/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   ++   L       +L+ ++D  E+  +   L + S    A  +  RVP +++
Sbjct: 6   LGRYFAGRFVVAALGVFASIFLLLVLVDYIEMVRKTSGLASASAIMVAETSLFRVPQLLE 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           ++ PF  L+  +  +  L+R  ELV++RA G+S WQ ++P +  ++L+G+   +  NP++
Sbjct: 66  KLTPFCMLIGAMTCYLALSRRLELVVARAAGVSAWQFISPALGSALLIGVIATVAYNPMS 125

Query: 125 TS----GEKIGIDLIQQWKDNGDKQKSDIIPWM-QISNPQQDIFIGAKKILPENHIWEDF 179
            +     +++  +L       G +  S    W+ Q++N  Q I I A +   +       
Sbjct: 126 ANLRELSKRMEAELFGSAPGGGIQDASGF--WLNQVTNDGQTI-INAARSEQQGVRLTGL 182

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ- 238
           T    D +     R +A  A +   +   + V  +     PI++    L IP  +   Q 
Sbjct: 183 TLFRFDTEQHFKERVEAREAELEVGQWIFRNVRRFSLDGPPIEQ--AVLAIPTTLTEAQV 240

Query: 239 --KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
              FS    + SF+++   +  S++S+ F       Q++ L+  P +L AM ++AASVSL
Sbjct: 241 RNSFSTP-ETVSFWQLPSYIR-SSESSGFATAGYRLQYHKLLAQPFLLAAMVMLAASVSL 298

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
            F R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV++      L LL
Sbjct: 299 RFFRMGGVQKMVLSGVGAGFLLYVLSKVTEDLSKAELMHPIAAAWLPVVVGGLTGFLALL 358

Query: 357 QKEDG 361
            +EDG
Sbjct: 359 YQEDG 363


>gi|217978371|ref|YP_002362518.1| permease YjgP/YjgQ family protein [Methylocella silvestris BL2]
 gi|217503747|gb|ACK51156.1| permease YjgP/YjgQ family protein [Methylocella silvestris BL2]
          Length = 361

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 177/363 (48%), Gaps = 13/363 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   +L   L   +    +VFV+D  E+  +  +LP+ S    A+LA  R P   +
Sbjct: 6   LGRYFSARFLTLILAVFVTICGMVFVVDFVEMLRRTTDLPDASPRSVALLAMLRAPSASE 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q++PF  L  ++  F +L R  EL+I+RA+G+S+W  L P +  +I++GI +V++ NP++
Sbjct: 66  QLMPFCVLCGSMAAFLDLTRKLELLIARAVGVSVWGFLVPPIAIAIVIGIGSVMLFNPVS 125

Query: 125 TS----GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
            +     +KI +++  +      +Q +D   W++  +   D  I A+ +  +       T
Sbjct: 126 AAMKQRADKIEVEIFGRLT----QQNADADIWIRQKSVDGDAIIKARTMSRDGSRLTKPT 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL--NIPIKMDGFQ 238
               D  +K     +A+ A + +   + ++      G   I+ +   L  N+        
Sbjct: 182 VYIYDDHDKFEAEVEAEHAQLSDGVWRFEQARILMPGEETIETSVYLLASNLTPAQVARG 241

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
             S Q  S +F+++      ++++ +  +   + QF  L+  PL+ VAM LIAA+ SL F
Sbjct: 242 PISPQ--SVAFWDLDAARRQTDRAGL-DSTAYKLQFQSLLARPLLFVAMVLIAAAFSLRF 298

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R      +V  G+ +GF+LY    ++   G +G++    AA  P ++   L  L LL +
Sbjct: 299 FRFGGIEKMVGGGVAAGFVLYVATKLVGDLGGAGLVSAPVAAWSPAVIASMLGALALLNQ 358

Query: 359 EDG 361
           EDG
Sbjct: 359 EDG 361


>gi|170743204|ref|YP_001771859.1| permease YjgP/YjgQ family protein [Methylobacterium sp. 4-46]
 gi|168197478|gb|ACA19425.1| permease YjgP/YjgQ family protein [Methylobacterium sp. 4-46]
          Length = 362

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 162/360 (45%), Gaps = 7/360 (1%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RY    +L+      L    LV+ +D  E+  + GE P  S    A L+  R P + +
Sbjct: 7   LGRYIAARFLRMIAGVFLTVFALVYTLDFVELMRRAGEAPGASALTVAHLSLLRTPAVAE 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           QI+PF  L   +     L+R  ELV++RA GIS WQ L P V+ ++ +G   V   NP+A
Sbjct: 67  QIMPFAILFGAMGALLQLSRKLELVVARAAGISAWQFLQPGVLVAVGIGALMVGAYNPLA 126

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            S ++    +  +      K       W++  +      + A   +         T  T 
Sbjct: 127 ASLKQRSTQVEARIFARSTKGGLSNDLWIRQRSVDGQAIVRASTAIEGTTSLAGVTIFTF 186

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLK--KVVEYQYGRIPIDKNSTTLNI-PIKMDGFQKFS 241
           D +     + +A  A +++   +L+  +V+    G    D      N+ P ++   Q+ +
Sbjct: 187 DAQGAFGQQIEARRATLHDGYWELQDARVLTQDSGPESYDTYLVASNLAPSQVR--QRVT 244

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S  F+++ + ++ S ++ +    R   Q   L+  P++ VAM L+AASVSL F R 
Sbjct: 245 PP-DSVPFWQLSETIARSERAGL-DAARYRLQRAVLLARPMLFVAMVLVAASVSLRFFRF 302

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
                +   G+ +GF LY    +M+  G SGI+    AA  P ++   L  L LL +EDG
Sbjct: 303 GGIGRMALAGVAAGFALYVARQVMEGLGASGIVAAPVAAWFPAVVGSLLGTLALLYQEDG 362


>gi|323137698|ref|ZP_08072774.1| permease YjgP/YjgQ family protein [Methylocystis sp. ATCC 49242]
 gi|322396995|gb|EFX99520.1| permease YjgP/YjgQ family protein [Methylocystis sp. ATCC 49242]
          Length = 361

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 92/357 (25%), Positives = 164/357 (45%), Gaps = 5/357 (1%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYF   +++T L        L+FV+   E+  +  + P       A++ A +VP   + I
Sbjct: 8   RYFAWRFMRTILAIFFTIFCLMFVVVFVEMLRRASDNPQAGAGMVALMTAMKVPAAAEMI 67

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +PF  L  ++  F +L R  EL+++RA G+S+WQ + P V+ ++L+G+F+V V NP++ S
Sbjct: 68  LPFAVLFGSMATFVDLTRKLELIVARAAGMSVWQFITPPVLTALLIGVFSVAVYNPLSAS 127

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            ++    +  +        + D   W++         + A     +      F S+ I  
Sbjct: 128 MKQRSDQMELELFGVPGSLRIDHGVWLRQHGVDGLAVMHAMGT-AKGGTELTFVSVNIYS 186

Query: 187 KN-KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFA 245
            N   + R +A  A +      L   +    G       S  L   +  +     +    
Sbjct: 187 PNGGFLERVEAQSARLEPGVWVLNGAIVSAPGEPARPVASYMLATDLTPEQAAAATTPPQ 246

Query: 246 SRSFYEIIKKMSFSNKSNI-FHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
              F+E+ +  + + ++ +    YR   QF  L+  PL+LVAM L+AAS SL F R    
Sbjct: 247 GTPFWELPEMTARTTEAGLDSTGYR--LQFQTLLARPLLLVAMVLVAASFSLRFFRFGGV 304

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              ++ G+ +GF+LY +  ++   G +G++ P+ AA  P ++   L  L LL  EDG
Sbjct: 305 AKTLSGGVAAGFVLYIVTKVLSDLGGAGLISPLVAAWSPALVGSMLGTLTLLYSEDG 361


>gi|298291095|ref|YP_003693034.1| permease YjgP/YjgQ family protein [Starkeya novella DSM 506]
 gi|296927606|gb|ADH88415.1| permease YjgP/YjgQ family protein [Starkeya novella DSM 506]
          Length = 361

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 97/367 (26%), Positives = 167/367 (45%), Gaps = 27/367 (7%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YF + +L   L   +G   L+ +IDL E+  ++GE  +       +L   R+P   +Q++
Sbjct: 9   YFGRRFLGAVLGIFVGCAGLIMLIDLLELSRRVGE-RDVDFGTLMLLVVYRMPFFTEQLL 67

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           PF  L   I  F  L+R  ELV++RA GIS WQ + P  + ++LLG+F+  V NP++   
Sbjct: 68  PFAVLFGAIGTFLTLSRRLELVVARAAGISAWQFIAPACLLALLLGVFSTTVYNPVSAD- 126

Query: 128 EKIGIDLIQQWKDNGDKQKSDIIP-------------WMQISNPQQDIFIGAKKILPENH 174
                     +KD   + +++I               WM+  +      I A        
Sbjct: 127 ----------FKDRASRLEAEIFNRQTGLFAMTTGGFWMRQQSVDGQAIIQAAATSDGGR 176

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
                        +K+  R +A  AI+     +L+       G    + ++  L   +  
Sbjct: 177 QLTGVNVFLFGADDKLTERIEAVRAILEPGAWRLEHARVLTPGIGLQEYDAYMLATNLTP 236

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
           +  Q+ + Q  +  F+++   +  + +   F   R   Q+  L+  P++L+AM LIAASV
Sbjct: 237 NQVQE-TLQSDTVPFWQLPAAIDAATRVG-FGAERYRLQYQSLLARPMLLLAMVLIAASV 294

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           SL   R       +  G+ +GF+LY    + +  G++GI+ PV AA  P ++   + ILI
Sbjct: 295 SLRVFRFGGIGQTILGGVAAGFLLYVSTKLAEDLGEAGIVHPVIAAWFPAVVGALMGILI 354

Query: 355 LLQKEDG 361
           LL +EDG
Sbjct: 355 LLHREDG 361


>gi|329114151|ref|ZP_08242913.1| Lipopolysaccharide export system permease protein LptG [Acetobacter
           pomorum DM001]
 gi|326696227|gb|EGE47906.1| Lipopolysaccharide export system permease protein LptG [Acetobacter
           pomorum DM001]
          Length = 370

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 91/380 (23%), Positives = 178/380 (46%), Gaps = 39/380 (10%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RY  + ++ + +  +     +V + D  ++  ++   P+ S +    +AA  VP    
Sbjct: 7   LSRYIARQFVFSVVAMIASLTGIVCLFDFIDLLRRVATKPDVSTNVVTEIAALHVPYFAT 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +I+PF  L+  IV F+ L R+SEL+++RA GIS WQ L   V  ++L+G     +I+P++
Sbjct: 67  EILPFGMLLGGIVCFWRLTRSSELIVARAAGISAWQFLTAPVACAMLIGALFTTLISPVS 126

Query: 125 TSGEKIGIDLIQQWKDN-----------GDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
           +S  +   +L QQ+                 ++SD        +P     + A+ +  ++
Sbjct: 127 SSMYRRAEELDQQYLRTGGGPLSLSSGSLWLRQSD-----SQYDPHGVAMLHARGVQLKD 181

Query: 174 HIW--EDFTSITIDKKNKIIHRKDADLA-------IIYNDKVKLKKVVEYQYGRIPIDKN 224
            +    + +   +D ++K++ R +A          I+ +  V     + +  G+I +  +
Sbjct: 182 GLLRIRNVSVFRLDHQDKLMMRIEAPEGYLGTLKWILSDASVVRPNDLLHHVGQIDLPTD 241

Query: 225 STTLNIPIKMDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIP 281
            T            +  E F+S    S + +   +S  ++S  F + R    F  L+ +P
Sbjct: 242 LTV----------NRVQESFSSPETLSVWALPGFISLLDRSG-FSSIRHRIHFQSLLALP 290

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           ++   M L+AA  S+  SR      ++  G+ +GF+L+T+  + + FG SG L P+ AA 
Sbjct: 291 MLAGTMALVAAGFSMRPSRRGGVARMIGSGVAAGFLLFTVSKVAEQFGNSGALPPMLAAW 350

Query: 342 IPVILTISLSILILLQKEDG 361
            P +  + L++ +LL  EDG
Sbjct: 351 APTLAGLCLAVSLLLHLEDG 370


>gi|258542096|ref|YP_003187529.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-01]
 gi|256633174|dbj|BAH99149.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-01]
 gi|256636231|dbj|BAI02200.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-03]
 gi|256639286|dbj|BAI05248.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-07]
 gi|256642340|dbj|BAI08295.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-22]
 gi|256645395|dbj|BAI11343.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-26]
 gi|256648450|dbj|BAI14391.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-32]
 gi|256651503|dbj|BAI17437.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654494|dbj|BAI20421.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-12]
          Length = 370

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 91/380 (23%), Positives = 178/380 (46%), Gaps = 39/380 (10%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RY  + ++ + +  +     +V + D  ++  ++   P+ S +    +AA  VP    
Sbjct: 7   LSRYIARQFVFSVVAMIASLTGIVCLFDFIDLLRRVATKPDVSTNVVTEIAALHVPYFAT 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +I+PF  L+  IV F+ L R+SEL+++RA GIS WQ L   V  ++L+G     +I+P++
Sbjct: 67  EILPFGMLLGGIVCFWRLTRSSELIVARAAGISAWQFLTAPVACAMLIGAVFTTLISPVS 126

Query: 125 TSGEKIGIDLIQQWKDN-----------GDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
           +S  +   +L QQ+                 ++SD        +P     + A+ +  ++
Sbjct: 127 SSMYRRAEELDQQYLRTGGGPLSLSSGSLWLRQSD-----SQYDPHGVAMLHARGVQLKD 181

Query: 174 HIW--EDFTSITIDKKNKIIHRKDADLA-------IIYNDKVKLKKVVEYQYGRIPIDKN 224
            +    + +   +D ++K++ R +A          I+ +  V     + +  G+I +  +
Sbjct: 182 GLLRIRNVSVFRLDHQDKLMMRIEAPEGYLGTLKWILSDASVVRPNDLLHHVGQIDLPTD 241

Query: 225 STTLNIPIKMDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIP 281
            T            +  E F+S    S + +   +S  ++S  F + R    F  L+ +P
Sbjct: 242 LTV----------NRVQESFSSPETLSVWALPGFISLLDRSG-FSSIRHRIHFQSLLALP 290

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           ++   M L+AA  S+  SR      ++  G+ +GF+L+T+  + + FG SG L P+ AA 
Sbjct: 291 MLAGTMALVAAGFSMRPSRRGGVARMIGSGVAAGFLLFTVSKVAEQFGNSGALPPMLAAW 350

Query: 342 IPVILTISLSILILLQKEDG 361
            P +  + L++ +LL  EDG
Sbjct: 351 APTLAGLCLAVSLLLHLEDG 370


>gi|154246776|ref|YP_001417734.1| permease YjgP/YjgQ family protein [Xanthobacter autotrophicus Py2]
 gi|154160861|gb|ABS68077.1| permease YjgP/YjgQ family protein [Xanthobacter autotrophicus Py2]
          Length = 364

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 100/381 (26%), Positives = 166/381 (43%), Gaps = 44/381 (11%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + +    +   L  + L+ ++D  E+  +  +    ++   A++   R P   
Sbjct: 5   ILGFYFARRFASAVVLIFLSCVTLIVLVDFLEMARRTADREQVTVGLLALVTLYRAPSFT 64

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +Q++PF  L   I  F  L+R  ELV++RA+G+S+WQ + P V+ + L+G+F+  V NP+
Sbjct: 65  EQLMPFAVLFGAISTFVLLSRRLELVVARAVGLSVWQFITPPVLVAFLIGVFSTTVFNPV 124

Query: 124 AT---------SGEKIGIDLIQQWKDNGDKQKSDIIP------WMQISNPQQDIFIGAKK 168
           +           GE  G               S ++P      W++  +      I A+ 
Sbjct: 125 SADFKERANQIEGEIFG------------SSSSGLLPQGKKEFWVRQQSVDGQSIIQAQA 172

Query: 169 ILPENHIWEDFTSITIDKKNKIIHRKDA------DLAIIYNDKVKLKKVVEYQYGRIPID 222
                           DK ++++ R +A      D A I  D   L   +++Q+      
Sbjct: 173 TRQGGRALSGVVVFEFDKADRLVERVEARSATLGDGAWILTDARVLVPGLDHQH------ 226

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASR--SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVI 280
               T  I   +D  Q      A    SF+++   +  + +S  F   R   Q   L+  
Sbjct: 227 --YDTYLIATNLDPKQIQESLIAPETVSFWQLPAAIRSAEQSG-FGAERYRLQLQSLLAR 283

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           P +LVAM LIAA V L   R       +  G+ +GF+LY    + +  G +G + PVAAA
Sbjct: 284 PFLLVAMVLIAAVVGLRVFRFGGVGQTILGGVLAGFLLYVGTKLAEDLGDAGFVHPVAAA 343

Query: 341 LIPVILTISLSILILLQKEDG 361
             P +  I L +LILL +EDG
Sbjct: 344 WFPAVAGILLGVLILLHREDG 364


>gi|163853055|ref|YP_001641098.1| permease YjgP/YjgQ family protein [Methylobacterium extorquens PA1]
 gi|218531865|ref|YP_002422681.1| permease YjgP/YjgQ family protein [Methylobacterium
           chloromethanicum CM4]
 gi|240140388|ref|YP_002964867.1| putative permease [Methylobacterium extorquens AM1]
 gi|254562992|ref|YP_003070087.1| permease [Methylobacterium extorquens DM4]
 gi|163664660|gb|ABY32027.1| permease YjgP/YjgQ family protein [Methylobacterium extorquens PA1]
 gi|218524168|gb|ACK84753.1| permease YjgP/YjgQ family protein [Methylobacterium
           chloromethanicum CM4]
 gi|240010364|gb|ACS41590.1| putative permease [Methylobacterium extorquens AM1]
 gi|254270270|emb|CAX26266.1| putative permease [Methylobacterium extorquens DM4]
          Length = 362

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 168/361 (46%), Gaps = 9/361 (2%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   +++T L   L    LV+ +D  E+  + G+    S    A LA  R P + +
Sbjct: 7   LGRYFAWRFVRTILGVFLTVFALVYTLDFVELLRRAGDAEGASPGLMAQLALYRTPAVAE 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
            ++PF  L  ++     L+R  ELV++RA GIS WQ L P    ++ +G   +   NP++
Sbjct: 67  SVLPFAVLFGSMAALLQLSRKLELVVARAAGISAWQFLQPGAFVALAIGALAIGAYNPLS 126

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            + ++   ++  +      K  +    W++  +      I A+  +         T    
Sbjct: 127 AALKQRSSEIEAKIFAKSTKAGTGKDLWLRQRSIDGQAIIRAETAVEGTTTLAGVTVFQF 186

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN----STTLNIPIKMDGFQKF 240
           D+      + +A  A +++   +L+ V        P        ++TL+ P ++   Q+F
Sbjct: 187 DEAGAFAAQLEAARATLHDGWWELRDVRVLTRDEPPESHEVYLVASTLD-PSQIR--QRF 243

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
           +    S  F+++ + ++   ++ +    R   Q+  L+  PL+ +AM L+AA+VSL F R
Sbjct: 244 TPP-ESVPFWQLPETIARHERAGL-DATRYRLQYDVLLATPLLYLAMVLVAATVSLRFFR 301

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
                 +V  G+ +GF+LY    +M+  G SG++ P  AA  P ++   L  L LL +ED
Sbjct: 302 FGGVGKLVLGGVSAGFVLYVARQVMEGLGASGMVAPTVAAWFPAVVGSLLGTLTLLYQED 361

Query: 361 G 361
           G
Sbjct: 362 G 362


>gi|114797396|ref|YP_760970.1| YjgP/YjgQ permease [Hyphomonas neptunium ATCC 15444]
 gi|114737570|gb|ABI75695.1| putative permease, YjgP/YjgQ family [Hyphomonas neptunium ATCC
           15444]
          Length = 373

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 92/373 (24%), Positives = 164/373 (43%), Gaps = 26/373 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  +  L   +  L   ++ + +ID+ E    +G     ++     L+  ++P+II+Q 
Sbjct: 9   RYILRECLSGLVLVLGILLLAILMIDVVEQMRTIGGDVEITLLDALRLSLMKLPMIIEQT 68

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT- 125
           +PF  L   ++ F  LNR SEL I RA G+S W+ L P +V  + LGIF+ L +NP+A  
Sbjct: 69  LPFALLAATMMAFTRLNRRSELSIIRASGLSAWRFLTPVIVLGVALGIFSSLALNPLAAR 128

Query: 126 -----SGEK-----IGIDLIQ-----QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKIL 170
                  E+     +G +++Q      W   GD     +I   ++ +  + +     KI+
Sbjct: 129 LSQSFEAERARLLDVGREVVQVAETGVWLRQGDDSSQYVIHARRVEDGGRTLL--DVKII 186

Query: 171 PENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNI 230
            E  ++              + R DA+ A++     +L+ +VE    + P  +   TL I
Sbjct: 187 EEQRLYNGRQPT---NDFAFVRRIDAEKAVLNEGFWQLENLVENLPNQAP--ERRATLAI 241

Query: 231 PIKMDGFQKFSEQFASRS--FYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMT 288
           P  +D  +   E  +  +  F+E + +  F  ++      R   + + L   P++  AM 
Sbjct: 242 PTSLDAVRLLDEYASPNTVGFWE-LPRFIFETRAAGLDTSRYTMRLFTLTATPVLFTAMA 300

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTI 348
           LI A   L   R      ++A G+ +   LY       S G +G    V AA  P +  +
Sbjct: 301 LIGALACLRLQRLGGTSRLLATGVLAAIGLYFFTQFSSSLGSTGAAPAVVAAWSPPLFVL 360

Query: 349 SLSILILLQKEDG 361
            +S+  +  +EDG
Sbjct: 361 FVSLAFIAYREDG 373


>gi|220925666|ref|YP_002500968.1| permease YjgP/YjgQ family protein [Methylobacterium nodulans ORS
           2060]
 gi|219950273|gb|ACL60665.1| permease YjgP/YjgQ family protein [Methylobacterium nodulans ORS
           2060]
          Length = 362

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/360 (25%), Positives = 159/360 (44%), Gaps = 7/360 (1%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RY     L+      L    LV+ +D  E+  + GE         A L+  R P I +
Sbjct: 7   LGRYIAGRLLRMIAGVFLTVFALVYTLDFVELMRRAGETQGIGALTVARLSLLRTPSIAE 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           QI+PF  L   +     L+R  ELV++RA GIS WQ L P V  ++ +G   V   NP+A
Sbjct: 67  QIMPFAILFGAMGALLQLSRKLELVVARAAGISAWQFLQPGVFVALAVGALMVGAYNPMA 126

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            + ++   ++  +     ++  S    W++  +      + A+  +         +    
Sbjct: 127 AALKQHSTEIEARIFSRSNRGGSGKDLWIRQRSVDGQAIVRAETAIEGTTTLAGVSVFAF 186

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLN---IPIKMDGFQKFS 241
           D +     + +A  A +++   +L+          P   ++  +    +P ++   Q+F+
Sbjct: 187 DDQGTFTQQIEARQATLHDGYWELQDARVLAKDSQPESYDTYLVASNLVPSQVR--QRFT 244

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S  F+++   ++ S ++ +    R   Q   L+  P++ VAM L+AASVSL F R 
Sbjct: 245 PP-DSVPFWQLGDTIARSERAGL-DATRYRLQRAVLLARPMLFVAMVLVAASVSLRFFRF 302

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
                +   G+ +GF LY    +M+  G SGI+    AA  P ++   L  L LL +EDG
Sbjct: 303 GGIGRMALAGVAAGFALYVARQVMEGLGASGIVAAPVAAWFPAVVGSLLGTLALLYQEDG 362


>gi|330993928|ref|ZP_08317858.1| Lipopolysaccharide export system permease protein lptG
           [Gluconacetobacter sp. SXCC-1]
 gi|329758874|gb|EGG75388.1| Lipopolysaccharide export system permease protein lptG
           [Gluconacetobacter sp. SXCC-1]
          Length = 371

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 174/373 (46%), Gaps = 30/373 (8%)

Query: 8   YFFKYYLKTTLY---FLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           Y  + +   TL    FL G   L+ + D  ++  ++   PN   S  + +A   +P    
Sbjct: 10  YIARQFTGATLAVIAFLTG---LITMFDFIDLLRRVSTRPNVPTSLVSQIAFLHIPFACL 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +I+PF  L+  I+ F+ L R+SELV++RA GIS WQ L   V+ ++L+G      ++P++
Sbjct: 67  EILPFGVLLGGILCFWRLARSSELVVARAAGISAWQFLAGPVICAVLIGAMATTCVSPLS 126

Query: 125 TSGEKIGIDLIQQW-KDNGDKQ--KSDIIPWMQ-----ISNPQQDIFIGAKKILPENHIW 176
           +   +    L +Q+ +DN  K    S    W++     + +   DI I A+++     + 
Sbjct: 127 SVMYRRAEALDRQYLRDNNGKSLNLSGGTLWLRQGDNGLVDHGVDI-IHARQVRLNGGVL 185

Query: 177 E--DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
                T   +   + ++ R +A    +   +  L+     +   +P D    TL+  + +
Sbjct: 186 HIGGITIFRLGPDDGLLTRIEAQSGYLGGGRWILEGARMLRPDEMPSDMGRFTLHADLTL 245

Query: 235 DGFQKFSEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMT 288
            G +   E FAS     +      I++++ S  S I H       F  L+ +P++   M 
Sbjct: 246 AGVE---ESFASPDTLSVWALPGFIRQLNRSGFSTIRHRL----HFQSLLTLPVLSGTMA 298

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTI 348
           L+AA  S+  +R      +++ G+ +GF L+ +  I   FG++G L PV AA  P    +
Sbjct: 299 LVAAGFSMRPARRGGVIRMISSGVAAGFALFALSKIAAQFGETGTLPPVLAAWAPTGAGL 358

Query: 349 SLSILILLQKEDG 361
            L++ +LL  EDG
Sbjct: 359 CLAVTLLLHLEDG 371


>gi|182677644|ref|YP_001831790.1| permease YjgP/YjgQ family protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633527|gb|ACB94301.1| permease YjgP/YjgQ family protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 362

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 160/364 (43%), Gaps = 26/364 (7%)

Query: 13  YLKTTLYFLLGAMI-----LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YL +   F++ A+      +++VIDL E+  + G  P  + S  A L+  R P + +QI+
Sbjct: 10  YLSSRFLFMILAVFGTIFSMIYVIDLVEMLRRAGNRPGATASLIAFLSFLRAPSVSEQIL 69

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT-- 125
           PF  L   +  F NL R  EL+++RA GISIWQL+ P +  ++ +GIF+V + NPI+   
Sbjct: 70  PFCVLFGTMATFINLTRRLELLVARAAGISIWQLMMPPLGIALAIGIFSVTLYNPISAMM 129

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
                GI+        G + K  +  W++ ++      I A+ +          T  T  
Sbjct: 130 KHRADGIETELFGGIGGQETKGGL--WIRQNSVDGQAIIRAETVEAGGSRLGGVTLYTYG 187

Query: 186 KKNKIIHRKDADLAIIYNDKVKLKKV------VEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           K      R +A  A +     ++ +        E Q   + +   + T           +
Sbjct: 188 KDGSFEARIEARHAKLVPGVWQMTEARIIVPGEEIQEAGLYLLATNLTPG---------E 238

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNI--FHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            SE   +       +  SF   + +    + R   QF  L+  PL  +AM LIAA+ SL 
Sbjct: 239 VSENIVTPESVPFWELQSFRAATELAGLDSTRYRLQFQLLLARPLFFIAMVLIAAAFSLR 298

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F R      +V  G  +GF+LY +       G SG+L    AA  P ++   L  L LL 
Sbjct: 299 FFRFGGITKMVCGGAGAGFVLYIVSKFTGDLGTSGLLSAPIAAWSPAVVASMLGALALLN 358

Query: 358 KEDG 361
           +EDG
Sbjct: 359 QEDG 362


>gi|188583149|ref|YP_001926594.1| permease YjgP/YjgQ family protein [Methylobacterium populi BJ001]
 gi|179346647|gb|ACB82059.1| permease YjgP/YjgQ family protein [Methylobacterium populi BJ001]
          Length = 362

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 167/361 (46%), Gaps = 9/361 (2%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   +++T L   L    LV+ +D  E+  + G+    S    A LA  R P + +
Sbjct: 7   LGRYFAWRFVRTILGVFLTVFALVYTLDFVELLRRAGDSEGASTGLMAQLALYRTPAVAE 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
            ++PF  L  ++     L+R  ELV++RA GIS WQ L P    ++ +G   +   NP++
Sbjct: 67  SVLPFAVLFGSMAALLQLSRKLELVVARAAGISAWQFLQPGAFVALAIGALAIGAYNPLS 126

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            + ++   ++  +      K  +    W++  +      I A+  +         T    
Sbjct: 127 AALKQRSSEIEAKIFAKSTKAGTGKDLWLRQRSVDGQAIIRAETAVEGTTTLAGVTVFQF 186

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN----STTLNIPIKMDGFQKF 240
           D       + +A  A +++   +L+ V        P        ++TL+ P ++   Q+F
Sbjct: 187 DDAGVFTAQIEAARATLHDGWWELRDVRVLTRDEPPESHEVYLVASTLD-PSQIR--QRF 243

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
           +    S  F+++ + ++   ++ +    R   Q+  L+  PL+ +AM L+AA+VSL F R
Sbjct: 244 TPP-ESVPFWQLPETIARHERAGL-DATRYRLQYDVLLATPLLYLAMVLVAATVSLRFFR 301

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
                 +V  G+ +GF+LY    +M+  G SG++ P  AA  P ++   L  L LL +ED
Sbjct: 302 FGGVGKLVLGGVSAGFVLYVARQVMEGLGASGMVAPTVAAWFPAVVGSLLGTLTLLYQED 361

Query: 361 G 361
           G
Sbjct: 362 G 362


>gi|163792837|ref|ZP_02186813.1| Predicted permease [alpha proteobacterium BAL199]
 gi|159181483|gb|EDP65995.1| Predicted permease [alpha proteobacterium BAL199]
          Length = 365

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/363 (27%), Positives = 173/363 (47%), Gaps = 20/363 (5%)

Query: 12  YYLKTTLYFLLGA----MILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  +  ++++LG     M +VF++DL E+  +              +AA ++P + QQI+
Sbjct: 10  YIGRQFVFWVLGTFAAIMAIVFLLDLIELLRRGSGKDGAHFGVLVEMAALKLPNMGQQIL 69

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA--- 124
           PF  L  +++ F  L RT+ELV++RA GIS+WQ L P +  ++LLG   V V+NPI+   
Sbjct: 70  PFAVLFGSMLAFTRLTRTNELVVARAAGISVWQFLMPAIAVALLLGALKVGVVNPISSVM 129

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
           T+   +  D I + + +          W++         + A      +    +   I  
Sbjct: 130 TARFNVLEDTILRNRVDSFMTVGQGGLWIRERTESGQHVVHALAARQNDAELANVLVIRF 189

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
              ++ + R DA  A +     +L   V       P  + S  + IP ++   Q   + F
Sbjct: 190 GHNDEFLERIDARTARLGAGYWELHDTVVTSVKGRPDQRGS--IRIPTRLT-IQNIQDSF 246

Query: 245 AS---RSFYEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           AS    SF+E+   I+ +  +  S + H       ++ L+  PL+L+AM LIAA+ SL  
Sbjct: 247 ASPETMSFWELPGFIRILENAGFSAVKHRL----YWHALLASPLLLIAMVLIAATFSLRL 302

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
           +R     +  + G+F+GF+LY +  I+ + G S  +  V AA  P  +T+ L +  LL  
Sbjct: 303 TRRGGTLLWASSGLFTGFLLYFMSDIVFALGLSARIPEVLAAWTPATVTMLLGLTSLLHL 362

Query: 359 EDG 361
           EDG
Sbjct: 363 EDG 365


>gi|170746989|ref|YP_001753249.1| permease YjgP/YjgQ family protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653511|gb|ACB22566.1| permease YjgP/YjgQ family protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 363

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 94/360 (26%), Positives = 165/360 (45%), Gaps = 7/360 (1%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RYF   +L+T L   +    LV+ +D  E+  + GE    S    A L+  R P + +
Sbjct: 8   LGRYFAARFLRTVLGVFVTVFALVYTLDFVELLRRAGEAQGASAGLMAQLSLYRTPAVAE 67

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
            ++PF  L  ++     L+R  ELV++RA GIS WQ L P +  ++ LG   V V NP++
Sbjct: 68  GVLPFAVLFGSMAALLQLSRKLELVVARAAGISAWQFLQPGLFVALALGALAVGVYNPVS 127

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
              ++   ++  +      K  S    W++      +  + A+  +         +  T 
Sbjct: 128 AMLKQRSTEIEAKIFAKSTKASSGKDLWIRQKGLDGEAILRAETAVEGTTTLAGVSVFTF 187

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF---QKFS 241
           D   K   +  A  A++++   +L  V        P  ++  T  I   +D     Q+F+
Sbjct: 188 DAAGKFAEQLVAARAMLHDGYWELSDVRVLTPDAPP--ESFDTYLIASNLDPGQVRQRFT 245

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S  F+++   ++ + ++ +    R   Q+  L   P++ VAM ++AA+VSL F R 
Sbjct: 246 PP-ESVPFWQLPTTIARTERAGL-DATRYRLQYDVLWARPVLFVAMVIVAATVSLRFFRF 303

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
                +V  G+ +GF LY +  +M+  G SG++    AA  P ++   L  L LL +EDG
Sbjct: 304 GGVGKLVLGGVAAGFALYVVRQVMEGLGASGLVAAPVAAWFPAVVGSLLGTLTLLYQEDG 363


>gi|162149096|ref|YP_001603557.1| hypothetical protein GDI_3326 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545161|ref|YP_002277390.1| permease YjgP/YjgQ family protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787673|emb|CAP57269.1| putative membrane protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532838|gb|ACI52775.1| permease YjgP/YjgQ family protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 369

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 87/368 (23%), Positives = 167/368 (45%), Gaps = 22/368 (5%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  + +    +  +L    LV + D  ++  ++   P+   S  + +A   VP  + +I+
Sbjct: 10  YIARQFTLAVMAMILSLTGLVSLFDFIDLLRRVATRPDVPTSLASEIALLHVPYFMIEIL 69

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           PF  L+  IV F+ L R+SEL+++RA GIS WQ L   +  ++L+GI     ++P+++  
Sbjct: 70  PFGVLLGGIVCFWRLTRSSELIVARAAGISAWQFLTGPLSCALLIGILATGALSPLSSIM 129

Query: 128 EKIGIDLIQQW-KDNGDKQKSDIIPWMQISN----PQQDIFIGAKKILPENHIWE--DFT 180
            +    L   + +  G    SD   W++ ++    P     + A+ +  +  +      +
Sbjct: 130 YRQAETLDHVYLRSGGPLNLSDGALWLRQADSGLVPHGVAILHARSVHLQGGVLRIGGIS 189

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNS----TTLNIPIKMDG 236
              +D  + +I R +A    +       +     +  R+P+        T L +P     
Sbjct: 190 LFRLDDTDHLIVRIEAPEGYLGRKVWIFQDARTIRPDRLPVPAGRFVMPTDLTVP----- 244

Query: 237 FQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
             +  E FAS    S + +   ++   +S  F + R    F  L+ +P++   M L+AA 
Sbjct: 245 --RVQESFASPDTLSVWALPGFIALLERSG-FSSIRHRLHFQTLLTLPILAGTMALVAAG 301

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
            S+  +R      ++  G+ +GF L+TI  +   FG+SG + P+ AA  P    + L++ 
Sbjct: 302 FSMRPTRRGGVARMIGSGVAAGFALFTISKVAAQFGESGAMPPLLAAWAPTGAGLCLAVS 361

Query: 354 ILLQKEDG 361
           +LL  EDG
Sbjct: 362 LLLHLEDG 369


>gi|296445732|ref|ZP_06887685.1| permease YjgP/YjgQ family protein [Methylosinus trichosporium OB3b]
 gi|296256712|gb|EFH03786.1| permease YjgP/YjgQ family protein [Methylosinus trichosporium OB3b]
          Length = 361

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 93/377 (24%), Positives = 165/377 (43%), Gaps = 41/377 (10%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RY    + KT L        L+FV+   E+  + G++P       A++   RVP   +
Sbjct: 6   LSRYLAARFAKTILAIFATMFCLMFVVYFVELLRRAGDIPQAGADTVALMTILRVPATAE 65

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
            I+PF  L   +  F +L R  ELV++RA G+S+WQ L P    ++++G+ +V + NP++
Sbjct: 66  TILPFAVLFGAMTTFVDLTRKLELVVARASGVSVWQFLFPPAFVALVIGVVSVTLYNPVS 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQ--------KSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
                    +++Q  D  + +        + D   W++++       + A          
Sbjct: 126 A--------VMKQRSDQMELELFGVQGSVRVDHSKWLRLTGVDGTAILHATDYQAGGARL 177

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI--PIDKNSTTLNIPIKM 234
            + +     K+   + R +A  A +      L  V   +  R+  P +++ T  +  +  
Sbjct: 178 TEVSVNVYSKEGLFLERVEAARARL------LAGVFVLEEARVNAPGEESRTVGSYLLAT 231

Query: 235 DGFQKFSEQFASR----------SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
           D      EQ  +           S  E+ +K + +      +      QF  L+  PL+L
Sbjct: 232 D---LTPEQLVTATTPPQGAPFWSLLELGEKTADAGLDPTGYIL----QFQTLLARPLLL 284

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
           VAM L+AAS SL F R       V+ G+ +GF+LY +  +    G +G++ P+ AA  P 
Sbjct: 285 VAMVLVAASFSLRFFRMGGIARTVSGGVVAGFVLYIVTKLFSDLGGAGVISPLVAAWSPA 344

Query: 345 ILTISLSILILLQKEDG 361
           ++   L  + LL  EDG
Sbjct: 345 LVGSMLGAVSLLYSEDG 361


>gi|83594405|ref|YP_428157.1| permease YjgP/YjgQ [Rhodospirillum rubrum ATCC 11170]
 gi|83577319|gb|ABC23870.1| permease YjgP/YjgQ [Rhodospirillum rubrum ATCC 11170]
          Length = 366

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 102/377 (27%), Positives = 183/377 (48%), Gaps = 33/377 (8%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMI----LVFVIDLNEIQNQMGELPNYSISRGAVL--AATR 58
           ++R    Y  +T L  L+GA +    L+ + D+ EI  + G   + +I    VL  A   
Sbjct: 3   IYRTLTTYIARTYLTALVGATLVVGALLMLFDVIEITRRSG---SKAIGIDVVLEMALYH 59

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P+ +Q  +PF+ +   +++F+ L R+SELV+ RA G+S+WQ L P +   ++LGI  V 
Sbjct: 60  LPMSLQSALPFVFMGGAVMIFWKLARSSELVVIRAAGLSVWQFLAPVIAVVVVLGIANVT 119

Query: 119 VINPIA----TSGEKIGIDLIQQWKDNGDKQK---SDIIPWMQISNPQQDIFIGAKKILP 171
           ++NP+A    T  E++   +     D+G       SD   W++ +NP+  + + A+ +  
Sbjct: 120 LLNPLAAHLYTKYERMDAGM-----DSGVANPLALSDGGLWLRENNPEGQVVMHAQGVRQ 174

Query: 172 ENHIWEDFTSITI---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL 228
            ++     T +TI       +   R DA+ A +    + L  VV    GR  + + + TL
Sbjct: 175 VDNALR-MTGVTIFRYGPDRRFESRIDAETAGLREGALVLTSVVTTYPGR--VGERAETL 231

Query: 229 NIPIKMDGFQKFSEQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
            +P  +    K  + F+   + SF+E+   ++F   +  F  +     ++ LI  PL+L+
Sbjct: 232 EVPSNLT-LPKIQDSFSPPETVSFWELPAFITFFEAAG-FSAHAHRLHWHSLIASPLLLI 289

Query: 286 AMTLIAASVSLEFS-RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
           AM L+ A  SL+ S RS      +   + +GF ++    I  + G S  L    AA  P 
Sbjct: 290 AMVLMGAVFSLKPSQRSVNWLFRIVGAVAAGFGVFFFSKITYTLGLSQTLPVNLAAWSPA 349

Query: 345 ILTISLSILILLQKEDG 361
           ++T  +++  L   EDG
Sbjct: 350 LVTTMVALAALFHLEDG 366


>gi|58038774|ref|YP_190738.1| hypothetical protein GOX0299 [Gluconobacter oxydans 621H]
 gi|58001188|gb|AAW60082.1| Hypothetical transmembrane protein [Gluconobacter oxydans 621H]
          Length = 396

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 98/372 (26%), Positives = 169/372 (45%), Gaps = 29/372 (7%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  + ++ +TL  +L    LV + D  ++  +    PN   S    +AA  VP  I  ++
Sbjct: 36  YIARQFMLSTLSMVLALTGLVSLFDFIDLLRRAATRPNVPASLIVKIAALHVPYYIIYVL 95

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           PF  L+  IV F  L R+SEL+++RA GIS WQ L   +  ++L G+ T   I+ ++++ 
Sbjct: 96  PFGILLGGIVCFSRLTRSSELIVARAAGISAWQFLASPLACALLTGLLTTTGISALSSTM 155

Query: 128 EKIGIDLIQQWKDNGD------------KQKSD-IIPWMQISNPQQDIFI--GAKKILPE 172
            +    L Q +   G             +Q  D ++P        QD+ +  GA K+   
Sbjct: 156 FRSAEMLDQTYLRTGGGPLTLNGGALWLRQSDDGLVPHGVAILHAQDVHLIDGALKV--- 212

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPI 232
                  +   +D ++++I R +A    + + +  L          +P      TL   +
Sbjct: 213 ----SGVSIFRLDDRDRLIVRVEAPQGALGDHQWILHGTSVLHPDHLPQQIGDMTLPSDL 268

Query: 233 KMDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
            +   Q   E FAS    S + +   +S   +S  F + R    F  L+ +P++   M L
Sbjct: 269 TVGRVQ---ESFASPDTLSVFALPGFISLLERSG-FPSIRHRLHFQSLLALPILAGTMAL 324

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           ++A  S+  +R      ++  GI +GF L+TI  + + FG+SG L PV AA  P    + 
Sbjct: 325 VSAGFSMRPTRRGGVARMLGSGIAAGFALFTISKVAEQFGESGALPPVLAAWAPTGAGLC 384

Query: 350 LSILILLQKEDG 361
           L++ +LL  EDG
Sbjct: 385 LAVALLLHMEDG 396


>gi|254418566|ref|ZP_05032290.1| putative permease, YjgP/YjgQ family [Brevundimonas sp. BAL3]
 gi|196184743|gb|EDX79719.1| putative permease, YjgP/YjgQ family [Brevundimonas sp. BAL3]
          Length = 378

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 86/343 (25%), Positives = 156/343 (45%), Gaps = 13/343 (3%)

Query: 27  LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTS 86
           LV +ID  E+   +G   + S  R   L A + P +I Q++PF+ L   +  +  LNR S
Sbjct: 41  LVMLIDFVEVSRGVGSDQDLSALRILGLVALKSPSVIVQLLPFVFLFGTLAAYIGLNRRS 100

Query: 87  ELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQK 146
           ELV  RA G+S W+ + P    +++LG+ TV V+ P+A++G+ +      +         
Sbjct: 101 ELVAMRAAGVSAWRFVLPAAGMALVLGVLTVTVLGPLASAGDGLWQRERARISGTAPGAS 160

Query: 147 SDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT----SITIDKKNKIIHRKDADLAIIY 202
           S+   W++  + Q+ + I A +    N    D T    +   +       R DA  A + 
Sbjct: 161 SNDAIWLREGDDQRQMIIRAGRQDRANARLLDVTFFIYTTDAEGNRDFSERIDARSAALS 220

Query: 203 NDKVKLKKVVEYQYGRIPID-KNSTTLNIPIKMDGFQKFSEQFASRSFYEI---IKKMSF 258
             + +L   V    G+  +   +   L+     + F++F+    S  F+ +   IK++  
Sbjct: 221 AGRWRLTDAVGASIGQRAVTYSSLDLLSSLADEEAFERFARP-QSTPFWSLPNQIKRIED 279

Query: 259 SNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFML 318
           +  ++  +  R    F  L+V PL+  AM+++AA+ SL   R      +    +  GF  
Sbjct: 280 AGFASTAYRLR----FQQLLVTPLVFAAMSILAAAFSLRLMRLGDLAKMSVAAVVLGFAF 335

Query: 319 YTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           + +     + G + ++ P  AA +P ILT   +  +L   EDG
Sbjct: 336 FFLNQFSSAMGSAEVVPPFVAAWLPPILTALAAFTLLFYTEDG 378


>gi|209964865|ref|YP_002297780.1| predicted permease YjgP [Rhodospirillum centenum SW]
 gi|209958331|gb|ACI98967.1| predicted permease YjgP [Rhodospirillum centenum SW]
          Length = 364

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 175/357 (49%), Gaps = 22/357 (6%)

Query: 18  LYFL--LGAMI-LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVV 74
           L+FL  LG M+ +V+++D  E+  +    P+ +      +   ++P I Q+I+PF+ L  
Sbjct: 17  LWFLAILGGMLAIVYLLDTVELLRRAANKPDAAFQIVLTMGLLKLPEIGQEIVPFVVLFG 76

Query: 75  NIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG----EKI 130
            +  F+ L RT ELV+ RA GIS+WQ + P +  + L+G+  V V+NPI ++     E++
Sbjct: 77  GMYTFWRLTRTQELVVVRASGISVWQFMAPVLTATFLIGMTLVGVLNPIFSAMLGRYEQL 136

Query: 131 GIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKI 190
               ++  K + D  +S I  W++     Q   I A  I+P          +  +   ++
Sbjct: 137 ENRYLRGMKSSLDVAESGI--WLRQVGEPQAYLIHADAIVPGTLELRQVMVLLNESDGQV 194

Query: 191 IHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASR--- 247
             R DA  A + +   +L+     + GR  + +      +P ++   QK  E FAS    
Sbjct: 195 SGRFDAASATLRDGFWELRDAWFNRPGR--VGEFLPAYRLPTELTE-QKIQEAFASPDTL 251

Query: 248 SFYEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
           SF+E+   I  +  +  S++ H       ++ L+  P++L AM L+AA+ ++   R    
Sbjct: 252 SFWELPGFIATLEATGLSSVRHRL----HWHSLLAQPVLLCAMILLAAAFAMRQVRRGGA 307

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
             ++A GI +  +L+ +  I+ + G SG +  + AA  P  +++ L    LL  EDG
Sbjct: 308 LTLIALGIAAALLLFVMQDIVLALGMSGTIPVLLAAWAPAGVSVMLGAAALLHLEDG 364


>gi|154253776|ref|YP_001414600.1| permease YjgP/YjgQ family protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154157726|gb|ABS64943.1| permease YjgP/YjgQ family protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 363

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 94/365 (25%), Positives = 166/365 (45%), Gaps = 16/365 (4%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L RY  + +L   L      ++L+F+I+L E+  +  + P+ +      +A   VP I  
Sbjct: 7   LSRYLGRQFLGVVLLTFGVFIVLIFMIELVELLRRSADKPDVTFGLVVTIALMEVPRIGA 66

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           Q +PF  L   +  F  L+R +ELV++RA G+S+WQ + P +  + ++G F   V NP++
Sbjct: 67  QTLPFAVLFGGMAAFLRLSRNNELVVARAAGVSVWQFIAPALAVAFVIGAFVTTVFNPVS 126

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIP-----WMQISNPQQDIFIGAKKILPENHIWEDF 179
            +       L  ++     +Q S +       W++ ++      + A + + +       
Sbjct: 127 ATLTTRAEQLESKYL---SRQASFVAVSANGLWLRQADSTGQSVVHALR-MDDGFRLRRV 182

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T    D+ N+   R DA  A +     +L  V     G      ++      +     ++
Sbjct: 183 TIFLYDQGNRFSGRIDAATARLRPGYWELADVWVMMDGEQSRKYDTYRQETSLTQ---KQ 239

Query: 240 FSEQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
             E FA   S SF+E+   ++ +  +  F   R +  F+ L+  P +L  M LIAA+ SL
Sbjct: 240 IEESFAREESISFWELPHFIATAEAAG-FSARRYQIYFHQLLATPALLCTMVLIAAAFSL 298

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
             +R      +V  GIFSGF++Y +  +  + G SGIL    AA  P ++   L + +L 
Sbjct: 299 RVTRMGGLLQMVLGGIFSGFLIYFLGNLAIALGLSGILPAALAAWAPSLVATLLGLAVLF 358

Query: 357 QKEDG 361
             EDG
Sbjct: 359 HLEDG 363


>gi|260427738|ref|ZP_05781717.1| permease, YjgP/YjgQ family [Citreicella sp. SE45]
 gi|260422230|gb|EEX15481.1| permease, YjgP/YjgQ family [Citreicella sp. SE45]
          Length = 364

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 168/368 (45%), Gaps = 15/368 (4%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +    +  L    I V ++DL E   + G   + S ++   + A R+P  +
Sbjct: 2   ILHRYFARRFFWMFMSILSVFAIFVGLVDLVEQIRKFGG--DISFAQKVQITALRLPEGM 59

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINP 122
            +I+P + ++    +F  L R+SELV+ RA G S +  L+ P +V   + G+ TV ++NP
Sbjct: 60  YEILPLVMILATAALFLMLARSSELVVVRAAGRSGLTALMGPMMVALAISGV-TVAMLNP 118

Query: 123 IATSGEKIGIDLIQQWKDNGDK----QKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           +  +  K   DL + ++++G       K  +  W++  +      I A +  P+  +  D
Sbjct: 119 LVAATSKRASDLAESYENDGASVISIGKEGL--WLRQGSSDGQAVIRAARANPDATVLYD 176

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI--PIDKNSTTLNIPIKMDG 236
            + +   +    I R +A  A + +    L+    +  G    P         + I  D 
Sbjct: 177 VSFLQYAEDGGPIRRVEAAEAALEDGAWALRDAKVWPLGTRANPEAAAERHDRLRIASDL 236

Query: 237 FQK-FSEQFASRSFYEIIKKMSFSN--KSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
            Q    ++F   S   I     F N  +   F   R E  F   +  P+ LVAM L+AA 
Sbjct: 237 TQNDIRDRFGKPSAVAIWDLPDFINGLEQAGFSARRHEVWFQMELARPIFLVAMVLVAAG 296

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
            ++  +R  +  + V   +  GF LY +    +  G++G L P+ AA +P + ++ L++ 
Sbjct: 297 FTMRPARLGRTGLYVLAAVLLGFGLYYVRNFAQIMGENGQLPPLFAAWVPPVASLMLALG 356

Query: 354 ILLQKEDG 361
           ++LQ EDG
Sbjct: 357 LVLQMEDG 364


>gi|304392006|ref|ZP_07373948.1| permease [Ahrensia sp. R2A130]
 gi|303296235|gb|EFL90593.1| permease [Ahrensia sp. R2A130]
          Length = 372

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/367 (23%), Positives = 170/367 (46%), Gaps = 16/367 (4%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  K +L+ T++  L    L+ ++D+ E+  +   + +        +   R P++ + I+
Sbjct: 9   YLAKNFLRNTMFVFLVFFFLIALVDMLELSRRTARIDDVGFFDVVSIVMLRAPVLSENIV 68

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA--T 125
           PF  L         LN+  ELV++RA G+S+WQ L P    + ++G+   L+ NP++   
Sbjct: 69  PFAVLFGASASLLLLNKRLELVVARASGVSVWQFLAPICAAAAVVGLVMGLIYNPLSLRL 128

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
               + ++ +   K+ G    +    W +I+ P  D+ + A             +    D
Sbjct: 129 QASSLSLEGVVFAKNTGVTSDTTWNFWTRIARPDGDMVLRAAVAAERGKKLSGVSLYLFD 188

Query: 186 KKNKIIHRKDADL-----AIIYNDKVKLKKVVEYQ----YGRIPIDKNSTTLNIPIKMDG 236
           K  K   R DA       A+   D +  + V+E       G  P       + + I  + 
Sbjct: 189 KDGKPEQRIDAASANFAEAVPGTDSLPNRYVLERANILTVGEKPKVVPVMVVPVSITAEL 248

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            +         SF+++  +   + ++        +T+++ ++ +PL+ VAM L+A +VSL
Sbjct: 249 LEIRQTSAERVSFWDLDDQAELAERAG-RPPEPFQTRWHSVLALPLLFVAMVLLAGTVSL 307

Query: 297 EFSRS--NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
            F+R   N  RI+   G+ +GF+LY +  ++ +FG +G++ PV AA  P  +   ++I +
Sbjct: 308 TFARFGINGKRILT--GVVAGFVLYVLTKLVVTFGSNGLVSPVIAAWSPATVGSLIAITV 365

Query: 355 LLQKEDG 361
           LL +EDG
Sbjct: 366 LLHQEDG 372


>gi|310816138|ref|YP_003964102.1| putative permease [Ketogulonicigenium vulgare Y25]
 gi|308754873|gb|ADO42802.1| putative permease [Ketogulonicigenium vulgare Y25]
          Length = 360

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 174/374 (46%), Gaps = 31/374 (8%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF   Y K  L    G  +++ +I+L E   + G   ++       L    VP  +
Sbjct: 2   ILHRYFALRYFKAFLGTAAGFFLMLVMIELIEQLRRFGGQSDFP-----ALTLLNVPATL 56

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINP 122
            Q++P I ++  +V+F  L R+SE+V++RA G S +  L+ P ++  +L+G+  V+  NP
Sbjct: 57  YQVLPLIVIISALVLFLGLARSSEMVVTRAAGRSALIALIAPVLI-VMLMGLLAVMAFNP 115

Query: 123 IATSGEKIGIDLIQQWKDNGD--KQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           I  S  +   + I     +    +   D I W++  +      I A    P+       T
Sbjct: 116 IVASTSREYDNRIATITGSSRILQIGGDAI-WLRQGDEDGQSVIRAAASDPDGTTLRGVT 174

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLK--KVVEYQYGRIPIDKNST---TLNIPIKM- 234
            ++         R DA  A +  D  +++  KV     G+ P + ++T   TL +P  + 
Sbjct: 175 MLSYTNDGIPARRIDAAAATLSGDHWQMQNAKVWPLNTGQNP-EASATIHATLAVPSNLS 233

Query: 235 -DGFQKFSEQFASRSFYEI---IKKM---SFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
            D  +      AS S +E+   IK+M    F+ +  I H  ++E      + +P  LVAM
Sbjct: 234 PDEIRNSFGNPASISVWELPAFIKRMEDAGFTAQRQIVH-LQSE------LALPAFLVAM 286

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
            LIAA  +L   R  +  ++V + +   F LY I  + +  G++G L P+ AA +  +  
Sbjct: 287 MLIAAVFTLRHQRGGRTGMMVLFAVLISFSLYFIRNLAQILGENGQLTPLLAAWVTPLAA 346

Query: 348 ISLSILILLQKEDG 361
           I+L + +LL  EDG
Sbjct: 347 IALGVGLLLHLEDG 360


>gi|148261610|ref|YP_001235737.1| permease YjgP/YjgQ family protein [Acidiphilium cryptum JF-5]
 gi|326405100|ref|YP_004285182.1| permease YjgP/YjgQ family protein [Acidiphilium multivorum AIU301]
 gi|146403291|gb|ABQ31818.1| permease YjgP/YjgQ family protein [Acidiphilium cryptum JF-5]
 gi|325051962|dbj|BAJ82300.1| permease YjgP/YjgQ family protein [Acidiphilium multivorum AIU301]
          Length = 376

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 88/354 (24%), Positives = 145/354 (40%), Gaps = 40/354 (11%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  + +L   +    G   +  + D  ++  Q  + P  +  R   L   RVP +  QI+
Sbjct: 16  YIGRRFLGAVVAMQAGLTAIGALFDFLDLLRQSADKPQATFWRMLALEVLRVPWLGMQIL 75

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT-- 125
           PF  L+  I  F+ L R+SELV++RA G S+WQ L   V G+ L+G+      +PI+   
Sbjct: 76  PFAVLLGGIFAFWRLTRSSELVVARATGTSVWQFLAVPVAGAALIGVLATTAGSPISAIM 135

Query: 126 -------SGEKIGID-----------LIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAK 167
                      +G+D            ++Q  D G K    I+          D      
Sbjct: 136 FARAEVLYSTYLGVDSGPLSLQGGQLWLRQADDAGGKGGIAIL--------HADAVHLHG 187

Query: 168 KILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT 227
           K+L   HI    T + +  +  +  R +A    +     +L+          P  +  + 
Sbjct: 188 KVLTTGHI----TVLRLTAQTTLQERIEAARGQLEPGGWRLESARILTPDGEP--RAVSA 241

Query: 228 LNIPIKMDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
           L IP  +    +  E FAS    SF+ +   +    +S  F   + E  F  L+ +PL+ 
Sbjct: 242 LRIPTTLT-VGRVQESFASPSALSFWALPGFIRLLRRSG-FSATQHELAFQSLLALPLLC 299

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
             M L+AA  S+  SR      ++  G+  GF+L+ +  +    GKSG  LPV 
Sbjct: 300 ATMVLVAAGFSMRPSRRGGAIQMIGAGVGCGFLLFMLSEVAAQLGKSGA-LPVG 352


>gi|302383688|ref|YP_003819511.1| permease YjgP/YjgQ family protein [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194316|gb|ADL01888.1| permease YjgP/YjgQ family protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 381

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 162/351 (46%), Gaps = 30/351 (8%)

Query: 27  LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTS 86
           LV +ID  EI   +G   + S  R   L   + P +I Q++PF+ L   +  F  LNR S
Sbjct: 45  LVMLIDFVEISRGLGSDTDLSGVRILGLMLIKSPAVIVQLLPFVFLFGTLAAFVGLNRRS 104

Query: 87  ELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDN----- 141
           EL+  RA G+S W+ + P    ++  G+ TV VI P+A SG+     + Q+ +       
Sbjct: 105 ELIAMRAAGVSAWRFVLPAAGAALAAGVLTVTVIGPLAASGD----GMFQRERGRISGAV 160

Query: 142 GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT----SITIDKKNKIIHRKDAD 197
           G  ++  I  W++    Q+ + + A +    N    D T    +   + +     R DA 
Sbjct: 161 GGGEQEAI--WLREGEGQRQMVVRAARQDRANARLLDVTFFIYATDPEGRRAFTERIDAA 218

Query: 198 LAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFA---SRSFYEI-- 252
            A +   + +L   V  Q G+       +TL++P  +   + F E+FA   S  F+ +  
Sbjct: 219 SASLSAGRWRLVDAVGAQTGQRA--TRYSTLDLPSSLADDEAF-ERFARPQSTPFWSLPG 275

Query: 253 -IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR-SNQPRIIVAY 310
            I+++  +  S+  +  R +     L+  PL   AMT++AA+ SL   R  +  R+ VA 
Sbjct: 276 QIQRIEAAGFSSTAYRLRLQQ----LLSTPLAFAAMTILAAAFSLRLMRLGDLARMAVA- 330

Query: 311 GIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            +  GF  + +     + G + ++ P  AA +P +LT   +  +L   EDG
Sbjct: 331 AVVLGFAFFFLNQFSAAMGSAEVVPPFIAAWLPAVLTALAAFTLLFYTEDG 381


>gi|254294287|ref|YP_003060310.1| permease YjgP/YjgQ family protein [Hirschia baltica ATCC 49814]
 gi|254042818|gb|ACT59613.1| permease YjgP/YjgQ family protein [Hirschia baltica ATCC 49814]
          Length = 368

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 156/328 (47%), Gaps = 21/328 (6%)

Query: 17  TLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNI 76
           TL  +LGA++LV   D+ E    +G     S+     L A + P +I + +PF  LV ++
Sbjct: 21  TLGIILGAILLV---DMVEQLRTVGARTELSLLGAFQLTALKAPQLILETMPFAILVGSM 77

Query: 77  VVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT-------SGEK 129
           + +  LNR+SEL   RA G+S W+ L P    +  LG   + +I+P+AT       + + 
Sbjct: 78  LAYSKLNRSSELSAIRASGVSAWRFLAPTFFLAAFLGCIAMTIIDPLATFSNAKYETEKT 137

Query: 130 IGIDLIQQWKDNGDKQKSDIIPWM-QISNPQQDIFIGAKKILPENHIWEDFTSITIDKKN 188
           + +D     KD+  +QK     W+ Q ++  Q +  G  ++LP ++       I I +K+
Sbjct: 138 LLLDDTGAVKDSAKRQKK---VWLRQGTDTTQSVIHG--EVLPNDNSSLQNVEIFILEKD 192

Query: 189 ----KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
               +   R DA  A +     +L+ V EY     PI ++   L   +            
Sbjct: 193 GDEFEFQRRIDAKKATLRPGFWQLEGVTEYSSDNEPIKQDYLALTTTLDPSTILDRGTDE 252

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            S SF+++ + +  + ++ +  + +   + + L+ +P++L AM LI A V L   RS   
Sbjct: 253 KSISFWKLPQLIQDARRAGLDAD-KYILKLHTLLAMPVLLGAMALIGAVVCLRLRRSGGV 311

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSG 332
             ++A GI +GF+L+ +  + K    SG
Sbjct: 312 TQLLAAGIGAGFLLFFVNQVSKGLASSG 339


>gi|163746449|ref|ZP_02153807.1| permease YjgP/YjgQ family, putative [Oceanibulbus indolifex HEL-45]
 gi|161380334|gb|EDQ04745.1| permease YjgP/YjgQ family, putative [Oceanibulbus indolifex HEL-45]
          Length = 365

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 91/374 (24%), Positives = 169/374 (45%), Gaps = 26/374 (6%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPL 61
           IL  YF + +  +   F++   +L  ++ L +  +Q     +  +    VL  T   +P 
Sbjct: 2   ILHFYFARRFFTS---FMVITAVLAALVMLVDGVDQARRFADDDVGWDQVLGMTLLNMPQ 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            I  I+P I ++  + +F  L R+SE+V++RA G S  + L   VV ++++G   V V+N
Sbjct: 59  TINMILPLIMILATVALFIGLARSSEMVVTRAAGRSALRALVAPVVVALIIGTLAVAVLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           PI  +  +    L Q+++ NG      SD   W++    +    I A +   +  +  + 
Sbjct: 119 PIVAATSERSEQLTQKYRSNGSSALSVSDEGLWLRQGTEEGQSVIRAWRTNSDASVLYNV 178

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKV----VEYQYGRIPIDKNSTTLNIP--IK 233
           T I+ D +   I R +A+ A +     +L       +E         +   TL IP  + 
Sbjct: 179 TIISYDAEKGPIRRIEAESAQLSGGDWQLTGAKIWPLEAGVNAEGAAEEHETLTIPSSLT 238

Query: 234 MDGFQKFSEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
           ++  ++   + A+ S YE+      +++  FS + +       E      +  P  LVAM
Sbjct: 239 VERIRESIARVAAVSIYELPEFIRQLEQAGFSTRQH-------EVWLQAELARPFFLVAM 291

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
            L+A++ ++  +R     + V   I  GF LY I +  +  G++G +    AA  P +  
Sbjct: 292 VLVASAFTMRHTRFGGTGVAVLASILLGFGLYFIRSFAQILGENGQIPVTLAAWAPPVAA 351

Query: 348 ISLSILILLQKEDG 361
           I L++ +LL  EDG
Sbjct: 352 IFLALGLLLHAEDG 365


>gi|16125935|ref|NP_420499.1| hypothetical protein CC_1690 [Caulobacter crescentus CB15]
 gi|221234698|ref|YP_002517134.1| hypothetical protein CCNA_01761 [Caulobacter crescentus NA1000]
 gi|13423101|gb|AAK23667.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220963870|gb|ACL95226.1| hypothetical membrane spanning protein [Caulobacter crescentus
           NA1000]
          Length = 368

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 91/367 (24%), Positives = 166/367 (45%), Gaps = 24/367 (6%)

Query: 11  KYYLKTTLYFLLGAMI----LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           +Y LK T+  L+GA+     +V +I   +I   +G   + S  R   L   + P  I  +
Sbjct: 10  RYVLKRTMGALVGALAVLSAMVMLIAFVDIARNVGTRADASFLRLLYLTILQAPATILVL 69

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            PFI L   +  F  LNR SEL+  RA GIS W+ + P    S ++G+ T+ ++NP+ T+
Sbjct: 70  APFIFLFGTMWAFVELNRRSELIAMRAAGISAWRFIMPAAASSFVIGLLTITLLNPL-TT 128

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAK-KILPENHIWEDFTSI--- 182
                 +  +    NG  +++    W++  + +  I I A+ + L +  +     S+   
Sbjct: 129 AMTAKFETERDRTMNGYLKEAPKGTWLRQGDDKTQIVIRARARELVDGSVRLRGVSLFVY 188

Query: 183 TIDKKN--KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
           T++ K       R +A+ A +     +L  V E   G   I  +S  L+IP  +D  +  
Sbjct: 189 TLNAKGVMDFTRRIEANEARLEPGFWRLSGVREATPGAGAIRSDS--LSIPSNLDD-RTA 245

Query: 241 SEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
           SE+F +     +      I++ + +  S +    R +      +  PL+  AM+++AA+ 
Sbjct: 246 SERFNTPQAVALWRLPATIQRTADAGFSAVPFKLRLQQD----LATPLLFAAMSVLAAAF 301

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           SL   R     ++   G+  GF  +    +  + G++ +L P  AA  P  + + +   +
Sbjct: 302 SLRLMRLGGLAMLAGSGVALGFGFFFFNELCSTLGRADVLAPFVAAWTPPTVALLVGFTL 361

Query: 355 LLQKEDG 361
           L   EDG
Sbjct: 362 LCYTEDG 368


>gi|126736392|ref|ZP_01752134.1| putative permease [Roseobacter sp. CCS2]
 gi|126714213|gb|EBA11082.1| putative permease [Roseobacter sp. CCS2]
          Length = 364

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 166/372 (44%), Gaps = 23/372 (6%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF   +L++ L   +   +++  +DL +   + G   + +     +L+   +P   
Sbjct: 2   ILHRYFASRFLRSFLGVGMVFFLIMLFVDLVDQLRRFGS-KDATFVDLLMLSLLNIPQAF 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINP 122
             I+P I ++  I +F +L+R+SE+V++RA G S +  LL P  V ++L+GIF V V+NP
Sbjct: 61  YAILPLIMILATIALFLSLSRSSEMVVTRAAGRSALHSLLAPLTV-ALLVGIFAVGVMNP 119

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSD--IIP------WMQISNPQQDIFIGAKKILPENH 174
           I     K       +++   D  + D  ++       W++  N      I A+    +  
Sbjct: 120 IVAGTSK-------EFEARSDALRGDSSVLSFGSSGLWLRQGNATGQTVIRAQSANLDGT 172

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
           +  D T +T       I R  A  A +      L+    +Q   +   + S  L+    +
Sbjct: 173 LLTDVTFLTFAPDGNPITRISAASAELTTGAWVLRDAKSWQLAGVTTPEASAQLDAERTV 232

Query: 235 DGF---QKFSEQFASRSFYEIIKKMSFSNK--SNIFHNYRAETQFYFLIVIPLMLVAMTL 289
                  +  + F + S   I +  +F ++  +  F   R    F+  + +P+ LV+M L
Sbjct: 233 QSTLTPDQIRDSFGTPSSIPIWELPAFIDRLQTAGFSAQRHLVWFHTELALPIFLVSMVL 292

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           I AS +L   R  +  ++V + +   F+ Y I    +  G++G L  + AA  P    I 
Sbjct: 293 IGASFTLRHQRGGRTGMMVMFAVLLAFVTYFIRNFAQVLGENGQLPVLLAAWAPPFAAIG 352

Query: 350 LSILILLQKEDG 361
           +S+  LL  EDG
Sbjct: 353 ISMGFLLHHEDG 364


>gi|83313005|ref|YP_423269.1| permease [Magnetospirillum magneticum AMB-1]
 gi|82947846|dbj|BAE52710.1| Predicted permease [Magnetospirillum magneticum AMB-1]
          Length = 367

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 162/343 (47%), Gaps = 22/343 (6%)

Query: 32  DLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVIS 91
           D+ E+  +    P   I+   ++A  ++P ++  I+PF  ++ ++V F+ L RT ELV++
Sbjct: 34  DVIELIRRAAGRPELGITPILLMAFFKLPQMLHTILPFAVMIGSMVCFWRLTRTHELVVA 93

Query: 92  RAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG----EKIGIDLIQQWKDNGDKQKS 147
           RA GIS+WQ + P +  + + GIF +   NP+A +     E++  +L+       D   S
Sbjct: 94  RAAGISVWQFITPVLAVAGIFGIFEITTFNPMAAAMYGRYERLQDELLATKASAFD--IS 151

Query: 148 DIIPWMQISNPQQDIFIGAKKILPEN---HIWEDFTSITIDKKNKIIHRKDADLAIIYND 204
           ++  W++  +   ++ + ++ +  +    HI  D      D+ +    R  A+ A + + 
Sbjct: 152 EVGLWLREPHENGEMVVHSETVRQDGLVLHI-RDAHFFLYDRPDHFHQRISAESATLVDG 210

Query: 205 KVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASR---SFYEIIKKMSFSNK 261
             ++++    + G+  + K    ++IP ++    +  + FAS    SF+++   + F  +
Sbjct: 211 AFEVRRAWVMEGGKPSVFKEQ--MHIPTQLT-LDRIHDNFASPETLSFWQLPGFIRFFER 267

Query: 262 SNIFHNYRAETQFYF--LIVIPLMLVAMTLIAASVSLE-FSRSNQPRIIVAYGIFSGFML 318
           +    N   + + Y   L+  P++   M L+AA  SL   +RS      +  G+ +GF +
Sbjct: 268 AGFTAN---KHRLYLQSLLASPVLYCGMVLMAAVFSLRPNTRSGGLLARIGAGVAAGFAV 324

Query: 319 YTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           Y    ++ + G S  L    AA  P +    + +  L   EDG
Sbjct: 325 YFFSKVIYALGLSATLPQTLAAWTPPLFAGLIGLSGLFHLEDG 367


>gi|83945295|ref|ZP_00957644.1| hypothetical protein OA2633_00970 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851465|gb|EAP89321.1| hypothetical protein OA2633_00970 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 367

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 166/375 (44%), Gaps = 22/375 (5%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILV----FVIDLNEIQNQMGELPNYSISRGAVLAA 56
           M G LWRY F      TL  L+GA +++     +ID  E    +G     S  +   L+ 
Sbjct: 1   MIGRLWRYLFI----QTLIGLIGAAVIITAVILLIDFVETSRDIGTRVGISAFQALHLSL 56

Query: 57  TRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
            + PL++Q  +PFI L   +  FF LNR SEL++ RA G S W++L P  + + L G  +
Sbjct: 57  LKAPLLVQDTLPFIVLFGVLFTFFRLNRRSELIVMRASGYSAWRILAPVAILAALTGAIS 116

Query: 117 VLVINPIATSG----EKIGIDLIQ-QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP 171
            L +NP+  +     E     L + + + +G  Q   I  W++ +     I I A++   
Sbjct: 117 TLALNPLGAASNARFEATREALFEGEGQSSGANQSGPI--WLRETTATGYIMITAQQQGG 174

Query: 172 ENHIWED--FTSITIDKKNKII--HRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT 227
           ++    +  F    + +    +   R  A+ A +      L   +EY  G    +     
Sbjct: 175 DDATLTEPVFRQYVLSESGAPLLDRRITAERAELNGGFWSLTNAIEYAPGGQATELGDVA 234

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
           L   +      + +    + SF+++   ++ +  + +  +   E +++ L+  PLMLVA 
Sbjct: 235 LPTNVGRQALFERARSPGAVSFWQLPAVIASARDAGL-SSLAYELRWHGLLAQPLMLVAA 293

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA-LIPVIL 346
            L+  + +L   R        A G  +GF+LY    +M   G SG + P+ AA   P + 
Sbjct: 294 ALMGIAATLRLHRLGGAAGFAAAGATAGFILYFSQELMLGLGASGAITPLTAAWTTPALF 353

Query: 347 TISLSILILLQKEDG 361
           +++  +  +   EDG
Sbjct: 354 SLA-GLFFIAATEDG 367


>gi|329850878|ref|ZP_08265723.1| hypothetical protein ABI_37970 [Asticcacaulis biprosthecum C19]
 gi|328841193|gb|EGF90764.1| hypothetical protein ABI_37970 [Asticcacaulis biprosthecum C19]
          Length = 380

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 90/363 (24%), Positives = 162/363 (44%), Gaps = 19/363 (5%)

Query: 12  YYLKTTLYFLLGAMI----LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y L+T +     A++    L+ +I+  EI   +    +       V+   R P  I  ++
Sbjct: 24  YILQTCVAMFASALMVVSALILLINYVEISRSVAARADLGGLEVLVMLFQRSPSAILILL 83

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           PF  L  ++  F NLNR SEL+  RA G+S W+ + P  V +   GI T+ V+NP+A+  
Sbjct: 84  PFAFLFGSLFAFVNLNRRSELIAMRAAGVSAWRFVLPATVSAFAFGILTIGVLNPVASHL 143

Query: 128 EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE-NHIWE-DFTSITID 185
           + +    +   +       ++ I   Q  + +Q +     +   +  H+    F   T D
Sbjct: 144 QDVYERKVVAAEAFAPTDPAEAIYLRQGDSDRQVVIRADGQASAQIGHLRGVTFWIFTTD 203

Query: 186 KKN--KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNS---TTLNIPIKMDGFQKF 240
           ++     I R DA  AI+     +LK   EY      +DK +     L +   +D  + F
Sbjct: 204 RRGAPSFIERVDAREAILRPGSWQLKDAREYT-----LDKPAQFYNVLTLSSNLDPQKAF 258

Query: 241 SEQFASRS--FYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
               +++S  F+  +  +   N+ + F     E + + L+  PLM  AMT + A  SL  
Sbjct: 259 KRYASTQSVPFWR-LPGLIRQNQISGFSTTSYELKLHQLLSTPLMFAAMTALGAVFSLRL 317

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R     I+V  G+  GF+++ +  +  S GK+ ++    A   P +L +  ++ +L+  
Sbjct: 318 MRLGGLTILVTSGVSLGFVIFFVNQLFASMGKADVIPAALAGWSPAVLAMLGAMTLLVYT 377

Query: 359 EDG 361
           EDG
Sbjct: 378 EDG 380


>gi|163735796|ref|ZP_02143225.1| permease YjgP/YjgQ family, putative [Roseobacter litoralis Och 149]
 gi|161390882|gb|EDQ15222.1| permease YjgP/YjgQ family, putative [Roseobacter litoralis Och 149]
          Length = 365

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 164/365 (44%), Gaps = 20/365 (5%)

Query: 12  YYLKTTLYFLLGAMILVF-VIDLNEIQNQMGELPNYSISRGAV--LAATRVPLIIQQIIP 68
           Y+ +    +L+ A I +F +I L ++ +Q     +  +S   +  L     P  I QI+P
Sbjct: 6   YFARRFASWLMIAFIALFALIALVDLVDQTRRFADRGVSAAGIFELVILNTPQTISQILP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGE 128
            I L+  +  F +L R+SEL+ +RA G S    L   V   I+LG      +NPI  +  
Sbjct: 66  LIVLLATVAFFLSLARSSELIATRASGRSAMGALIAPVGVVIVLGTLATTTLNPIVAATS 125

Query: 129 KIGIDLIQQWKDNGDKQKSDIIP--WMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
           K   +L Q ++  G    S      W++       + I A +  P+  +  D T +  + 
Sbjct: 126 KKYNELSQTYRTGGGSTFSISTEGLWLRQGTDDGQMVIRAWRSNPDASVLFDVTFLAYEV 185

Query: 187 KNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR-IPIDKNST---TLNIPIKMDGFQKFSE 242
               + R  AD A + +    L+ V ++   R I  + N+T   +L IP  +   ++  E
Sbjct: 186 IGTPVRRIHADSAELKDGAWLLRNVKDWPLARGINSEGNATEHRSLTIPSSLT-VERIRE 244

Query: 243 QFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            F   S   I      IK+++ +  S++ H    +++    +  PL LVAM LIA++ ++
Sbjct: 245 SFGHPSTISIWEMNDFIKQLNQAGFSSLQHRVWLQSE----LARPLFLVAMVLIASAFTM 300

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
             +R     + V   +  GF LY + +     G++G L    AA  P I ++ L+   LL
Sbjct: 301 RHTRFGGTGVAVLAAVLLGFALYFVRSFGLILGENGQLPVYLAAWAPPIASVLLAFGPLL 360

Query: 357 QKEDG 361
             EDG
Sbjct: 361 HAEDG 365


>gi|23013662|ref|ZP_00053531.1| COG0795: Predicted permeases [Magnetospirillum magnetotacticum
           MS-1]
          Length = 312

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 147/317 (46%), Gaps = 22/317 (6%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++  I+PF  ++  +V F+ L RT ELV++RA GIS WQ + P +  + + GIF +
Sbjct: 5   KLPQMLHTILPFAVMIGAMVCFWRLTRTHELVVARAAGISAWQFITPVLAVAGMFGIFEI 64

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
              NP+A +     E++  +L+       D   S++  W++  +   ++ + ++ +  E 
Sbjct: 65  TTFNPMAAAMYSRYERLQDELLAAKSSAFD--ISEVGLWLREPHDDGEMVVHSETVRQEG 122

Query: 174 ---HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNI 230
              HI  D      D+ +    R  A+ A + +   ++++    + G+  + K    +  
Sbjct: 123 LVLHI-RDAHFFLYDRPDHFYQRIAAETASLEDGAFEVRRAWVMEGGKPSVFKEKMRIPT 181

Query: 231 PIKMDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYF--LIVIPLMLV 285
            + +D   +  + FAS    SF+++   + F  ++    N   + + Y   L+  P++  
Sbjct: 182 QLTLD---RIHDNFASPETLSFWQLPGFIRFFERAGFTAN---KHRLYLQSLLASPVLYC 235

Query: 286 AMTLIAASVSLE-FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
            M L+AA  SL   +RS      +  G+ +GF +Y    ++ + G S  L    AA  P 
Sbjct: 236 GMVLMAAVFSLRPNTRSGGLLARIGGGVAAGFAVYFFSKVIYALGLSATLPQTLAAWTPP 295

Query: 345 ILTISLSILILLQKEDG 361
           +    + +  L   EDG
Sbjct: 296 LFAGLIGLSGLFHLEDG 312


>gi|86138692|ref|ZP_01057265.1| permease, YjgP/YjgQ family protein [Roseobacter sp. MED193]
 gi|85824752|gb|EAQ44954.1| permease, YjgP/YjgQ family protein [Roseobacter sp. MED193]
          Length = 367

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 92/351 (26%), Positives = 160/351 (45%), Gaps = 20/351 (5%)

Query: 25  MILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLIIQQIIPFITLVVNIVVFFNL 82
           M LV +IDLNE   Q+     + +S   ++  T    P  + + +P I ++  IV+F  L
Sbjct: 23  MTLVMLIDLNE---QIRRFDEFDVSASEIVGLTLLNAPAALSEFLPLIMILTTIVLFVGL 79

Query: 83  NRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNG 142
            R+SELV++RAIG S  + L   V+ + LLGI  V  +NPI  +   +   L   ++  G
Sbjct: 80  ARSSELVVTRAIGRSGIRALAAPVLVAGLLGILAVSTLNPIVAATTNLSKTLADTYRTGG 139

Query: 143 DKQK--SDIIPWMQISNPQQDIFIGAKKI--LPENHIWEDFTSITIDKKNKIIHRKDADL 198
                 S    W++  +P     I A       +N +  D T +    +   I +  A+ 
Sbjct: 140 PSALSFSGEGLWLRQGSPSGQSVIHASSYGGGSDNIVLYDVTILAYAPQGGPIRQIIAES 199

Query: 199 AIIYNDKVKLKKVVEYQY--GRIPIDKNST--TLNIPIKMDGFQKFSEQFASR---SFYE 251
           A +  ++  L K   +    G  P    +T  TL +P  +    +  ++  S    S Y+
Sbjct: 200 ARLDGEEWLLHKAKAWHMTAGLNPERSAATHETLRLPTTLTQ-DRIRDRLGSADGISVYD 258

Query: 252 IIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYG 311
           +   +    ++  F   R +  +   +  PL L+AM L+ A+ ++  +R     + V   
Sbjct: 259 LPTTIRDLAQAG-FSTKRYQVWYQVELARPLFLIAMVLVGAAFTMRHTRFGGTGLAVLTA 317

Query: 312 IFSGFMLYTIITIMKSFGKSGILLPVA-AALIPVILTISLSILILLQKEDG 361
           +  GF LY +    +  G++G  +PVA AA  P + +I L++ +LL  EDG
Sbjct: 318 VLLGFGLYFVRNFAQILGENG-QIPVALAAWAPPVASILLTMGLLLHAEDG 367


>gi|295689677|ref|YP_003593370.1| permease YjgP/YjgQ family protein [Caulobacter segnis ATCC 21756]
 gi|295431580|gb|ADG10752.1| permease YjgP/YjgQ family protein [Caulobacter segnis ATCC 21756]
          Length = 367

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 90/367 (24%), Positives = 162/367 (44%), Gaps = 24/367 (6%)

Query: 11  KYYLKTTLYFLLGAMI----LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           +Y LK ++  L+GA+     +V +I   +I   +G   + +  +   L   + P  I  +
Sbjct: 9   RYVLKRSMSALVGALAVLGAMVMLIAFVDIARNVGTRADVNFFQLLYLTVLQAPATILVL 68

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            PF+ L   +  F  LNR SEL+  RA G+S W+ + P    S ++G+ T+ ++NP+ T+
Sbjct: 69  APFVFLFGTMWAFVELNRRSELIAMRAAGVSAWRFIMPAATASFVIGLLTITLLNPL-TT 127

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAK-KILPENHIWEDFTSI--- 182
                 +  +    NG    +    W++  + +  I I A+ + + +  +     S+   
Sbjct: 128 AMTARFETERDHMMNGYLNNAPRGTWLRQGDDKTQIVIRARGRDMIDGSVRLRGVSLFVY 187

Query: 183 TIDKKN--KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
           T++KK       R +A+ A +     +L  V E   G   I  +S  L+IP  +D  +  
Sbjct: 188 TLNKKGVMDFTRRIEANEARLEPGFWRLTGVREATPGAGAIRSDS--LSIPSNLDD-RTA 244

Query: 241 SEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
           SE+F +     +      IK+   +  S      R +      +  PL+  AM+++AA+ 
Sbjct: 245 SERFNTPQAVALWRLPATIKRAEDAGFSAAPFKLRLQQD----LATPLLFSAMSVLAAAF 300

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           SL   R      +   G+  GF  +    +  + GK+ +L P  AA  P I+ I     +
Sbjct: 301 SLRLMRLGGLAALAGSGVALGFGFFFFNELCSTLGKADVLAPSIAAWTPPIVAILAGFTL 360

Query: 355 LLQKEDG 361
           L   EDG
Sbjct: 361 LCYTEDG 367


>gi|114766152|ref|ZP_01445156.1| permease, YjgP/YjgQ family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114541612|gb|EAU44654.1| permease, YjgP/YjgQ family protein [Roseovarius sp. HTCC2601]
          Length = 364

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 151/315 (47%), Gaps = 17/315 (5%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTV 117
           +P  + +I+P + ++    +F  + R+SELV+ RA G S +  L  P  V  ++ G+ +V
Sbjct: 55  LPSGLYEILPLVMILATAALFLMMARSSELVVVRAAGRSGLTALAGPVAVALVISGV-SV 113

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILPENHI 175
            ++NPI  +  +   DL + +K NG    S      W++    + D  I A +  P+  +
Sbjct: 114 AILNPIVAATSRQSSDLTESYKSNGASTISIGREGLWLRQGGDEGDTVIRAARANPDATV 173

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLK--KVVEYQYGRIP--IDKNSTTLNIP 231
             + + +  + ++  + R +A+ A + +    L+  K    Q GR P  + +    L +P
Sbjct: 174 LYEVSFVEYEAESGPLRRIEAEEAALQDGAWVLRDAKAWPLQSGRSPEGMSERFERLELP 233

Query: 232 --IKMDGFQKFSEQFASRSFY---EIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
             +  DG +    + +S + +   E I+ +  +     F   R        +  P+ LVA
Sbjct: 234 SDLTQDGIRDRFGKPSSVAIWDLPEFIEGLEMAG----FSARRHVVWLQMELARPVFLVA 289

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
           M L+AA  ++  +R  +  + V   +  GF LY +    +  G++G L P+ AA IP I 
Sbjct: 290 MVLVAAGFTMRPARLGRTGLHVLAAVLLGFGLYYVRNFAQIMGENGQLPPILAAWIPPIA 349

Query: 347 TISLSILILLQKEDG 361
           ++ L++ ++LQ EDG
Sbjct: 350 SLLLALGLVLQMEDG 364


>gi|159043738|ref|YP_001532532.1| permease YjgP/YjgQ family protein [Dinoroseobacter shibae DFL 12]
 gi|157911498|gb|ABV92931.1| permease YjgP/YjgQ family protein [Dinoroseobacter shibae DFL 12]
          Length = 365

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 147/316 (46%), Gaps = 27/316 (8%)

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVIN 121
           I ++IP I ++  I +F  + RTSEL+++RA G S I  L+ P +V  ++ GI  + V+N
Sbjct: 60  IYEVIPLIMVLATITLFLKMARTSELIVTRAAGRSAIRSLIAPVIVAGLIGGI-GISVLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIP------WMQISNPQQDIFIGAKKILPENHI 175
           PI  +  +I     ++ +D    + + ++       W++ + P+  I I A        I
Sbjct: 119 PIVAATSRIA----EETRDEVRGRATSVLALSSEGLWLRQAAPEGQIVIHAAGASLGGTI 174

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-GRIPID---KNSTTLNIP 231
             D T +  D     I R  A  A +      L  V  +   GR+  +   + S  + +P
Sbjct: 175 LYDVTFLRFDADALPIERVAASRAELVPGAWDLTGVKVWDLTGRLNPEAGVRTSAWMQVP 234

Query: 232 IKMDGFQKFSEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
             +    +  + F   S   I      I ++  +  + + H     T+    +  P+ LV
Sbjct: 235 SDLT-LDQIRDSFGDPSAIPIWELPAFIDQLEAAGFAALSHRVWLHTE----LASPVFLV 289

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
           AM LI A+ ++  +R  +  ++V + +  GF +Y + +  +  G++G +  +AAA  P +
Sbjct: 290 AMVLIGAAFTMRHTRFGRTGLMVLFAVLLGFSMYFLKSFAQVLGEAGKIPVLAAAWFPPL 349

Query: 346 LTISLSILILLQKEDG 361
             + LS+ +LL +EDG
Sbjct: 350 AGVFLSLALLLHQEDG 365


>gi|89070357|ref|ZP_01157664.1| putative permease [Oceanicola granulosus HTCC2516]
 gi|89044004|gb|EAR50179.1| putative permease [Oceanicola granulosus HTCC2516]
          Length = 366

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 94/379 (24%), Positives = 164/379 (43%), Gaps = 35/379 (9%)

Query: 4   ILWRYFFKYYLKTTL------YFLLGAMILVFVIDLNEIQNQMGELPNYSISRGA-VLAA 56
           IL RYF + YL + L      + LLGAM LV          Q  E+ + + +R + VLA 
Sbjct: 2   ILHRYFARRYLTSFLTVSGLFFVLLGAMDLV---------EQANEVSDEAAARWSDVLAL 52

Query: 57  T--RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI 114
           T    P  + +I+P + ++  I +F  L R+SELV++RA G S    L   V+   L+G 
Sbjct: 53  TLLNAPASLYEILPLLVILSTIALFLGLARSSELVVTRAAGRSALHALVAPVLVVALIGA 112

Query: 115 FTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP------WMQISNPQQDIFIGAKK 168
             + V+NP+  +  K     +   +D G    + I+       W++   P+    I A +
Sbjct: 113 VALAVLNPLVAATSKEYEARVSALEDRG----ASIVSVDAGGLWLRQGGPEGQSVIRAAR 168

Query: 169 ILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL 228
              +       T IT  ++ +   R DA  A +     +L +   +  G   + + +   
Sbjct: 169 ANTDGTELSGVTFITFAEEGRPSRRIDARRARLEAGVWRLVEAKSWPLGDAGVPEAAAEE 228

Query: 229 N----IPIKMDGFQKFSEQFASRSFYEIIKKMSFSNK--SNIFHNYRAETQFYFLIVIPL 282
           +    +   +   Q   + F + S   I +   F ++  +  F   R +      +  P 
Sbjct: 229 HDVYEVATSLTAAQ-IRDSFGAPSSIPIWELPRFIDRLQTAGFSARRHQVWLQTELAKPA 287

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
            LVAM LI A+ ++   R  +  ++    I   F LY +    +  G++G +  + AA  
Sbjct: 288 FLVAMLLIGAAFTMRHQRGGRTGLMALVAILLSFGLYFLRNFAQILGENGQIPVLLAAWA 347

Query: 343 PVILTISLSILILLQKEDG 361
           P +  I+ S+ +LL KEDG
Sbjct: 348 PPLAGIAASVALLLHKEDG 366


>gi|126725341|ref|ZP_01741183.1| putative permease [Rhodobacterales bacterium HTCC2150]
 gi|126704545|gb|EBA03636.1| putative permease [Rhodobacterales bacterium HTCC2150]
          Length = 365

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 97/375 (25%), Positives = 168/375 (44%), Gaps = 28/375 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSIS--RGAVLAATRVPL 61
           IL  YF + ++   L  L     ++F+ID+ E   Q+    + S+     A LA    P 
Sbjct: 2   ILHLYFARKFITNFLMILFVFFGIIFLIDMVE---QLRRFSSNSVGMKEAAQLALLNAPG 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            + +I+P + ++  + +F NL RTSELVI+RA G S    L   ++ +  LG+F V V N
Sbjct: 59  NLYRILPLLVILSTLALFLNLTRTSELVIARASGRSALGALLAPLLVTFTLGVFGVSVWN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIP------WMQISNPQQDIFIGAKKILPENHI 175
           PI  +      +L +   D    + S+ +       W++  N +    I A +      I
Sbjct: 119 PIGAATA----NLYETISDRHLGRASNALSIGAEGLWLRQGNVEGQTVIHANETNQNGTI 174

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI--PIDKNSTTLNIPIK 233
             + T +  D  +++I+R +A  A +      L     + +     P    STT  I ++
Sbjct: 175 LGNVTFLAFDINSQVIYRIEAKTAKLETGGWVLNDTKRWDFKDTLNPELSASTTDTIRLQ 234

Query: 234 MDGFQK-FSEQFASRS---FYEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            +  QK   E F + S   F+E+   I  +  +  S+  H     T+    + +P  L+A
Sbjct: 235 SNLTQKEIQESFGAPSDIPFWELPAFIASLENAGFSSTQHRVWYATE----LALPAFLMA 290

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
           M LI A  ++  SR  +  I++   I  GF L+ +    +  G SG +  + AA  P + 
Sbjct: 291 MVLIGAMFTMRHSRFGKTGIMLLGAIVMGFGLFFLKNFAQVLGNSGQIPVLLAAWTPPLA 350

Query: 347 TISLSILILLQKEDG 361
            I L++  +L  E+G
Sbjct: 351 GILLALGFILHTEEG 365


>gi|56697305|ref|YP_167671.1| YjgP/YjgQ family permease [Ruegeria pomeroyi DSS-3]
 gi|56679042|gb|AAV95708.1| permease, YjgP/YjgQ family [Ruegeria pomeroyi DSS-3]
          Length = 365

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 173/372 (46%), Gaps = 22/372 (5%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPL 61
           IL RYF + ++++ L   L  + LV +IDL E   Q+     + +S G ++  T    P 
Sbjct: 2   ILDRYFARRFIQSFLVIGLVFLGLVLLIDLIE---QLRRFEGFEVSMGQLVGLTLLNAPA 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVI 120
            I +I+P + ++  IV+F  L R+SELV++RAIG S I  L+ P +V ++++G+  V  +
Sbjct: 59  AISEILPLLMILSTIVLFVGLARSSELVVTRAIGRSGIRALVGPVLV-ALVIGLLAVTTL 117

Query: 121 NPIATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           NPI  +       L   +++ G      SD   W++  +      I A     +     D
Sbjct: 118 NPIVAATAVRYQTLADTYRNGGPSVLSLSDEGLWLRQGDAGGQSVIHATGFGGDGVTLFD 177

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLK--KVVEYQYGRIPIDKNST---TLNIPIK 233
            T ++         R  A+ A + + K  L+  KV   + G+ P + N+     + +P  
Sbjct: 178 VTILSYAPDGSAQRRTIAESAQLQDGKWLLQKAKVWPLKVGQNP-EANAVYHDRIEMPTS 236

Query: 234 MDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
           +   ++  +    R   S Y++ + +    ++  F   R +      +  PL LV+M L+
Sbjct: 237 LTQ-ERIRDSLGRRETVSIYDLPQTIEQLQQAG-FSTKRHKVWLQVELARPLFLVSMVLV 294

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA-AALIPVILTIS 349
            A+ ++  +R     + V   +  GF LY      +  G++G  +PVA AA  P +  I 
Sbjct: 295 GAAFTMRHTRFGGTGLAVLSAVLLGFTLYFTRNFAQILGENG-QIPVALAAWAPPVAAIM 353

Query: 350 LSILILLQKEDG 361
           L+  +LL  EDG
Sbjct: 354 LTFGLLLHAEDG 365


>gi|197105169|ref|YP_002130546.1| hypothetical protein PHZ_c1706 [Phenylobacterium zucineum HLK1]
 gi|196478589|gb|ACG78117.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 367

 Score = 89.7 bits (221), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 162/369 (43%), Gaps = 16/369 (4%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
           G L RY     L      L     ++ +I   E+ +Q+G   +   S    L   R P +
Sbjct: 5   GRLERYVMGRMLAGVGAALAVISAVILLIQFVELSSQVGTRADVGASGIFALTLLRAPSL 64

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           IQ ++PF  L   I  F  LNR SELV  RA G+S W+ + P    + +LG+  V V+NP
Sbjct: 65  IQILLPFCFLFGGIGAFVGLNRKSELVAMRAAGVSAWRFILPSAALAAILGVLAVAVLNP 124

Query: 123 IATS-GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAK-KILPENHIWEDFT 180
            A +   +   +  +  ++    +  D+  W++  + +  I I AK +      +     
Sbjct: 125 FAAALNARFEAERARLMENYLGDRPQDV--WIRQGDERTQIVIHAKDRETVAGAVVLKGV 182

Query: 181 SITIDKKN-----KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
           S+ I +K      +   R +A  A +     +L+ V E   G   I   S +L+I   +D
Sbjct: 183 SVFIYEKTPRGAPEFRRRLEAAEARLMPGFWRLRDVREAGVGESSI--RSESLSIRSTLD 240

Query: 236 GFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAA 292
             +   E+FAS    +F+ +   +  + ++  F       +F  L+  P++  AMT++AA
Sbjct: 241 A-EAAMERFASPEAIAFWRLPAAIRLTEQAG-FSAAGYRLRFQQLLATPVLFAAMTVLAA 298

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSI 352
           + SL   R      +   G+  GF+++       +  K+ IL   AAA  P ++ +   +
Sbjct: 299 AFSLRLVRLGGLAGLAGAGVALGFVMFFFNQFAGALAKADILPLFAAAWAPTLVALLAGV 358

Query: 353 LILLQKEDG 361
            +L   EDG
Sbjct: 359 TLLCYTEDG 367


>gi|296532232|ref|ZP_06894979.1| permease YjgP/YjgQ family protein [Roseomonas cervicalis ATCC
           49957]
 gi|296267439|gb|EFH13317.1| permease YjgP/YjgQ family protein [Roseomonas cervicalis ATCC
           49957]
          Length = 369

 Score = 89.7 bits (221), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 161/324 (49%), Gaps = 22/324 (6%)

Query: 52  AVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQ-LLNPFVVGSI 110
           A +AA R+P ++ QI+PF  L+  IV F+ L+R SELV++RA G+S W  LL P +V ++
Sbjct: 54  ASIAALRLPYVVLQILPFAVLLGGIVAFWRLSRASELVVARAAGVSAWSFLLGPVLV-AL 112

Query: 111 LLGIFTVLVINPIATS----GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQD----- 161
            +G   + V++P++ +     E++    ++     G    +    W++ ++   +     
Sbjct: 113 AMGTLAITVVSPLSAAMMARAERLDATYLRN--ATGLSSLAGGKLWLRQADESVEPGGVA 170

Query: 162 IFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPI 221
           I  G  ++  +  +    +       ++ I R +A LA +      L++ V +   R P+
Sbjct: 171 ILAGVPEVGRDGFLLRGASLWRFSATDRPIGRAEAPLARLEPGAWVLQEAVSFGRDRQPL 230

Query: 222 DKNSTTLNIPIKMDGFQKFSEQFASR---SFYEIIKKMSFSNKSNIFHNYRAETQFYFLI 278
              + TL +P  +    +  E FAS    SF+ +   ++    +  F   R    F+ L+
Sbjct: 231 P--AATLRLPTSLTP-DRIEETFASPDTLSFWALPGFIAVLESAG-FSAVRHRLTFHSLL 286

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
            +PL+  AM L+AA  S+  +R      ++  GI +GF L+ +  + + FG++G  LPVA
Sbjct: 287 SLPLLAAAMALLAAGFSMRHARRGGVGRMLGLGIAAGFALFLLDKVAEEFGQAGT-LPVA 345

Query: 339 -AALIPVILTISLSILILLQKEDG 361
            AA  P +  +  ++ +LL  EDG
Sbjct: 346 LAAWAPSVAGLLFALTLLLYTEDG 369


>gi|315500013|ref|YP_004088816.1| permease yjgp/yjgq family protein [Asticcacaulis excentricus CB 48]
 gi|315418025|gb|ADU14665.1| permease YjgP/YjgQ family protein [Asticcacaulis excentricus CB 48]
          Length = 379

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 84/341 (24%), Positives = 149/341 (43%), Gaps = 11/341 (3%)

Query: 27  LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTS 86
           ++F+ID  EI   +G+  + S  +   L   + P II  ++PF  L   +  F  LNR S
Sbjct: 44  IIFLIDYVEISKSLGQRGDLSSLQIVGLLMLKSPNIILVLLPFAFLFGTLSAFVGLNRRS 103

Query: 87  ELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQK 146
           EL+  RA G+S W+ + P    + +LG  TV V++P AT           Q   +  + K
Sbjct: 104 ELIAMRAAGMSAWRFVLPAAGMAAILGALTVTVLSPAATVLADQYDRFAAQQSQSDTRAK 163

Query: 147 SDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKN--KIIHRKDADLAIIYND 204
           +  I   Q    QQ +    ++      I   F + ++D+    + + R DA  A++   
Sbjct: 164 TGEIYLRQGDGKQQTVIHAREQSEDGRLIDASFWTFSLDEAEIPRFLTRIDASEAVLRPG 223

Query: 205 KVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD-GFQKFSEQFASRSFYEI---IKKMSFSN 260
             +LK     + G   +  N+ ++   +  +  F +F+    S +F+++   I ++  S 
Sbjct: 224 TWQLKSARVSKPGETTLYYNTLSIGSNLSPERAFNRFAAP-QSTNFWQLPGTIAQIESSG 282

Query: 261 KSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYT 320
            S   +  R       L+  PLM  AMT + A+ SL   R      +   GI  GFM++ 
Sbjct: 283 FSAAGYVLRLNQ----LLATPLMFAAMTALGAAFSLRLMRIGGLARLTLSGIVLGFMVFF 338

Query: 321 IITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           +  +  S GK+ ++    A           ++ +L+  EDG
Sbjct: 339 LNQLCGSLGKAEVIPAFLAGWATPFAAFLTAMTLLVYTEDG 379


>gi|144900091|emb|CAM76955.1| permease YjgP/YjgQ family [Magnetospirillum gryphiswaldense MSR-1]
          Length = 367

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 170/372 (45%), Gaps = 39/372 (10%)

Query: 10  FKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPF 69
           F     + L  +LG + L  +I+L       G+L  +++   A+L   ++P ++  ++PF
Sbjct: 15  FLLAFASVLAVILGVVFLFDIIELIRRAAGRGDLGVFNLVAMALL---KLPQMMHTVLPF 71

Query: 70  ITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS--- 126
             ++  +V F+ L RT ELV++R+ GIS WQ L P +V    LG+  +   NP+A +   
Sbjct: 72  AVMIGAMVAFWRLTRTHELVVARSAGISAWQFLTPVLVLVAGLGVIELTAFNPMAATMYG 131

Query: 127 -----------GEKIGIDLIQQ--WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
                      G+   +D+ +   W   GD Q+  ++   Q+   QQ++       L   
Sbjct: 132 RFQKMEDEILLGKTSALDVSEMGLWLREGDAQRQIVLHADQV---QQELL---TLNLRGV 185

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
           H++       ++ +     R  A    + +  ++L  V E + G+  +   +  L   + 
Sbjct: 186 HVF------VLNAEEHFTRRLSAASGRLADGVLELTDVWEMEGGKSSVHHPALKLATELT 239

Query: 234 MDGFQKFSEQFAS---RSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
           ++   +  + FAS    SF+++   ++F  K+  F   +    F  L+  PL+  AM L+
Sbjct: 240 LE---RVHDNFASPETMSFWQLPAFITFFEKAG-FAATKHRMHFQSLLSSPLLYCAMVLV 295

Query: 291 AASVSLEFS-RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           AA  SL  + R+    + V  G+ +GF +Y    I+ +FG S  L    AA  P ++   
Sbjct: 296 AAVFSLRPNMRAGGLLMRVGGGVAAGFGIYFFNKIIYAFGLSATLPQGLAAWSPALVAGL 355

Query: 350 LSILILLQKEDG 361
           + +  LL  EDG
Sbjct: 356 IGVSGLLHLEDG 367


>gi|254460215|ref|ZP_05073631.1| permease, YjgP/YjgQ family [Rhodobacterales bacterium HTCC2083]
 gi|206676804|gb|EDZ41291.1| permease, YjgP/YjgQ family [Rhodobacteraceae bacterium HTCC2083]
          Length = 365

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 102/380 (26%), Positives = 168/380 (44%), Gaps = 48/380 (12%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           R FF+ +L T L FL      + +IDL E Q +  +  + S S    L     P  I QI
Sbjct: 9   RRFFRVFLTTLLIFL----AFLTLIDLVE-QMRRFDSKDVSFSDIVFLTLFNAPGAIYQI 63

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINPIAT 125
           +P + ++  + +F  L RTSELV++R+ G S +  L +P  V +++ GI TV + NPI  
Sbjct: 64  LPLVMILSAVSLFLTLARTSELVVTRSAGRSALVTLASPMCVAAVI-GITTVTLFNPIVA 122

Query: 126 SGEKIGIDLIQQ----------------WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKI 169
           S  +  I L Q+                W   GD+    +I  +  S+  + +F    + 
Sbjct: 123 STTRQYITLEQEYKSQKKNTVSIGRDGLWLRQGDENGQTVIHALSTSDDMRTLF--DARF 180

Query: 170 LPENHIWEDFTSITIDKKN------KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDK 223
           L  N   +  T I  D+        ++I  K   L    N +   ++        I +  
Sbjct: 181 LQYNTDSQPKTRIIADEARLTNTGWQLIRAKHWSLDTSGNPEETARE--------IDVLM 232

Query: 224 NSTTLNIPIKMDGFQKFS--EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIP 281
             TTL I    D F + +    +   ++ E +++  FS +    H    + +F      P
Sbjct: 233 LPTTLTIENIRDSFSEPAAISIWEMDAYIEGLEEAGFSTRR---HKVWQQMEF----ARP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L L+AM L+ AS ++  +R  +  + V   I  GF LY +    +  G++G L  + AA 
Sbjct: 286 LFLMAMVLVGASFTMRHTRFGKAGVAVLAAIMMGFGLYYVRNFAQILGENGQLPTMIAAW 345

Query: 342 IPVILTISLSILILLQKEDG 361
            P I +I L++ +LL  EDG
Sbjct: 346 TPPIASILLALGLLLHMEDG 365


>gi|126728788|ref|ZP_01744603.1| permease, YjgP/YjgQ family protein [Sagittula stellata E-37]
 gi|126710718|gb|EBA09769.1| permease, YjgP/YjgQ family protein [Sagittula stellata E-37]
          Length = 364

 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 90/371 (24%), Positives = 167/371 (45%), Gaps = 33/371 (8%)

Query: 12  YYLKTTLYFLLG--AMILVF--VIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YY +  L   LG  A+  +F  ++DL +   Q+G+    S      L   ++P  + +I+
Sbjct: 6   YYARRFLSLFLGIFAVFALFQGLLDLIDELRQLGD--EVSFGETLQLVILKLPEGLYEIL 63

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINPIATS 126
           P + ++  + +F  L R+SELV +RA G S +  L+ P  V ++L+G   V ++NPI  +
Sbjct: 64  PLVMILATVAMFIGLARSSELVATRAAGRSGLTALMAPATV-ALLIGAIIVAMMNPIVAA 122

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIP---WMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             K   DL + + ++G+       P   W++         I A +  PE     D + +T
Sbjct: 123 TSKRYADLRETY-ESGNTSAVSFGPEGLWLRQGGEDGQSVIRAARANPEATELYDVSIVT 181

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY---------GRIPIDKN-STTLNIPIK 233
                    R  A+ A + +    L     +            R+ ++    +TL     
Sbjct: 182 YAPDGGPAMRIQAESAALSDGAWHLTDAKAWPLTPGLNPELGARLHVEYELPSTLTRESI 241

Query: 234 MDGFQKFSEQ--FASRSFYEIIKKMSFSNKSNI-FHNYRAETQFYFLIVIPLMLVAMTLI 290
            D F + S    +    F   +++  FS + +I ++N          +  PL LVAM L+
Sbjct: 242 RDRFGRPSAVAIWDLPQFIAGLEESGFSARRHIVWYNME--------LARPLFLVAMVLV 293

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISL 350
            A+ +++ +R  +  + V   +  GF LY + +  +  G++G L PV AA +P   ++ L
Sbjct: 294 GAAFTMQPTRLARTGLAVLSAVLLGFGLYYVRSFAQIMGENGQLAPVVAAWVPPTASVLL 353

Query: 351 SILILLQKEDG 361
           ++ ++L  EDG
Sbjct: 354 ALGLVLHMEDG 364


>gi|110680307|ref|YP_683314.1| YjgP/YjgQ family permease [Roseobacter denitrificans OCh 114]
 gi|109456423|gb|ABG32628.1| permease YjgP/YjgQ family, putative [Roseobacter denitrificans OCh
           114]
          Length = 365

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 96/372 (25%), Positives = 166/372 (44%), Gaps = 22/372 (5%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAV--LAATRVPL 61
           IL  YF + +     + L+  + L  +I L ++ +Q     +  +S   +  L     P 
Sbjct: 2   ILHLYFARRFAS---WLLIAFIALSALIALVDLVDQTRRFADRGVSATGIFELVILNTPQ 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            I QI+P I L+  +  F +L R+SEL+ +RA G S    L   V   ILLG      +N
Sbjct: 59  TISQILPLIVLLATVAFFLSLARSSELIATRASGRSAMGALVAPVSVVILLGTLATTTLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIP--WMQISNPQQDIFIGAKKILPENHIWEDF 179
           PI  +  K   +L Q ++  G    S      W++ +     + I A +  P+  +  D 
Sbjct: 119 PIVAATSKKYNELSQIYRTGGVSTLSISTEGLWLRQATDDGQMVIRAWRSNPDASVLFDV 178

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR-IPIDKNST---TLNIPIKMD 235
           T +  +     + R  AD A + +    L+ V ++   R I  + N+T   +L IP  + 
Sbjct: 179 TFLAYEVIGTPVRRIHADSAELKDGAWLLRNVKDWPLARGINSEGNATEHRSLTIPSSLT 238

Query: 236 GFQKFSEQFASRS------FYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
             ++  E F   S        + IK+++ +  S++ H    +++    +  PL LVAM L
Sbjct: 239 -VERIRESFGHPSTISIWEMTDFIKQLNQAGFSSLQHRVWLQSE----LARPLFLVAMVL 293

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           IA++ ++  +R     + V   +  GF LY + +     G++G L    AA  P I ++ 
Sbjct: 294 IASAFTMRHTRFGGTGVAVLAAVLLGFALYFVRSFGLILGENGQLPVYLAAWAPPIASVL 353

Query: 350 LSILILLQKEDG 361
           L+   LL  EDG
Sbjct: 354 LAFGPLLHAEDG 365


>gi|254510403|ref|ZP_05122470.1| permease, YjgP/YjgQ family [Rhodobacteraceae bacterium KLH11]
 gi|221534114|gb|EEE37102.1| permease, YjgP/YjgQ family [Rhodobacteraceae bacterium KLH11]
          Length = 382

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 103/372 (27%), Positives = 177/372 (47%), Gaps = 21/372 (5%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV--PL 61
           IL RYF + ++++  + ++G + L  +I ++ I+ Q+    +  +S G +L  T +  P 
Sbjct: 18  ILDRYFARRFVQS--FLVIGGIFLTLMILIDLIE-QVRRFDSVDLSFGQLLQLTLLNTPA 74

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVI 120
            I +++P + ++  I +F  L R+SELV++RAIG S I  LL P  + ++++G F V ++
Sbjct: 75  AISEMLPLLMILATIALFVGLARSSELVVTRAIGRSGIRALLAPVFI-ALMIGGFAVALL 133

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKS---DIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           NPIA +  +    L   +++ G    S   + +   Q S   Q +      +  ++    
Sbjct: 134 NPIAAATSEEFQRLADGYRNQGSSALSISGEGLWLRQASASGQSVIHATGTVNGDDFALH 193

Query: 178 DFTSITID---KKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT---LNIP 231
           D T  T     K N+ I  + ADL   Y   ++  KV   +    P + N+TT   LN+P
Sbjct: 194 DVTITTFSSDGKPNQQIAARQADLENGYW-TLRQAKVWTLEDDLNP-ETNATTHEVLNLP 251

Query: 232 IKM--DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
             +  D       Q  S S Y++ + +S   ++  F   + E      +  PL LV+M L
Sbjct: 252 TTLTRDRILDTLGQQDSVSVYDLPQLISDLREAG-FATKQYEVWLQVQLARPLFLVSMVL 310

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           I A+ ++   R     I V   +  GF +Y I    +  G++G L    AA  P    I 
Sbjct: 311 IGAAFTMRHVRFGGTGIAVLTAVLLGFGIYFIRNFAQILGENGQLPIFVAAWAPPFAGIL 370

Query: 350 LSILILLQKEDG 361
           LS+ +LL  EDG
Sbjct: 371 LSLGLLLHAEDG 382


>gi|259419234|ref|ZP_05743151.1| permease YjgP/YjgQ [Silicibacter sp. TrichCH4B]
 gi|259345456|gb|EEW57310.1| permease YjgP/YjgQ [Silicibacter sp. TrichCH4B]
          Length = 368

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 88/370 (23%), Positives = 161/370 (43%), Gaps = 23/370 (6%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLIIQQ 65
           Y+ K + +   +FL+ A +L+ ++ L ++  Q        +  G +L  T    P  + +
Sbjct: 6   YYAKRFFQ---WFLVIAAVLMSLVMLIDLSEQFRRFDGQDLQFGQLLELTLLNTPAALNE 62

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT 125
            +P I ++  IV++  + R+SELV++RA+G S  + L P VV +++LG   V  +NPI  
Sbjct: 63  FLPLIMILTTIVLYVGMARSSELVVTRALGRSGIRALLPPVVVALILGGLAVSTLNPIVA 122

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIP---WMQIS--NPQQDIFIGAKKILPENHIWEDFT 180
           +       L + ++  G      +     W++    N Q  I     +   EN    D +
Sbjct: 123 ATTNRFDSLSESYRQTGGPAAVSLSGEGLWLRQGGQNGQSVIHAANYRGDAENLFLYDVS 182

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY--GRIP--IDKNSTTLNIPIKMDG 236
            +T         R  A  A +  +   L+    +Q   G  P    K+   L +P  +  
Sbjct: 183 ILTYTPDGGPTRRTIAAEARLDGEDWVLRDAKVWQLIVGVNPERSAKSYDELRLPTTLTN 242

Query: 237 FQ-----KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
            +      ++E  +     + IK +S +     F   R +      +  PL LVAM L+ 
Sbjct: 243 ERIRDTLGYAEGISIYELPQTIKSLSEAG----FSTTRFQVWLQVELARPLFLVAMVLVG 298

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLS 351
           A+ ++  +R     I V   +  GF LY +    +  G++G +  + AA  P + +I L+
Sbjct: 299 AAFTMRHTRLGGTGIAVLTSVLLGFALYFVHNFARILGENGQIPILLAAWAPPVASILLT 358

Query: 352 ILILLQKEDG 361
           + +LL  EDG
Sbjct: 359 MGLLLHAEDG 368


>gi|254486546|ref|ZP_05099751.1| permease, YjgP/YjgQ family [Roseobacter sp. GAI101]
 gi|214043415|gb|EEB84053.1| permease, YjgP/YjgQ family [Roseobacter sp. GAI101]
          Length = 365

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 93/383 (24%), Positives = 164/383 (42%), Gaps = 44/383 (11%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPL 61
           IL  YF + ++  T + L+ A++   +I L ++  Q  +   + I    +   T    P 
Sbjct: 2   ILHLYFARRFV--TGFVLISAVLFALLI-LVDMVEQARKFAEHDIGWQRLFGMTLLNTPE 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            +  I+P I ++  +V+F +L R+SELV++RA G S    L   V  + ++GI  V ++N
Sbjct: 59  TLNLILPLIMILATVVLFLSLARSSELVVTRASGRSALSALQAPVWVAFIIGIMAVGMLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           PI  +  K  I L +  +  G      SD   W++    Q    I A +   +  +  D 
Sbjct: 119 PIVAATAKRYIQLSESIRAGGVSTLSISDEGLWLRQGGDQGQTVIRAWRSNADASVLYDV 178

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T +T   +   I R +A  A + +D            G +     S  L + +  +G  +
Sbjct: 179 TFLTYAAQGGPIRRIEASSAALEDD------------GWVLTGAKSWPLELGVNAEGNAE 226

Query: 240 FSEQFASR------------------SFYEI---IKKMSFSNKSNIFHNYRAETQFYFLI 278
             E                       S Y++   I ++  +  S   H    +T+    +
Sbjct: 227 VFETLTLPSTLTLDRIRESITDPGVVSIYDLPGFIHQLELAGFSPRRHKVWLQTE----L 282

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
             P  LVAM L+A++ ++  +R     + V   +  GF LY I +  +  G++G +  V 
Sbjct: 283 ARPFFLVAMVLVASAFTMRHTRFGGTGVAVLASVLLGFGLYFIRSFAQILGENGQIPVVL 342

Query: 339 AALIPVILTISLSILILLQKEDG 361
           AA  P + +I L+I +LL  EDG
Sbjct: 343 AAWAPPVASILLAIGLLLHAEDG 365


>gi|84516314|ref|ZP_01003674.1| permease, YjgP/YjgQ family [Loktanella vestfoldensis SKA53]
 gi|84510010|gb|EAQ06467.1| permease, YjgP/YjgQ family [Loktanella vestfoldensis SKA53]
          Length = 364

 Score = 83.2 bits (204), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 160/372 (43%), Gaps = 23/372 (6%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +L T L  L    +++  +DL E Q++        +     L    +P  I
Sbjct: 2   ILHRYFARRFLMTFLGVLAVFFLIMLFLDLVE-QSRRYASAEAGLRDLLTLTLLNIPRAI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINP 122
            +I+P I ++  I +F  L R+SELV++RA G S +  +L P  VG +L+GI  V V+NP
Sbjct: 61  YEILPLIMILAAIGLFLGLARSSELVVTRAAGRSALRAILAPLAVG-LLIGIVAVAVLNP 119

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIP--------WMQISNPQQDIFIGAKKILPENH 174
           I  +  K       +++  G   + +           W++     +   I A     +  
Sbjct: 120 IVAATSK-------EYEARGGALRGNASALSIGSSGLWLRQGASDEQTVIRAAGANLDGT 172

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
           +  D T +T         R +A  A++ +    L+    + +G     +        +++
Sbjct: 173 VLTDVTFLTFTPDVGPARRVNAASAVLTDGAWVLRNAKVWTFGGTLTPEAGAVTQATMRI 232

Query: 235 DGF---QKFSEQFASRSFYEIIKKMSFSN--KSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
                  +  + F + S   I +  +F +  +   F   R     +  I  P+ L+AM +
Sbjct: 233 ASTLTPDQIRDSFGTPSSIPIWQLPAFIDRLREAGFSAQRHLVWLHSEIAQPVFLMAMVM 292

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           I AS ++   R  +  + V   I   F++Y I    +  G++G L    AA  P +  ++
Sbjct: 293 IGASFTIRHQRGGRTGLAVMTAILLAFVIYFIRNFAQVLGENGQLPAALAAWAPPLAAMA 352

Query: 350 LSILILLQKEDG 361
           LS+ ILL  EDG
Sbjct: 353 LSLGILLHNEDG 364


>gi|84500988|ref|ZP_00999223.1| permease, YjgP/YjgQ family protein [Oceanicola batsensis HTCC2597]
 gi|84391055|gb|EAQ03473.1| permease, YjgP/YjgQ family protein [Oceanicola batsensis HTCC2597]
          Length = 365

 Score = 82.8 bits (203), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 98/381 (25%), Positives = 166/381 (43%), Gaps = 49/381 (12%)

Query: 6   WRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQ 65
           WR F + ++     FLL +M+    ID+ E   ++   P  ++S+   L     P  I  
Sbjct: 9   WR-FLRIFIGLLAVFLLMSML----IDVAEHLRRLSSTPA-TLSQVLRLVLLNAPEGIYT 62

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINPIA 124
           I+P I ++  + +F  L RTSELV++RA G S +  L++P +V +  +G+  V ++NPI 
Sbjct: 63  ILPLIMILATVALFLGLARTSELVVTRAAGRSALRSLVSPVIV-AFAIGVIGVAMVNPIV 121

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIP------WMQISNPQQDIFIGAKKILPENHIWED 178
            +  K    L++ ++  G    +D++       W++    +    I A +  P+     D
Sbjct: 122 AATSKRYAALLESYQSGG----ADVLSLSAEGLWLRQGGAEGQTVIRAARSNPQATELYD 177

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI-PIDKNSTTLNIPIKMDGF 237
            T I          R +A  A +      +    E    RI P+ + +       + + F
Sbjct: 178 VTMIAYAPDGGPEKRIEAARARL------IAGAWELHDARIWPLARGTNPEARTERRESF 231

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNI----------------FHNYRAETQFYFLIVIP 281
           +  S      S  E   + +F   S I                F   R    F   +  P
Sbjct: 232 EVPS------SLTEARIRDTFGEPSAIPVWDMPTYIGLLTEAGFSARRHAVWFQMELAKP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA-AA 340
           L LVAM LIAA+ ++   R  +  I V   I  GF LY +   ++  G++G  +PVA AA
Sbjct: 286 LFLVAMVLIAAAFTMRHVRFGKTGIAVLSAIMLGFALYYVRNFVQILGENG-QIPVALAA 344

Query: 341 LIPVILTISLSILILLQKEDG 361
             P + ++ L++ +LL  EDG
Sbjct: 345 WAPPVASVLLALGLLLHMEDG 365


>gi|89054304|ref|YP_509755.1| permease YjgP/YjgQ [Jannaschia sp. CCS1]
 gi|88863853|gb|ABD54730.1| permease YjgP/YjgQ [Jannaschia sp. CCS1]
          Length = 364

 Score = 82.8 bits (203), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 86/350 (24%), Positives = 153/350 (43%), Gaps = 21/350 (6%)

Query: 25  MILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQQIIPFITLVVNIVVFFNL 82
           M ++  ID+ +   ++G    +S    AVL  A   +P  I  ++P   ++  +V+F  L
Sbjct: 23  MAILLPIDMADQLRRIGSDQGFS----AVLQLALLNLPRSITGLMPLFVMLATLVLFLGL 78

Query: 83  NRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP-IATSGEKIGIDLIQQWKDN 141
            RTSELV+ RA G S  +     V+ ++++G  ++L++NP +AT+  +  + L    + +
Sbjct: 79  ARTSELVVVRAAGRSALKSAASPVIVALIIGGLSLLILNPLVATTARQYDLTLA---RLS 135

Query: 142 GDKQKSDIIP----WMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDAD 197
           G + +S  +     W++     +   I A     +     D +  T D    ++ R DA 
Sbjct: 136 GLESRSVSVTGEGFWLRQGTGSEQTVIRASATNSDGTHLFDASFFTFDADGALLERMDAR 195

Query: 198 LAIIYNDKVKLKKVVEY---QYGRIPIDKNS-TTLNIPIKMDGFQKFSEQFASRSFYEII 253
            A++      L  V  +   Q      D     TL +P  +   ++  + F +     I 
Sbjct: 196 EAVLARAAWTLTDVKRWPLAQSDNAEADAELFPTLTLPSTLTP-EQIRDSFGNPETVPIF 254

Query: 254 KKMSFSNKSNI--FHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYG 311
           +   F  + N   F   +  T F   +  PL+L AM LI A  ++  +R  +  ++V   
Sbjct: 255 ELPGFIRQLNDAGFAALQHRTWFQMQLSSPLLLAAMVLIGAGFTMRHTRFGKTGVMVLGA 314

Query: 312 IFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           I  GF +  +    +  G++G L     A  P I  I L+I  LL  EDG
Sbjct: 315 ILLGFGVVFLRRFAEVLGETGQLAASLVAWTPPIAAILLAIGFLLHTEDG 364


>gi|163739705|ref|ZP_02147113.1| permease YjgP/YjgQ [Phaeobacter gallaeciensis BS107]
 gi|163743162|ref|ZP_02150544.1| permease, YjgP/YjgQ family protein [Phaeobacter gallaeciensis 2.10]
 gi|161383579|gb|EDQ07966.1| permease, YjgP/YjgQ family protein [Phaeobacter gallaeciensis 2.10]
 gi|161386935|gb|EDQ11296.1| permease YjgP/YjgQ [Phaeobacter gallaeciensis BS107]
          Length = 367

 Score = 80.1 bits (196), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 160/353 (45%), Gaps = 24/353 (6%)

Query: 25  MILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLIIQQIIPFITLVVNIVVFFNL 82
           + LV +IDLNE   Q+       +S G +   T    P  + + +P I ++  IV+F  L
Sbjct: 23  LTLVMLIDLNE---QIRRFEAQDLSLGQLFGLTLLNTPAALSEFLPLIMILTTIVLFIGL 79

Query: 83  NRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNG 142
            R+SELV++RAIG S  + L   V+ + L+G+  V  +NPI  +      DL + +++ G
Sbjct: 80  ARSSELVVTRAIGRSGIRALAAPVLLAALIGVLAVSTLNPIVAATSNRYRDLAETYRNGG 139

Query: 143 DKQKSDIIP--WMQISNPQQDIFIGAKKILPENH--IWEDFTSITIDKKNKIIHRKDADL 198
               S      W++    Q    I A     +       D T ++   + + I +  A+ 
Sbjct: 140 PAALSLTGEGLWLRQGGAQGQSVIHATGYSGDTDDITLYDVTILSYGPEGRPIRQTLAEE 199

Query: 199 AII-YNDKVKLK-KVVEYQYGRIP---IDKNST-TLNIPIKMDGFQKFSEQFASRSFYEI 252
           A +   D V +K KV     G  P    +++ST  L+  +  +  +         S Y++
Sbjct: 200 AALDGGDWVLIKAKVWPLIVGVNPETNAERHSTLRLSTTLTSERIRDTLGTATGISVYDL 259

Query: 253 ---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVA 309
              I+++S +     F   R E      +  PL L+AM L+ A+ ++  +R     + V 
Sbjct: 260 PATIRELSEAG----FSTKRYEVWLQVELARPLFLIAMALVGAAFTMRHARFGGTGLAVL 315

Query: 310 YGIFSGFMLYTIITIMKSFGKSGILLPVA-AALIPVILTISLSILILLQKEDG 361
             +  GF LY +    +  G++G  +PVA A   P +  I L++ +LL  EDG
Sbjct: 316 TAVLLGFGLYFLRNFAQILGENG-QIPVALAGWAPPVAAILLTMGLLLHAEDG 367


>gi|126462313|ref|YP_001043427.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103977|gb|ABN76655.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17029]
          Length = 364

 Score = 80.1 bits (196), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 88/374 (23%), Positives = 158/374 (42%), Gaps = 27/374 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSIS--RGAVLAATRVPL 61
           IL RY  + +L+      L    L+ +ID   + +QM    +  I+  +  +L+  RVP 
Sbjct: 2   ILSRYIARRFLRMVFIVFLAFFGLMMLID---VLDQMRRFSDEGITLVQAGLLSLLRVPA 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            +  I+P I ++  + +F  L R+SELV+ RA G S  + L   +V ++ LG   V V+N
Sbjct: 59  TLYTILPLIVILAAVALFLGLARSSELVVVRAAGRSGLRFLVAPMVVALALGTVAVTVLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIP---WMQISNPQQDIFIGAKKILPENHIWED 178
           PI  +G     D        G+     I     W++     +   I A +   +      
Sbjct: 119 PI-VAGTSRQYDAAAGRLARGEASILSISKEGLWLRQGGSGEQTVIHALRSNTDGTRLYA 177

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI-PIDKNSTTLNIPI----K 233
            T +T D + +   R  A+ A +     +L     +      P  + S   N+ +     
Sbjct: 178 VTFLTFDAEGRPTGRIAAEQAALERGYWQLSGAKSWDLTEANPEARASLPGNLRVTSELT 237

Query: 234 MDGFQKFSEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
            +G Q      ++   +E+      +++  FS +      +R   Q  F   +P  L AM
Sbjct: 238 REGIQDSFGDPSAIPIWELPAYVAGLERAGFSAR-----KHRVWMQMEF--ALPATLAAM 290

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
            L+AA  ++  SR      +V   +  GF L+ +    +  G++G +  + AA  P ++ 
Sbjct: 291 VLVAAGFTMRHSRFGGTGRMVLLALLGGFSLFFLRNFAQVLGENGQIPILLAAWSPPLIG 350

Query: 348 ISLSILILLQKEDG 361
           +  S+ +LL  EDG
Sbjct: 351 VMGSLGLLLHLEDG 364


>gi|146277167|ref|YP_001167326.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555408|gb|ABP70021.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 364

 Score = 79.3 bits (194), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 155/371 (41%), Gaps = 21/371 (5%)

Query: 4   ILWRYFFKYYLKTTLYFLL---GAMILVFVIDLNEIQNQMGELPNYSIS--RGAVLAATR 58
           IL RY  + +L+      L   G M+L+ V+D      QM    +  I+  +  +L+  R
Sbjct: 2   ILSRYIARRFLRMVFIVFLVFFGLMMLIDVLD------QMRRFSDEGITLVQAGLLSLLR 55

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           VP  I  I+P I ++  + +F  L RTSELV+ RA G S  + L   ++ ++ +G   V 
Sbjct: 56  VPATIYTILPLIVILAAVALFLGLARTSELVVVRAAGRSGLRFLVAPMIVALAIGAAAVT 115

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP---WMQISNPQQDIFIGAKKILPENHI 175
           V+NPI  +G     D        G+     I     W++    +    I A +   +   
Sbjct: 116 VLNPI-VAGTSRQYDAAASRLARGEASILSISEEGLWLRQGGAEGQTVIHAARSNTDGTR 174

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI-PIDKNSTTLNIPIKM 234
               T +T D       R  A+ A +     +L     +      P    +   NI +  
Sbjct: 175 LYAVTFLTFDGNGLPRSRVAAEQAALETGYWQLSGAKSWDLTLANPEASANLEGNIRVPS 234

Query: 235 D----GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
           D    G Q      ++   +E+   ++   ++  F   +        + +P ML AM L+
Sbjct: 235 DLTREGIQDSFGDPSAIPIWELPAYVAGLERAG-FSARKHRVWMQMELALPFMLAAMVLV 293

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISL 350
           AA  ++  SR      +V   + SGF L+ +    +  G++G +  + AA  P ++ +  
Sbjct: 294 AAGFTMRHSRFGGTGRMVLLALLSGFGLFFLRNFAQVLGENGQIPILLAAWSPPLIGVMG 353

Query: 351 SILILLQKEDG 361
           S+ +LL  EDG
Sbjct: 354 SLGLLLHLEDG 364


>gi|304321347|ref|YP_003854990.1| putative permease [Parvularcula bermudensis HTCC2503]
 gi|303300249|gb|ADM09848.1| predicted permease [Parvularcula bermudensis HTCC2503]
          Length = 364

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/344 (20%), Positives = 151/344 (43%), Gaps = 12/344 (3%)

Query: 26  ILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRT 85
           ++V  +DL E    +  +P         L   R P +I  + PFI L   +  +  + R 
Sbjct: 25  LIVVSVDLIEAMRDIARIPGAGPIAALRLTLLRTPQLILSLSPFIFLFGTLWAYGQMARM 84

Query: 86  SELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQ 145
           SE+ + RA G+S+W+L+ P V+ ++  G+     ++P+A    +    +  + +   +  
Sbjct: 85  SEIAVLRAAGLSVWRLIFPPVILAVAAGLLIATTLDPLAARLAETAQTVKNEARSGEEAA 144

Query: 146 KSDIIPWMQISNPQQD--IFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYN 203
                 W++ +    D    + A++    + + E+ T     +    I R DA  A+I  
Sbjct: 145 AKRPHLWLRQNEIGSDGIALLHAERYRENDPVLEEVTVWRRTQDGAFIERLDAPRALIDA 204

Query: 204 DKVKLKKVVEYQYGRIPIDKNSTTLNIPIK-----MDGFQKFSEQFASRSFYEIIKKMSF 258
             ++L +            +    + +P+      +D  ++ ++  +  +  E I+ M  
Sbjct: 205 QVLRLMQARRSTSIATTAPQIEAEIEVPVAIDLRLLDQDRQTADTLSVWALPETIRLMGD 264

Query: 259 SNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF-SRSNQPRIIVAYGIFSGFM 317
           +  +      R    ++ L  +PL L AM ++A + +L   +R     +++  GI +GF+
Sbjct: 265 AGMTTTKFRLR----YHALWSLPLKLAAMVILACAFALGMNARGGGTALLMGMGILAGFL 320

Query: 318 LYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           L+ +  +  +  ++ I+    AA  P +L +  ++ +LL +EDG
Sbjct: 321 LFILSELSAAIAEAAIVPVGLAAWAPALLAVLFAVTLLLYREDG 364


>gi|77463458|ref|YP_352962.1| putative permease [Rhodobacter sphaeroides 2.4.1]
 gi|221639316|ref|YP_002525578.1| permease Yjgp/YjgQ family protein [Rhodobacter sphaeroides KD131]
 gi|332558335|ref|ZP_08412657.1| Permease YjgP/YjgQ family protein precursor [Rhodobacter
           sphaeroides WS8N]
 gi|77387876|gb|ABA79061.1| putative permease [Rhodobacter sphaeroides 2.4.1]
 gi|221160097|gb|ACM01077.1| Permease YjgP/YjgQ family protein precursor [Rhodobacter
           sphaeroides KD131]
 gi|332276047|gb|EGJ21362.1| Permease YjgP/YjgQ family protein precursor [Rhodobacter
           sphaeroides WS8N]
          Length = 364

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 89/375 (23%), Positives = 159/375 (42%), Gaps = 29/375 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSIS--RGAVLAATRVPL 61
           IL RY  + +L+      L    L+ +ID   + +QM    +  I+  +  +L+  RVP 
Sbjct: 2   ILSRYIARRFLRMVFIVFLAFFGLMMLID---VLDQMRRFSDEGITLVQAGLLSLLRVPA 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQ-LLNPFVVGSILLGIFTVLVI 120
            +  I+P I ++  + +F  L R+SELV+ RA G S  + L+ P VV ++ LG   V V+
Sbjct: 59  TLYTILPLIVILAAVALFLGLARSSELVVVRAAGRSGLRFLVAPMVV-ALALGTVAVTVL 117

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIP---WMQISNPQQDIFIGAKKILPENHIWE 177
           NPI  +G     D        G+     I     W++     +   I A +   +     
Sbjct: 118 NPI-VAGTSRQYDAAAGRLARGEASILSISKEGLWLRQGGSGEQTVIHALRSNTDGTRLY 176

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI-PIDKNSTTLNIPI---- 232
             T +T D + +   R  A+ A +     +L     +      P  +     N+ +    
Sbjct: 177 AVTFLTFDAEGRPTGRIAAEQAALERGYWQLSGAKSWDLTEANPEARAGLPGNLRVTSEL 236

Query: 233 KMDGFQKFSEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
             +G Q      ++   +E+      +++  FS +      +R   Q  F   +P  L A
Sbjct: 237 TREGIQDSFGDPSAIPIWELPAYVAGLERAGFSAR-----KHRVWMQMEF--ALPATLAA 289

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
           M L+AA  ++  SR      +V   +  GF L+ +    +  G++G +  + AA  P ++
Sbjct: 290 MVLVAAGFTMRHSRFGGTGRMVLLALLGGFSLFFLRNFAQVLGENGQIPILLAAWSPPLI 349

Query: 347 TISLSILILLQKEDG 361
            +  S+ +LL  EDG
Sbjct: 350 GVMGSLGLLLHLEDG 364


>gi|255263663|ref|ZP_05343005.1| permease YjgP/YjgQ family protein [Thalassiobium sp. R2A62]
 gi|255105998|gb|EET48672.1| permease YjgP/YjgQ family protein [Thalassiobium sp. R2A62]
          Length = 363

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/375 (23%), Positives = 161/375 (42%), Gaps = 30/375 (8%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVI-DLNEIQNQMGELPNYSISRGAVLAAT--RVP 60
           IL RYF + +    L FL G  ++ F I    ++  Q+G+     +S    +  T    P
Sbjct: 2   ILHRYFARRFF---LAFL-GVFVIFFAILGFLDMVEQLGKFSGDDVSFTQTVGLTLLNTP 57

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             + +I+P + ++  I +F +L R+SE+V++RA G S  + L+  +  ++L+G+F V V+
Sbjct: 58  QALYRILPLVMILSTIALFLSLARSSEMVVTRAAGRSAIRALSAPIFVAVLIGLFAVAVL 117

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIP---------WMQISNPQQDIFIGAKKILP 171
           NPI  +         Q+++      +SD            W++  +  Q   I A+    
Sbjct: 118 NPIVAATS-------QEYEKRASDYRSDDAQVLSVSAEGLWLRQGDNTQQTVIRAEAATL 170

Query: 172 ENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST---TL 228
           E       T ++      I  R +AD A +     +L     +       + +ST    L
Sbjct: 171 EGTELSRVTFLSFTDAGPIT-RIEADSARLTPGAWELTNAKSWPLDAPNPEASSTKHDVL 229

Query: 229 NIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNK--SNIFHNYRAETQFYFLIVIPLMLVA 286
            +P  +   Q   + F + S   I +  +F  +  +  F   R    F   + +P  +V+
Sbjct: 230 RVPSTLTRDQ-IRDGFGTPSAIPIWELPAFIKQLETAGFSARRHAVWFNMELALPAFMVS 288

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
           M ++AA +++   R  +  + V   I  GF  Y +    +  G++G +    AA      
Sbjct: 289 MVMVAAGLTMRHQRGGRVGLSVLAAIMLGFAFYFLRNFAQILGENGQISATLAAWATPAA 348

Query: 347 TISLSILILLQKEDG 361
            I L++ +LL  EDG
Sbjct: 349 AICLALGMLLHLEDG 363


>gi|83942393|ref|ZP_00954854.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. EE-36]
 gi|83846486|gb|EAP84362.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. EE-36]
          Length = 365

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 88/376 (23%), Positives = 163/376 (43%), Gaps = 30/376 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPL 61
           IL  YF + ++   + F+L + +L  ++ L ++ +Q     +Y I    +   T    P 
Sbjct: 2   ILHLYFARRFI---MGFILISAVLFSLLVLVDMVDQARRFSSYDIGWLRLFGMTLLNTPE 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            +  I+P I ++  +V+F +L R+SELV++RA G S    L   +  + ++G+  V ++N
Sbjct: 59  TMNLILPLIMILATVVLFLSLARSSELVVTRAAGRSALSALQAPIWVAFIIGVMAVGMLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           PI  +  K  I L    +  G      SD   W++  + +    I A +   +  +  D 
Sbjct: 119 PIVAATAKRYIQLSDSIRAGGTSVLSVSDEGLWLRQGSDEGQTVIRAWRSNKDASVLYDV 178

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T ++   +     R +AD A + N    L     +     P++            D    
Sbjct: 179 TFLSYAPEGGPARRIEADSAALENGIWTLTDAKSW-----PLEVGVNAEGAAETFDTLTL 233

Query: 240 FSEQFASR-----------SFYEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
            S     R           S Y++   IK++  +  S   H    +T+    +  P  LV
Sbjct: 234 PSTLTLDRIRDSITDPGAVSIYDLPDYIKQLELAGFSPRRHKVWLQTE----LARPFFLV 289

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
           AM L+A++ ++  +R     + V   +  GF LY I +  +  G++G +  + AA  P +
Sbjct: 290 AMVLVASAFTMRHTRFGGTGVAVLASVLMGFGLYFIRSFAQILGENGQIPVLLAAWAPPV 349

Query: 346 LTISLSILILLQKEDG 361
            +I L++ +LL  EDG
Sbjct: 350 ASILLALGLLLHSEDG 365


>gi|83953613|ref|ZP_00962334.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. NAS-14.1]
 gi|83841558|gb|EAP80727.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. NAS-14.1]
          Length = 365

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 165/376 (43%), Gaps = 30/376 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPL 61
           IL  YF + ++   + F+L + +L  ++ L ++ +Q     +Y I    +   T  + P 
Sbjct: 2   ILHLYFARRFI---MGFILISAVLFSLLVLVDMVDQARRFSSYDIGWLRLFGMTLLKTPE 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            +  I+P I ++  +V+F +L R+SELV++RA G S    L   +  + ++G+  V ++N
Sbjct: 59  TMNLILPLIMILATVVLFLSLARSSELVVTRAAGRSALSALQAPIWVAFIIGVMAVGMLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           PI  +  K  I L    +  G      SD   W++  + +    I A +   +  +  D 
Sbjct: 119 PIVAATAKRYIQLSDSIRAGGTSVLSVSDEGLWLRQGSDEGQTVIRAWRSNKDASVLYDV 178

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T ++   ++    R +AD A + +    L     +     P++            D    
Sbjct: 179 TFLSYAPESGPARRIEADSAALEDGIWTLTDAKSW-----PLEVGVNAEGAAETFDTLTL 233

Query: 240 FSEQFASR-----------SFYEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
            S     R           S Y++   IK++  +  S   H    +T+    +  P  LV
Sbjct: 234 PSTLTLDRIRDSITDPGAVSIYDLPDYIKQLELAGFSPRRHKVWLQTE----LARPFFLV 289

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
           AM L+A++ ++  +R     + V   +  GF LY I +  +  G++G +  + AA  P +
Sbjct: 290 AMVLVASAFTMRHTRFGGTGVAVLASVLMGFGLYFIRSFAQILGENGQIPVLLAAWAPPV 349

Query: 346 LTISLSILILLQKEDG 361
            +I L++ +LL  EDG
Sbjct: 350 ASILLALGLLLHSEDG 365


>gi|254453977|ref|ZP_05067414.1| permease, YjgP/YjgQ family [Octadecabacter antarcticus 238]
 gi|198268383|gb|EDY92653.1| permease, YjgP/YjgQ family [Octadecabacter antarcticus 238]
          Length = 362

 Score = 76.3 bits (186), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 161/371 (43%), Gaps = 27/371 (7%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYF + +  T      G  +L+ +IDL E   + G   + S+     L+   +P  I  I
Sbjct: 3   RYFARRFAWTFAATFGGFFVLMLLIDLVEQLRRYGG--DASLGDMFQLSLLNLPTGIYAI 60

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINPIAT 125
           +P I ++  +  F  L R+SEL+++RA G S +  L+ P +V ++++G   + V+NP+  
Sbjct: 61  LPLIMVLATVTTFLGLARSSELIVTRAAGRSALNALIAPLIV-TLIIGAIAIGVLNPLVA 119

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIP---------WMQISNPQQDIFIGAKKILPENHIW 176
           +        +++++   +  +SD            W++  +      I A +   +    
Sbjct: 120 A-------TLKEYEARENALRSDGPSVLAISENGLWLRQGDDNSQTVIRAGRANLDGTQL 172

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEY--QYGRIP--IDKNSTTLNIPI 232
           +D T IT         R +A  A +     +L +   +    GR+   +    TTL IP 
Sbjct: 173 QDVTFITFPPTGGPTRRIEAASANLTQGAWELSEAKAWPLNSGRVAESVATTHTTLRIPS 232

Query: 233 KMDGFQKFSEQFASRSFYEIIKKMSFSNKSNI--FHNYRAETQFYFLIVIPLMLVAMTLI 290
            +   Q   + F   S   I +  +F ++  +  F   R +  F   +  P  L+AM LI
Sbjct: 233 TLTADQ-IRDSFGVPSSIPIWELPAFIDRLEVAGFSAARHQVWFQMELAQPAFLLAMVLI 291

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISL 350
            A  ++   R  +  ++V   I   F L+ +    +  G++G +    AA  P +  I+ 
Sbjct: 292 GAGFTMRHQRGGRTGVMVLTAILICFALFFLRNFAQILGENGQISAGLAAWAPPLAAIAA 351

Query: 351 SILILLQKEDG 361
           S+ +LL  EDG
Sbjct: 352 SLGLLLHLEDG 362


>gi|85706341|ref|ZP_01037435.1| permease, YjgP/YjgQ family protein [Roseovarius sp. 217]
 gi|85669114|gb|EAQ23981.1| permease, YjgP/YjgQ family protein [Roseovarius sp. 217]
          Length = 363

 Score = 75.9 bits (185), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 163/366 (44%), Gaps = 12/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +  +   FL   + LV ++ L ++ +++G+ P  +  +   +   ++P   
Sbjct: 2   ILERYFGRRFFMS---FLGVTVTLVVMLGLIDLMDELGDFPELAFGQVLGIVLLKLPEAY 58

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +IIP + ++ ++ +F  L RTSELV+ RA G S  Q L      ++ +G+  + V NP+
Sbjct: 59  YEIIPLVMILASVALFLRLARTSELVVLRASGRSALQGLLAPAAVALAIGLLGLAVGNPL 118

Query: 124 ATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL+  +  + + D   +    W++ S  +    I A +   +       + 
Sbjct: 119 VAATSKRHHDLVNSYSGQASSDLAIASEGLWLRQSAAEGQTVIYAARASSDLGTLYAPSF 178

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKL--KKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ- 238
                  K + R  A  A +      L   K+ +   G  P         + +  D  Q 
Sbjct: 179 YDFAPDGKPLRRISATSAQLEEGAWVLTEAKIWDLAQGVNPEASAREDAQMTVPSDLTQD 238

Query: 239 KFSEQFASRSF---YEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
           +  + F S  +   +E+ K ++   ++  F   R    F   +  P+ LVA+ LI+A+ +
Sbjct: 239 RILDSFGSPEYVPIWELPKFIAQLEEAG-FSARRYAIWFQSELAQPVFLVALVLISAAFT 297

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           ++ +R     + V   +  GF L+ I    +  G++G +  + AA  P + ++ + + IL
Sbjct: 298 MQHTRGANVGLSVLTAVLLGFGLHYIRNFAQILGENGQIPILLAAWAPPVASLFIGLGIL 357

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 358 LHLEDG 363


>gi|254477617|ref|ZP_05091003.1| permease YjgP/YjgQ [Ruegeria sp. R11]
 gi|214031860|gb|EEB72695.1| permease YjgP/YjgQ [Ruegeria sp. R11]
          Length = 367

 Score = 75.9 bits (185), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 93/356 (26%), Positives = 155/356 (43%), Gaps = 30/356 (8%)

Query: 25  MILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLIIQQIIPFITLVVNIVVFFNL 82
           + LV +IDLNE   Q+       +S G +   T    P  + + +P I ++  IV+F  L
Sbjct: 23  LTLVMLIDLNE---QIRRFDAQDLSFGQLFGLTLLNAPAALSEFLPLIMILTTIVLFVGL 79

Query: 83  NRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNG 142
            R+SELV++RAIG S  + L   VV +  +G+  V  +NPI  +      DL + +++ G
Sbjct: 80  ARSSELVVTRAIGRSGIRALAAPVVLAAFIGLLAVSTLNPIVAATSNHYRDLAETYRNGG 139

Query: 143 DKQKSDIIP--WMQISNPQQDIFIGAKKILPENHIWEDFT--SITI---DKKNKIIHRKD 195
               S      W++    Q    I AK    +    ED T   +TI     + + I +  
Sbjct: 140 PAALSLTGEGLWLRQGGAQGQSVIHAKGYSGDV---EDVTLLGVTILSYGPEGRPIRQTV 196

Query: 196 ADLAIIYNDKVKL--KKVVEYQYGRIP----IDKNSTTLNIPIKMDGFQKFSEQFASRSF 249
           A  A +      L   KV     G  P     +  S  L+  +  +  +         S 
Sbjct: 197 ARSATLDGSDWVLTNAKVWPLVTGVNPETNATEHASLRLSTTLTSERIRDTLGTATGISV 256

Query: 250 YEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRI 306
           Y++   I++++ +     F   R E      +  PL L+AM L+ A+ ++  +R     +
Sbjct: 257 YDLPATIRELAEAG----FSTKRYEVWLQVELARPLFLIAMVLVGAAFTMRHARFGGTGL 312

Query: 307 IVAYGIFSGFMLYTIITIMKSFGKSGILLPVA-AALIPVILTISLSILILLQKEDG 361
            V   +  GF LY +    +  G++G  +PVA A   P +  I L++ +LL  EDG
Sbjct: 313 AVLMAVLLGFGLYFLRNFAQILGENG-QIPVALAGWAPPVAAILLTMGLLLHAEDG 367


>gi|260576762|ref|ZP_05844747.1| permease YjgP/YjgQ family protein [Rhodobacter sp. SW2]
 gi|259021014|gb|EEW24325.1| permease YjgP/YjgQ family protein [Rhodobacter sp. SW2]
          Length = 364

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 83/373 (22%), Positives = 161/373 (43%), Gaps = 37/373 (9%)

Query: 12  YYLKTTLYFLLG-----AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           Y  +  ++ LLG     A IL+ +  L++++   G+    S+ +  +LAA  +P  + +I
Sbjct: 6   YIARRFVWLLLGIILGFATILLLIDSLDQLRRLSGQ--GISLGQATLLAAMNMPSSLYRI 63

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +P + ++  I +F  L R+SELV+ RA G S  + L   V+ ++L G   V V+NP+  +
Sbjct: 64  LPLLMILAAITLFMGLARSSELVVVRASGRSGLRFLATPVLAALLFGAVAVAVLNPLVAA 123

Query: 127 GEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
             K    L+ ++  +G+   S  D   W++   P     I A +   +       T ++ 
Sbjct: 124 TLKRYDTLLSKYAQDGESVLSINDDGLWLRQGGPDGQTVIHAARANADGTELFSVTFLSF 183

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPID----------KNSTTLNIPIKM 234
           D       R +A  A + +    L     +     P++          +  T L   +  
Sbjct: 184 DAAGLPSARTEAREARLGDGAWALVDAKTW-----PLNLANPEASAARETGTRLPSDLTR 238

Query: 235 DGFQKFSEQFASRSFYEI------IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMT 288
           D  +      A+ S + +      +++  FS +S   H    +T+    +++     AM 
Sbjct: 239 DAIRDSFGTPAAISIWNLPSYIAGLERAGFSARS---HRVWLQTELALPLLL----AAMV 291

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTI 348
           LIAA  ++  +RS +    V   +  GF ++ +    +  G++G +    AA  P    +
Sbjct: 292 LIAAGFTMRPTRSGKTGTYVLLALLGGFGIFFLRNFAQVLGENGQIPIAMAAWSPPAAAV 351

Query: 349 SLSILILLQKEDG 361
             ++ +LL  EDG
Sbjct: 352 LFAVGLLLHLEDG 364


>gi|294084201|ref|YP_003550959.1| permease YjgP/YjgQ [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663774|gb|ADE38875.1| permease YjgP/YjgQ [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 368

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 7/131 (5%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMG----ELPNYSISRGAVLAATR 58
           G L+RYF  YY +  L  L G  +++ VI   E+  Q      ++   S+S   VLA   
Sbjct: 8   GTLFRYFAFYYTRWILLCLFGLTVIISVIQSVELMRQKSVNKSDVEEISVS---VLAMLN 64

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P II+ I+PF  L+  ++ F   N+++E V++R  G SIW  L+P +V ++ +G+  V+
Sbjct: 65  LPNIIEVILPFAVLIGTMLCFHAWNKSNEFVVTRGFGQSIWVSLSPVLVSALAIGVLFVM 124

Query: 119 VINPIATSGEK 129
           VINPI     K
Sbjct: 125 VINPIGAVTSK 135


>gi|126739400|ref|ZP_01755093.1| permease, YjgP/YjgQ family protein [Roseobacter sp. SK209-2-6]
 gi|126719500|gb|EBA16209.1| permease, YjgP/YjgQ family protein [Roseobacter sp. SK209-2-6]
          Length = 367

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 97/377 (25%), Positives = 163/377 (43%), Gaps = 40/377 (10%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLIIQ 64
           R F +++L  T       M LV +IDL+E   Q+     + +S G +L  T    P  + 
Sbjct: 9   RRFAQWFLVITGVL----MTLVVLIDLSE---QIRRFDAFDLSAGQILGLTLLNAPAAMN 61

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           + +P I ++  IV+F  L R+SELV++RAIG S  + L   V+ + L+G+  V  +NPI 
Sbjct: 62  EFLPLIMILTTIVLFVGLARSSELVVTRAIGRSGIRALAAPVLVAALIGVLAVSTLNPIV 121

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIP--WMQISNP--QQDIFIGAKKILPENHIWEDFT 180
            +       L   ++  G    S      W++  +P  Q  +         E  I  D T
Sbjct: 122 AATTNRYKSLSDSYRTGGPSVLSLTGEGLWLRQGSPSGQSVVHAAGYGGGREEIILYDVT 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLK---------------KVVEYQYGRIPIDKNS 225
            +T  K +    R  A  A +      L+                  E+Q  RIP     
Sbjct: 182 ILTYGKDSGPRTRTQARSARLEGSDWVLQDAKVWPLSAWTNPEISAGEHQELRIP--TTL 239

Query: 226 TTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
           T   I  ++D     S+  +     + I++++ +     F   + E  +   +  P  L+
Sbjct: 240 TQDRIRDRLDA----SDGISIYDLPQTIRELAEAG----FATKKHEVWYQVELARPFFLI 291

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA-AALIPV 344
           AM L+ A+ ++  +R     + V   +  GF LY I    +  G++G  +PVA AA  P 
Sbjct: 292 AMVLVGAAFTMRHTRFGGTGMAVLTAVLLGFGLYFIRNFAQILGENG-EIPVALAAWAPP 350

Query: 345 ILTISLSILILLQKEDG 361
           + +I L++ +LL  EDG
Sbjct: 351 VASILLTLGLLLHAEDG 367


>gi|99080789|ref|YP_612943.1| permease YjgP/YjgQ [Ruegeria sp. TM1040]
 gi|99037069|gb|ABF63681.1| permease YjgP/YjgQ [Ruegeria sp. TM1040]
          Length = 368

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 88/370 (23%), Positives = 160/370 (43%), Gaps = 23/370 (6%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLIIQQ 65
           Y+ + +L+   +F++ A +L+ ++ L ++  Q        +  G +L  T    P    +
Sbjct: 6   YYARRFLQ---WFMVIAAVLMSLVMLIDLSEQFRRFDAQDLRFGQLLELTLLNAPAAFSE 62

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT 125
            +P I ++  IV+F  + R+SELV++RAIG S  + L P VV +++LG   V  +NPI  
Sbjct: 63  FLPLIMILTTIVLFVGMARSSELVVTRAIGRSGIRALVPPVVVALVLGGLAVSTLNPIVA 122

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIP---WMQIS--NPQQDIFIGAKKILPENHIWEDFT 180
           +       L + ++  G      +     W++    N Q  I     +   EN    D +
Sbjct: 123 ATTNRFETLSESYRQTGGPAAVSLSGEGLWLRQGGQNGQSVIHAANYRGDAENLYLYDVS 182

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ--YGRIP--IDKNSTTLNIPIKMDG 236
            +T         R  A  A +  D   L+    +Q   G  P    K    L +P  +  
Sbjct: 183 ILTYAPDGGPTRRTVAAEARLEGDDWVLRDAKVWQLILGVNPERSAKRYDELRLPTTLTN 242

Query: 237 FQ-----KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
            +      ++E  +     + I+ +S +     F   R +      +  PL LVAM L+ 
Sbjct: 243 ERIRDTLGYAEGISIYDLPQTIQSLSEAG----FSTTRFQVWLQVELARPLFLVAMVLVG 298

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLS 351
           A+ ++  +R     + V   +  GF LY +    +  G++G +  + AA  P + +I L+
Sbjct: 299 AAFTMRHTRLGGTGVAVLTSVLLGFALYFVHNFARILGENGQIPILLAAWAPPVASILLT 358

Query: 352 ILILLQKEDG 361
           + +LL  EDG
Sbjct: 359 MGLLLHAEDG 368


>gi|149914657|ref|ZP_01903187.1| permease, YjgP/YjgQ family protein [Roseobacter sp. AzwK-3b]
 gi|149811450|gb|EDM71285.1| permease, YjgP/YjgQ family protein [Roseobacter sp. AzwK-3b]
          Length = 363

 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 165/371 (44%), Gaps = 30/371 (8%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  + +L T L      +IL+F+ID   I  +M + P +  S    +A  + P    +I+
Sbjct: 6   YLARRFLLTFLAIFSVFVILLFLID---IVKEMQDFPAFPFSEILEIALLKAPSANYEIL 62

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINPIATS 126
           P I ++  + +F  ++R SELV+ RA G S I  L+ P VV   L+G+ +V ++NPI  +
Sbjct: 63  PLIVILATVALFLRMSRNSELVVVRASGRSAIRALVAPLVVAG-LIGVVSVTMLNPIVAA 121

Query: 127 GEKIGIDLIQQ---WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             K   DL+     W  N      + + W++  +      I A++   +     + T I 
Sbjct: 122 SAKRHNDLMNSYLGWSINIMAIAPEGL-WLRQGSETGQTVIHAERASSDVSTLYNTTFIA 180

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKL--KKVVEYQYGRIPIDKNST-----TLNIPIKM-- 234
                    R  A  A + + + +L   K+ +   G   I+  ST     + ++P  +  
Sbjct: 181 FGLDGTPQRRITAASATLGDGEWRLADAKLWDLSSG---INPESTAQELDSYSVPSALTQ 237

Query: 235 ----DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
               D F K  E  +     + I ++  S  S   +    +T+    +  PL L+A+ + 
Sbjct: 238 DRIIDSFGK-PEYISIWDLPKFIGQLEESGFSARRYAVWMQTE----LARPLFLIALVMA 292

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISL 350
           AA+ ++  SR +   + V   I  GF L+ I    +  G++G +  + AA  P +    L
Sbjct: 293 AAAFTMRHSRLHNTGVSVLTAIMLGFGLHYIRNFAQILGENGQIPIMLAAWAPPVAAFLL 352

Query: 351 SILILLQKEDG 361
           ++ ILL  E+G
Sbjct: 353 ALGILLHMEEG 363


>gi|167646491|ref|YP_001684154.1| permease YjgP/YjgQ family protein [Caulobacter sp. K31]
 gi|167348921|gb|ABZ71656.1| permease YjgP/YjgQ family protein [Caulobacter sp. K31]
          Length = 367

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 152/373 (40%), Gaps = 36/373 (9%)

Query: 11  KYYLKTTLYFLLGAM----ILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           +Y LK TL  L  A+    +LV +I   +I   +G            L   + P  I  +
Sbjct: 9   RYVLKKTLGSLAAALAVVSVLVMLIAFVDISKSVGTRAEVGFGELLFLTVLQAPATILLL 68

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG--------IFTVL 118
            PFI L   +  F  LNR SEL+  RA G+S W+ + P  V + ++G          T  
Sbjct: 69  TPFIFLFGTLGAFVGLNRRSELIAMRAAGVSAWRFIMPAAVAAFVMGLLTLTLLNPLTAA 128

Query: 119 VINPIATSGEKIGIDLIQQ-----WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
           +     TS   +  + ++      W   GD  K+ ++    I    +D   GA ++    
Sbjct: 129 MSAQFETSRNAMMENYLKSAPKGLWLRQGD-DKTQVV----IRARARDQINGAVRL---R 180

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
            +     ++  +   +   R +AD A +     +L  V     G   I   S T  +P  
Sbjct: 181 GVSLFVYAVQPNGALQFSQRIEADEARLEPGFWQLSGVRVAMPGAGAI--RSETYTLPSN 238

Query: 234 MD---GFQKFS--EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMT 288
           +D     ++FS  +  A     E IK+   +  S+I    R +     ++  PL+  AM+
Sbjct: 239 LDDRTASERFSNPQAIAVWRLPETIKRTEAAGFSSIPFRLRLQQ----VLATPLLFAAMS 294

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTI 348
           ++AA+ SL   R      +   G+  GF  +    +  + GK+ +L P  AA  P I+ +
Sbjct: 295 VLAAAFSLRLMRLGGLAGLAGAGVTLGFAFFFFNELCGALGKADVLTPAMAAWTPPIVAL 354

Query: 349 SLSILILLQKEDG 361
              + +L   EDG
Sbjct: 355 LAGLTLLCYTEDG 367


>gi|260433487|ref|ZP_05787458.1| permease, YjgP/YjgQ family [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417315|gb|EEX10574.1| permease, YjgP/YjgQ family [Silicibacter lacuscaerulensis ITI-1157]
          Length = 366

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 94/375 (25%), Positives = 160/375 (42%), Gaps = 27/375 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGA--MILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPL 61
           IL RYF + +L++  + ++GA  + L+ +IDL E   + G+  + S  +   L     P 
Sbjct: 2   ILDRYFARRFLQS--FVVIGAIFLTLMILIDLIEQVRRFGD-ADLSFGQLLQLTLLNTPA 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
            I +++P + ++  I +F  L R+SELV++RAIG S  + L   V  ++ +G   V ++N
Sbjct: 59  AISEMLPLLMILSTIALFVGLARSSELVVTRAIGRSGIRALAAPVALALGIGALAVALLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKS---DIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           PIA +  +    L  Q+++ G    S   D +   Q S   Q +   A     +     D
Sbjct: 119 PIAAATSEKYETLSDQYRNGGSSTLSLSRDGLWLRQGSKDGQSVIHAAGTENGDTLKLID 178

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIP----IDKNSTTLNIPIKM 234
            T IT   +     +  A  A + + +  L+ V ++   R            TL +P  +
Sbjct: 179 VTIITFSPQGIPTRQIIAQSAELLDGQWLLRGVKDWSLSRAANPEFFSSEYDTLALPTTL 238

Query: 235 D--------GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
                    G Q     +        + +  FS K       + E      +  P  LV+
Sbjct: 239 TRERILDRLGHQGLVSIYDLPQLIRDLAQAGFSTK-------QYEVWLQAQLARPFFLVS 291

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
           M LI A+ ++   R     I V   +  GF +Y +    +  G++G L  + AA  P   
Sbjct: 292 MVLIGAAFTMRHVRFGGTGIAVLTAVLLGFAIYFVRNFAQILGENGQLPVMLAAWAPPFA 351

Query: 347 TISLSILILLQKEDG 361
            I LS+ +LL  EDG
Sbjct: 352 AILLSLGLLLHAEDG 366


>gi|254467255|ref|ZP_05080666.1| permease YjgP/YjgQ [Rhodobacterales bacterium Y4I]
 gi|206688163|gb|EDZ48645.1| permease YjgP/YjgQ [Rhodobacterales bacterium Y4I]
          Length = 367

 Score = 72.8 bits (177), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 87/345 (25%), Positives = 149/345 (43%), Gaps = 32/345 (9%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y+ + +L+  L      M LV +IDLNE Q +  E     + +   L+   +P  + + +
Sbjct: 6   YYARRFLQWFLVICAVLMTLVILIDLNE-QIRRFEGAGLGLPQLVGLSLLNIPAALSEFL 64

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           P I ++  IV+F  L R+SELV++RAIG S  + L   V+ +  +G+  V ++NPIA + 
Sbjct: 65  PLIMILTTIVLFVGLARSSELVVTRAIGRSGIRALAAPVLAAAGIGVLAVTMLNPIAAAT 124

Query: 128 EKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT----- 180
                DL + + + G      S    W++    +    I AK    +     D T     
Sbjct: 125 ANRYQDLAETYHNGGPSALSLSGEGLWLRQGGARGQSVIHAKGYSGDA---ADITLHDVS 181

Query: 181 ----SITIDKKNKII---HRKDADLAIIYNDKV-KLKKVVEYQYGRIPIDKNSTTLNIPI 232
               S       +II    R D    I+ N K   L   +  + G    D+    L +P 
Sbjct: 182 IHAYSTAGGPVRRIIAESARLDGSNWILTNAKSWPLTAGINPEAGAASHDE----LQLPT 237

Query: 233 KM--DGFQKFSEQFASRSFYEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
            +  D  +      +  S Y++   I+++S +     F   R E ++   +  PL L+AM
Sbjct: 238 TLTTDRIRDTLGTASGISIYDLPATIRELSAAG----FTTKRYEVRYQAELARPLFLIAM 293

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSG 332
            L+ AS ++  +R     + V   +  GF LY I    +  G++G
Sbjct: 294 VLVGASFTMRHARFGGTGLAVLMAVLLGFGLYFIRNFAQILGENG 338


>gi|114569776|ref|YP_756456.1| permease YjgP/YjgQ family protein [Maricaulis maris MCS10]
 gi|114340238|gb|ABI65518.1| permease YjgP/YjgQ family protein [Maricaulis maris MCS10]
          Length = 365

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 86/367 (23%), Positives = 160/367 (43%), Gaps = 13/367 (3%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
           G L RY         L   L    ++ ++D  E    +G   + S      L   R P +
Sbjct: 4   GRLNRYMASQTAGGLLLAFLTIATVIILVDFVEQSRAVGTRVDVSTLDLLGLTLLRAPAL 63

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           ++  +PF+ L   +   F LNR+SEL++ RA GIS W++L   +V ++ +GI     +NP
Sbjct: 64  LESTLPFVFLFGTLTSLFRLNRSSELIVMRASGISAWRILTAPMVLAVGIGIIGATGLNP 123

Query: 123 IATS----GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           +A +     E     L+   +  G +Q      W++ +N      I A ++     +  +
Sbjct: 124 LAATLNAEFEARRDSLMNVRRVEGAEQPV----WLRETNIDGFTVIAATQLEEARQVLRN 179

Query: 179 --FTSITIDKKN--KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
             F     D     ++  R DA+ A +     ++   +E       +D  +  +   I  
Sbjct: 180 PVFLQFAEDASGTPRLERRIDAESAELRAGFWEVTGAIERTPTPSRLDLGAIAMPTSINR 239

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
               + +      +F+++ + ++ + ++ +    R E + + L+ +PL L+A TLIAA+ 
Sbjct: 240 QALFERARSAEGVAFWDLPRLITSAREAGL-ATQRYELRLHALLALPLTLLASTLIAAAA 298

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           +L   R          G  +GF+++    ++ SFG SG L P  AA     LT  L+++ 
Sbjct: 299 TLRLHRLGGAAAFAMAGGIAGFVMFFFQEMLSSFGVSGALPPATAAWSAPALTALLALIY 358

Query: 355 LLQKEDG 361
           +   EDG
Sbjct: 359 IASTEDG 365


>gi|85859085|ref|YP_461287.1| permease [Syntrophus aciditrophicus SB]
 gi|85722176|gb|ABC77119.1| permease [Syntrophus aciditrophicus SB]
          Length = 359

 Score = 70.5 bits (171), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 85/346 (24%), Positives = 157/346 (45%), Gaps = 26/346 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPL 61
           IL RY  + +L+  L  +L  + L  ++D  E   ++  L NYS +   +LA    R+P+
Sbjct: 3   ILDRYISREFLRFFLLVILSFLSLFLIVDFFE---KLKMLINYSATFYQILAFFFFRIPM 59

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL--- 118
           ++   IP   L+ +++ F +L++ SE+V  RA G+S+++   P ++ S L+ +FT +   
Sbjct: 60  MLSLTIPAAVLLSSLLTFGSLSKNSEIVAMRASGVSLYRSSIPILLISFLIALFTFVFSE 119

Query: 119 VINPIATS-GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           +I P A    E I    I++ +  G  ++  I  W + +    +     K   PE++   
Sbjct: 120 LITPYANEKAEYIRKVEIEKKEIQGIFKQEQI--WYRGTRGIYNF----KLFDPEHNTLR 173

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKK--VVEYQYGRIPIDK--NSTTLNIPIK 233
             T   +D+K  +I R DA+ A+   ++       +V +     P+ +      L+ P  
Sbjct: 174 GITLNYMDRKMNLIMRVDAERAVWDRNQWVFYNLLIVRFDSAGFPVMERYGEKILDFPET 233

Query: 234 MDGF---QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
              F   QK SEQ       + ++K+    ++  +   R     +  I  P + V + +I
Sbjct: 234 PSDFRVIQKDSEQMGYFELRKYVQKI----RTEGYDATRYLADLHGKIAFPFVCVLLAVI 289

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLP 336
             S SL+  RS      +  G+  GF  + +     S G+SG L P
Sbjct: 290 GISFSLKTERSGGLAGSIFAGLIIGFSYWILFAFSMSLGRSGTLPP 335


>gi|51473938|ref|YP_067695.1| hypothetical protein RT0756 [Rickettsia typhi str. Wilmington]
 gi|51460250|gb|AAU04213.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 362

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 151/314 (48%), Gaps = 22/314 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL +++EL+   + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLTQVSSLISFTSMLFFLRNLTKSNELIAILSSGIHIWQVLIIPCIVTLILGIICT 118

Query: 118 LVINPIATSG-EKIGI---DLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
            ++NPI+T G +K  I    L ++    G   +S ++ +  ++   Q   I  + I    
Sbjct: 119 TLLNPISTIGLQKYAILEAKLTKKALSGGLISESGLLFFESLNEHNQ--IIQTQFIDVAE 176

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKV------VEYQYGRIPIDKNSTT 227
               + T + ID  N  + R DA   II N K+ L +V          Y  + I  N   
Sbjct: 177 QKLNNITILFIDNNNSFLKRIDALYGIIKNKKLYLNRVKVSMKDETKSYNNLTIQTN--- 233

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
           L+I   ++ F +  E  +  +  ++I ++  S  S I  NY  +  +Y  +  P+M++A 
Sbjct: 234 LSINSLVNKFMR-PEMVSIWALPKLINELLNSGLSAI--NY--QIYYYKQLFKPIMMMAT 288

Query: 288 TLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
            ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +L
Sbjct: 289 VILASCFISLK-QRCNAQEKILILGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSLL 347

Query: 347 TISLSILILLQKED 360
              +S  I+L  ++
Sbjct: 348 IFFISNFIILHYKE 361


>gi|157804140|ref|YP_001492689.1| hypothetical protein A1E_04940 [Rickettsia canadensis str. McKiel]
 gi|157785403|gb|ABV73904.1| hypothetical protein A1E_04940 [Rickettsia canadensis str. McKiel]
          Length = 333

 Score = 69.7 bits (169), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 153/315 (48%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL +  + G+ IWQ+L    + +++LGI   
Sbjct: 30  KIPYLLGQVSSLISFTAMLFFLSNLTKNNELTVILSSGVHIWQVLVSPCIVTLILGIVFT 89

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++   +G   KS ++ +  +++  Q I   FI  A+K 
Sbjct: 90  TILNPIGTIGLQKYELLEAKLTKKALSDGIISKSGLLFFESLNDANQIIQTQFINVAEKK 149

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLN 229
           L       + T + +D  N  + R DA   II N  + L +V  +         N+ T+ 
Sbjct: 150 L------NNITVLFVDSNNSFLKRIDALYGIIENKMLHLNRVKVFTKEETK-AYNTLTIQ 202

Query: 230 IPIKMDGF-QKFS--EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
             + ++    KFS  +  +  +  ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 203 TNLSINSLVNKFSRPDMVSIWALPKLINELLNSGLPAI--NY--QIYYYKQLFKPIMMMA 258

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R+N    I+  G+FSGF+ Y++  I+        L  +AA L+P +
Sbjct: 259 TVILASCFISLK-QRNNSQEKILILGLFSGFIAYSLSEILLKILAYNNLSLIAAILLPSM 317

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 318 LIFFISNFIILHYKE 332


>gi|294678215|ref|YP_003578830.1| permease YjgP/YjgQ family protein [Rhodobacter capsulatus SB 1003]
 gi|294477035|gb|ADE86423.1| permease YjgP/YjgQ family protein [Rhodobacter capsulatus SB 1003]
          Length = 366

 Score = 69.7 bits (169), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 122/269 (45%), Gaps = 22/269 (8%)

Query: 47  SISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFV 106
           ++S  A LAA  VP  +  I P + ++  +V F  L R+SELV+ RA G S  ++L   V
Sbjct: 44  ALSDAAHLAALSVPSTLYTIFPLVVMLSGVVAFLGLARSSELVVIRAAGRSALRMLLAPV 103

Query: 107 VGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP---WMQISNPQQDIF 163
             ++L+G+  V V NPI ++  K   ++  Q +  G +Q   I     WM     +Q   
Sbjct: 104 TVALLIGVLLVAVGNPIVSATSKRAEEIEGQLRAEG-RQTVSIGREGLWM-----RQGTA 157

Query: 164 IGAKKILPENHIWEDFTS------ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYG 217
            G + ++       D T+      +  D K   + R DA  A +      L +  ++  G
Sbjct: 158 DGGQAVIHAMRGNADATALYQVTFLLFDAKAGPVRRIDAASAWLTPGAWVLSEAKDWPLG 217

Query: 218 R-IPIDKNST---TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSF--SNKSNIFHNYRAE 271
           R    ++++T   T+++P  +   +  ++ F + S   I +   F  + ++  F   R  
Sbjct: 218 RSTNPERDATRAQTISLPSTLTA-ESIADSFGAPSAMPIWELPGFIRALEAAGFSARRHI 276

Query: 272 TQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
                 +  PLML AM L+AA  ++  +R
Sbjct: 277 VWLQVELAQPLMLAAMVLVAAGFTMRPAR 305


>gi|308272620|emb|CBX29224.1| hypothetical protein N47_J02050 [uncultured Desulfobacterium sp.]
          Length = 356

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 78/327 (23%), Positives = 142/327 (43%), Gaps = 51/327 (15%)

Query: 57  TRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP-FVVGSILLG-- 113
           +++P  I Q IP   L+  +V F  +++ +E+V  ++ GISI+ LL P  ++GS+     
Sbjct: 57  SKMP--IAQFIPLSVLLSILVTFGLMSKNNEIVAIKSGGISIYHLLRPILLIGSVFFCVV 114

Query: 114 IFTVLVINPIATS-GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
           IF    + PI  S  EKI   L Q      +++K        ++  ++DI+I    ++  
Sbjct: 115 IFLSEAVVPITKSKAEKI---LTQ-----ANRKK------FAMALKEKDIWIKGHNLI-- 158

Query: 173 NHI-WEDFTSITI--------DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDK 223
            HI + D +  TI        D K +++ R D +  +       L  ++E +     +DK
Sbjct: 159 THIEYYDSSKKTIHGIKLYFFDDKFRVVRRIDCEKGVFNQGNWILYDIIEQK-----LDK 213

Query: 224 NSTTLNI-----------PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAET 272
           N++ ++            P  +      SE  ++   Y+ IKK+    +S  +      T
Sbjct: 214 NNSEISFHKQLIEHLVFSPDDIGVVAVTSESMSAFELYDYIKKI----ESEGYDATTYRT 269

Query: 273 QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSG 332
            FY  +  P + + M  +   ++          + + YGI + F  +       S G+ G
Sbjct: 270 DFYAKLSFPFICIIMCFVGTGIAFRLGAKESLPVNIVYGIGAAFSYWVFFGFCISLGEGG 329

Query: 333 ILLPVAAALIPVILTISLSILILLQKE 359
           IL P  AALIP ++ +   I  +L  E
Sbjct: 330 ILNPFFAALIPNLVFLGFGIFTVLNTE 356


>gi|229587132|ref|YP_002845633.1| Putative permease [Rickettsia africae ESF-5]
 gi|228022182|gb|ACP53890.1| Putative permease [Rickettsia africae ESF-5]
          Length = 362

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 149/315 (47%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLGQVSSLISFTAMLFFLRNLTKNNELTAMLSSGIHIWQVLVIPCIVTLMLGIVFT 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++    G   KS ++ +  +++  Q I   FI  A+K 
Sbjct: 119 TILNPIGTIGLQKYELLEAKLTKKALSEGIISKSGLLFFESLNDETQIIQTQFINVAEKK 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---ST 226
           L       + T + +D  N  + R DA   II N  + L +V  +         N    T
Sbjct: 179 L------NNITILFVDHNNSFLKRIDALYGIIENKMLHLNRVKVFTKEETKAYNNLTMQT 232

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L+I   ++ F +  E  +  +  ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 233 NLSINSLVNKFIR-PEMVSIWALPKLIHELLNSGLPAI--NY--QIYYYKQLFKPIMMMA 287

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +
Sbjct: 288 TVILASCFISLK-QRDNSQEKILLLGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSM 346

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 347 LIFFISNFIMLHYKE 361


>gi|15893122|ref|NP_360836.1| hypothetical protein RC1199 [Rickettsia conorii str. Malish 7]
 gi|238650591|ref|YP_002916443.1| hypothetical protein RPR_03025 [Rickettsia peacockii str. Rustic]
 gi|15620329|gb|AAL03737.1| unknown [Rickettsia conorii str. Malish 7]
 gi|238624689|gb|ACR47395.1| hypothetical protein RPR_03025 [Rickettsia peacockii str. Rustic]
          Length = 362

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 149/315 (47%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLGQVSSLISFTAMLFFLRNLTKNNELTAMLSSGIHIWQVLVIPCIVTLMLGIVFT 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++    G   KS ++ +  +++  Q I   FI  A+K 
Sbjct: 119 TILNPIGTIGLQKYELLEAKLTKKALSEGIISKSGLLFFESLNDETQIIQTQFINVAEKK 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---ST 226
           L       + T + +D  N  + R DA   II N  + L +V  +         N    T
Sbjct: 179 L------NNITILFVDHNNSFLKRIDALYGIIENKMLHLNRVKVFTKEETKAYNNLTMQT 232

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L+I   ++ F +  E  +  +  ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 233 NLSINSLVNKFIR-PEMVSIWALPKLINELLNSGLPAI--NY--QIYYYKQLFKPIMMMA 287

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +
Sbjct: 288 TVILASCFISLK-QRDNSQEKILLLGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSM 346

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 347 LIFFISNFIMLHYKE 361


>gi|157829030|ref|YP_001495272.1| hypothetical protein A1G_06555 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933754|ref|YP_001650543.1| hypothetical protein RrIowa_1403 [Rickettsia rickettsii str. Iowa]
 gi|157801511|gb|ABV76764.1| hypothetical protein A1G_06555 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908841|gb|ABY73137.1| hypothetical membrane spanning protein [Rickettsia rickettsii str.
           Iowa]
          Length = 362

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 150/315 (47%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLGQVSSLISFTAMLFFLRNLTKNNELTAMLSSGIHIWQVLVIPCIVTLMLGIVFT 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI+T G    E +   L ++    G   KS ++ +  +++  Q I   FI  A+K 
Sbjct: 119 TILNPISTIGLQKYELLEAKLTKKALSEGIISKSGLLFFESLNDETQIIQTQFINVAEKK 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---ST 226
           L       + T + +D  N  + R DA   II N  + L +V  +         N    T
Sbjct: 179 L------NNITILFVDHNNSFLKRIDALYGIIENKMLHLSRVKVFTKEETKAYNNLTMQT 232

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L+I   ++ F +  E  +  +  ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 233 NLSINSLVNKFIR-PEMVSIWALPKLINELLNSGLPAI--NY--QIYYYKQLFKPIMMMA 287

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +
Sbjct: 288 TVILASCFISLK-QRDNSQEKILLLGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSM 346

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 347 LIFFISNFIMLHYKE 361


>gi|34581207|ref|ZP_00142687.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262592|gb|EAA26096.1| unknown [Rickettsia sibirica 246]
          Length = 362

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 149/315 (47%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLGQVSSLISFTAMLFFLRNLTKNNELTAMLSSGIHIWQVLVIPCIVTLMLGIVFT 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++    G   KS ++ +  +++  Q I   FI  A+K 
Sbjct: 119 TILNPIGTIGLQKYELLEAKLTKKALSEGIISKSGLLFFESLNDKTQIIQTQFINVAEKK 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---ST 226
           L       + T + +D  N  + R DA   II N  + L +V  +         N    T
Sbjct: 179 L------NNITILFVDHNNSFLKRIDALYGIIENKMLHLNRVKVFTKEETKAYNNLTMQT 232

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L+I   ++ F +  E  +  +  ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 233 NLSINSLVNKFIR-PEMVSIWALPKLINELLNSGLPAI--NY--QIYYYKQLFKPIMMMA 287

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +
Sbjct: 288 TVILASCFISLK-QRDNSQEKILLLGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSM 346

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 347 LIFFISNFIMLHYKE 361


>gi|325295269|ref|YP_004281783.1| permease YjgP/YjgQ family protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065717|gb|ADY73724.1| permease YjgP/YjgQ family protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 354

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 82/358 (22%), Positives = 156/358 (43%), Gaps = 16/358 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY F   L+  +  LL  M+L  VID     ++M       I+ G +    R+PL   ++
Sbjct: 7   RYVFIETLRYFVLTLLTFMVLFIVIDF---VSKMDTFLKSGIADGFLYVIYRLPLYTVRV 63

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           IP  TL+  +V   N + ++EL + +A+GIS+++   P +  + L  I + L+   +   
Sbjct: 64  IPIATLIATMVTLSNFSFSNELTVVKALGISVYRFSFPIIFLAFLASILSFLIGELVVPK 123

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
              +   +  + K+N +   S    W +     +  F+  + + P     +  +   + K
Sbjct: 124 SISLSKSIYYKVKENKNFHVSGKSIWFK---KDEKTFVFMEYVNPAKSEAKRISIFFLGK 180

Query: 187 KNKIIHRKDADLAI-IYNDKVKLKKVVEYQYGRIPIDK-NSTTLNIPIKMDGF---QKFS 241
           +     R DA   I I +D  KLK   E +   +   K +   +N+ I        Q  +
Sbjct: 181 EFSPTKRIDALYGINIKDDIWKLKNCFERKLKELKTTKISEKEINLGIGKKDLIFTQIET 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
           E  +S   Y++IK++    K   +         Y  + I L+ + + +I   + +   R+
Sbjct: 241 ETMSSFLLYKVIKQL----KRAGYDTTGYLVDLYSKLAISLLPLVVAVIGIPLGVFNPRN 296

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
            +   +V       FM  T I+   S GKSG+L P  +A  P ++ +S+ +L+L + +
Sbjct: 297 KKGYTLVIAAALIVFMWIT-ISFFSSLGKSGVLPPFYSAFAPEVMFLSIGLLLLARMD 353


>gi|209964086|ref|YP_002297001.1| predicted permease YjgP [Rhodospirillum centenum SW]
 gi|209957552|gb|ACI98188.1| predicted permease YjgP [Rhodospirillum centenum SW]
          Length = 359

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/338 (19%), Positives = 142/338 (42%), Gaps = 34/338 (10%)

Query: 35  EIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAI 94
           E    +G+L  Y++         R+P I+++++P   LV ++   + L + +E+V  R+ 
Sbjct: 42  ERGGALGDLGTYAL--------LRLPSIVERLVPLAVLVGSLTTLYGLVQNNEIVAMRSA 93

Query: 95  GISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP--- 151
           G++ +QLL   +  ++ + +F +++ + IA   E+     +  W +  +    D +P   
Sbjct: 94  GLTPYQLLATLMPAAVAIAVFHLILSDQIAPRAERA---FLTWWAET-EPPTDDDLPLAE 149

Query: 152 ---WMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYN----- 203
              W+++ N      + A+++L      E  +    D + ++  R  A  A+  +     
Sbjct: 150 KKLWLRVGN----TIVAAERVLERGARLEQVSLYPRDDQGRVTERTRAAAAVYGDGNWTL 205

Query: 204 -DKVKLKKVVEYQYGRIPIDKNSTTLNI-PIKMDGFQKFSEQFASRSFYEIIKKMSFSNK 261
            D  +L  +    +   P  +    + + P  +    + +E         I++      +
Sbjct: 206 LDGTRL-DLTRGDFKAEPFARAPWPVRLHPANVVEVLQPTENIPLLRLRSILRGDWAGRQ 264

Query: 262 SNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTI 321
           S  ++    ET+ +     PL  + M L+AA V+    RS      +A GI  G      
Sbjct: 265 SPAYY----ETRLHETYAGPLATLIMVLLAAPVAHGMRRSGAVGGSMALGIGIGLTYLLA 320

Query: 322 ITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
             ++ + G++G +  V AA  P +   ++   IL+  E
Sbjct: 321 DGMLAALGEAGAMPAVIAAWAPTVFFAAVGGAILVHVE 358


>gi|15604603|ref|NP_221121.1| hypothetical protein RP769 [Rickettsia prowazekii str. Madrid E]
 gi|3861298|emb|CAA15197.1| unknown [Rickettsia prowazekii]
 gi|292572419|gb|ADE30334.1| Putative permease [Rickettsia prowazekii Rp22]
          Length = 362

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 147/311 (47%), Gaps = 16/311 (5%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL +++EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLSQVSSLISFTSMLFFLRNLTKSNELTAILSSGIHIWQVLIIPCIVTLILGIICT 118

Query: 118 LVINPIATSGEK----IGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
            ++NPI+T G +    +   L ++        +S ++ +  ++   Q   I  K I    
Sbjct: 119 TILNPISTIGLQKYSLLEAKLTKKALSECLISESGLLFFESLNEHNQ--IIQTKFIDVAE 176

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---STTLNI 230
               + T + ID  N  + R DA   II N K+ L +V       I    N    T L+I
Sbjct: 177 KKLNNITILFIDNNNSFLKRIDALYGIIDNKKLYLNRVKVSTKDEIKSYSNLTIQTNLSI 236

Query: 231 PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
              ++ F +  E  +  +  ++I ++  S  S I  NY  +  +Y  +  P+M++A  ++
Sbjct: 237 NSLVNKFMR-PEMVSIWALPKLINELLNSGLSAI--NY--QIYYYKQLFKPIMMMATVIL 291

Query: 291 AAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +L   
Sbjct: 292 ASCFISLK-QRCNSQEKILILGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSMLIFF 350

Query: 350 LSILILLQKED 360
           +S  I+L  ++
Sbjct: 351 ISNFIILHYKE 361


>gi|67459625|ref|YP_247249.1| permease [Rickettsia felis URRWXCal2]
 gi|67005158|gb|AAY62084.1| Predicted permeases [Rickettsia felis URRWXCal2]
          Length = 362

 Score = 66.6 bits (161), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 148/315 (46%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLGQVSSLISFTSMLFFLRNLTKNNELTAMLSSGIHIWQVLVIPCIVTLILGIVFT 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++    G   KS ++ +  + +  Q I   FI  A+K 
Sbjct: 119 TILNPIGTIGLQKYELLEAKLTKKTLSEGIISKSGLLFFESLKDENQIIQTQFINIAEKK 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---ST 226
           L       + T + +D  N  + R DA   II N  + L +V  +         N    T
Sbjct: 179 L------NNITILFVDSNNSFLKRIDALYGIIENKMLHLNRVKVFTKEETKTYNNLTIQT 232

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L+I   ++ F +  E  +  +  ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 233 NLSINSLVNKFIR-PEMVSIWALPKLINELLNSGLPAI--NY--QIYYYKQLFKPIMMMA 287

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +
Sbjct: 288 TVILASCFISLK-QRDNSQEKILILGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSM 346

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 347 LIFFISNFIILHYKE 361


>gi|83952307|ref|ZP_00961039.1| permease, YjgP/YjgQ family protein [Roseovarius nubinhibens ISM]
 gi|83837313|gb|EAP76610.1| permease, YjgP/YjgQ family protein [Roseovarius nubinhibens ISM]
          Length = 363

 Score = 66.6 bits (161), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 84/368 (22%), Positives = 154/368 (41%), Gaps = 16/368 (4%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + +L T +       +L+ +IDL +      +LP + +    +L    +P   
Sbjct: 2   ILHFYFARKFLWTLIGIATVFSVLLGLIDLVDELQDFPDLPFFDVLEIVLL---NLPHAN 58

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P + ++  + +F  L R+SELV+ RA G S    L   V  + L+G+  V + NP+
Sbjct: 59  YEILPLVMILATVALFVRLARSSELVVLRASGRSALAGLAGPVAVAALVGLVGVTMFNPV 118

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL+      GD     S    W++    +    I AK   P+       T 
Sbjct: 119 VAASAKRYNDLVNGHSGLGDNVLAISSEGLWLRQGTEEGQTVIHAKSATPDLSTLFGATF 178

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST------TLNIPIKMD 235
            +   +   + R  A+ A +   +  L  V  +        + S       T+   +  D
Sbjct: 179 TSFTPEGDPMRRLTAESAELGQGQWHLSDVKIWDLANTDNPEASARTQDRLTIRAALTRD 238

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNK--SNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
              +  + F    +  I    +F ++  +  F   R    F   +  PL L+A+ L+ A+
Sbjct: 239 ---RIIDSFGKPEYIPIWDLPAFIDQLETAGFSARRYAVWFQMELAQPLFLIALVLVGAA 295

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
            +++ +R       V   +  GF L+ I    +  G++G +  + AA  P + ++ L++ 
Sbjct: 296 FTMKHARLANTGTSVLAAVMLGFTLHYIRNFAQVLGENGQIPILLAAWAPPVASLLLALG 355

Query: 354 ILLQKEDG 361
           ILL  EDG
Sbjct: 356 ILLHMEDG 363


>gi|114768925|ref|ZP_01446551.1| permease, YjgP/YjgQ family protein [alpha proteobacterium HTCC2255]
 gi|114549842|gb|EAU52723.1| permease, YjgP/YjgQ family protein [alpha proteobacterium HTCC2255]
          Length = 366

 Score = 66.6 bits (161), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/324 (20%), Positives = 142/324 (43%), Gaps = 22/324 (6%)

Query: 53  VLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
           +L+  R    +   +P I ++  +    +L+R++E ++ RA G+S  + L P +  +  L
Sbjct: 50  ILSLLRTTTYLSLAMPLIIMLSALAFSVSLSRSNEFIVLRASGVSALKGLFPVISSAFFL 109

Query: 113 GIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP----WMQISNPQQDIFIGAKK 168
           G+ ++ +++P+A  G+ IG   I+  K    +Q   +I     WM+ +       I A  
Sbjct: 110 GLISIFMLDPLA--GKMIGYYNIKLDKLRSKEQSQVLINDNGYWMRQATLNGHQIIKAVN 167

Query: 169 ILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI---PIDKNS 225
           +          T    D+   +  R  ++ A + N+++ L   +++   +I   PI  N 
Sbjct: 168 VSNNGQRLHQVTIFNYDENGLVTERFFSESAALGNNELLLTNAIKWSDTKIKKNPIIANE 227

Query: 226 TTLNIPIK--------MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL 277
               + IK        +DG+    E  +  +  + I+K+  S  S + +  +   Q+   
Sbjct: 228 KIKKLKIKTEITPTQLLDGYAS-PETISPWNMNKQIQKVKSSGFSVLKYQSKKMEQY--- 283

Query: 278 IVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPV 337
              P + + M ++    +L+ SR+    I V   + SGF L+       + G+SG +  +
Sbjct: 284 -ARPFLFIVMVVLGTVFTLQNSRARNVGISVVLAVASGFFLHFFQNFCTTLGRSGEIPLI 342

Query: 338 AAALIPVILTISLSILILLQKEDG 361
            A   P++    +++ + L  EDG
Sbjct: 343 IATWSPILSIGLIAMTLFLHYEDG 366


>gi|157826222|ref|YP_001493942.1| hypothetical protein A1C_06005 [Rickettsia akari str. Hartford]
 gi|157800180|gb|ABV75434.1| hypothetical protein A1C_06005 [Rickettsia akari str. Hartford]
          Length = 362

 Score = 66.6 bits (161), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 82/315 (26%), Positives = 146/315 (46%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KIPYLLGQVCSLISFTAMLFFLSNLTKNNELTAMLSSGIHIWQVLVIPCIVTLILGIVFT 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++    G   KS ++ +  ++   Q I   FI  A+K 
Sbjct: 119 TILNPIGTIGLQKYELLEAKLTKKALSEGIISKSGLLFFESLNGENQIIQTQFINVAEKK 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---ST 226
           L       + T + +D  N  + R DA   II N  + LK+V            N    T
Sbjct: 179 L------NNITILFVDSNNSFLKRIDALYGIIENKMLHLKRVKVCTKEETKAYNNLTIQT 232

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L+I   ++ F +  E  +  S  ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 233 NLSINSLVNKFIR-PEMVSIWSLPKLINELFNSGLPAI--NY--QIYYYKQLFKPIMMMA 287

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R N    I+  G+F GF+ Y++  I+        L   AA L+P +
Sbjct: 288 TVILASCFISLK-QRDNSQEKILILGLFLGFIAYSLSEILLKILTYNNLSLTAAILLPSM 346

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 347 LIFFISNFIILHYKE 361


>gi|157964920|ref|YP_001499744.1| putative permease [Rickettsia massiliae MTU5]
 gi|157844696|gb|ABV85197.1| Putative permease [Rickettsia massiliae MTU5]
          Length = 370

 Score = 65.9 bits (159), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 148/315 (46%), Gaps = 24/315 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 67  KIPYLLGQVSSLISFSAMLFFLRNLTKNNELTAMLSSGIHIWQVLVIPCIVTLMLGIVFT 126

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++    G   KS ++ +  +++  Q I   FI  A+K 
Sbjct: 127 TILNPIGTIGLQKYELLEAKLTKKALSEGIISKSGLLFFEALNDENQIIQTQFINVAEKK 186

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN---ST 226
           L       + T + +D  N  + R DA   II N  + L +V  +         N    T
Sbjct: 187 L------NNITILFVDHNNSFLKRIDALYGIIENKMLHLNRVKVFTKEETKAYNNLTIQT 240

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L+I   ++ F +  E  +     ++I ++  S    I  NY  +  +Y  +  P+M++A
Sbjct: 241 NLSINSLVNKFIR-PEMVSIWVLPKLINELLNSGLPVI--NY--QIYYYKQLFKPIMMMA 295

Query: 287 MTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
             ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  +AA L+P +
Sbjct: 296 TVILASCFISLK-QRDNSQEKILLLGLFSGFIAYSLSEILLKILTYNNLSLIAAILLPSM 354

Query: 346 LTISLSILILLQKED 360
           L   +S  I+L  ++
Sbjct: 355 LIFFISNFIMLHYKE 369


>gi|218778208|ref|YP_002429526.1| permease YjgP/YjgQ family protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759592|gb|ACL02058.1| permease YjgP/YjgQ family protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 353

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 122/293 (41%), Gaps = 24/293 (8%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPF----VVGSILLG 113
           R+P +  Q++P   L+  +VV   + R +E++   + G S + LL P     V+ S+ L 
Sbjct: 56  RIPYVAAQVLPVGVLLSAMVVIGLMARHNEIIAYASGGGSSFSLLKPIAVMGVIASLFLF 115

Query: 114 IFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIG-AKKILPE 172
            F  +++   A    +I    +++  D G +       W       ++  IG   K +PE
Sbjct: 116 AFNEIIVPAAAAEANQIWYQDVRKEGDVGTRT-----TWF-----HRNGLIGRVDKYIPE 165

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPI 232
            H   D T    D   K+I R DAD A I      L+  +E   GR    +    L + +
Sbjct: 166 THTARDITLNYYDPSFKLIKRIDADDATISGTVWTLRNAMESVSGRASDIRQHKELKVEM 225

Query: 233 KMDGFQ-----KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
                Q     K S++ +     E I K+    +S  +   R        I  PL+ + M
Sbjct: 226 DFTADQLHDRVKRSDEMSLVQLKEHIHKI----ESEGYKAVRFRVDLASKISFPLVCLIM 281

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           +++  +++L   R     + +  G+   F  + + ++  S G +G+  P+ +A
Sbjct: 282 SVLGGAMALRGKRGEGLAVNIVMGMGLAFAYWVVHSLCLSLGYAGMYSPIFSA 334


>gi|239946701|ref|ZP_04698454.1| permease, YjgP/YjgQ family [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920977|gb|EER21001.1| permease, YjgP/YjgQ family [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 362

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 151/318 (47%), Gaps = 30/318 (9%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI  +
Sbjct: 59  KIPYLLGQVSSLISFTAMLFFLRNLTKNNELTAMLSSGIHIWQVLVIPCIVTLILGIVFM 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---FIG-AKKI 169
            ++NPI T G    E +   L ++    G   KS ++ +  +++  Q I   FI  A+K 
Sbjct: 119 TILNPIGTIGLQKYELLEAKLTKKALSEGIISKSGLLFFESLNDENQIIQTQFINVAEKK 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDK 223
           L       + T + +D  N  + R DA   II N  + L +V  +       Y  + I  
Sbjct: 179 L------NNITILFVDSNNSFLKRIDALYGIIENKMLHLNRVKVFTKEETKAYNNLTIQA 232

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLM 283
           N   L+I   ++ F +  E  +  +  ++I ++  S    I  NY  +  +Y  +  P+M
Sbjct: 233 N---LSINSLVNKFIR-PEMVSIWALPKLINELLNSGLPAI--NY--QIYYYKQLFKPIM 284

Query: 284 LVAMTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
           ++A  ++A+  +SL+  R N    I+  G+FSGF+ Y++  I+        L  + A L+
Sbjct: 285 MMATVILASCFISLK-QRDNSQEKILILGLFSGFIAYSLSEILLKILTYNNLSLITAILL 343

Query: 343 PVILTISLSILILLQKED 360
           P +L   +S  I+L  ++
Sbjct: 344 PSMLIFFISNFIILHYKE 361


>gi|149201834|ref|ZP_01878808.1| permease, YjgP/YjgQ family protein [Roseovarius sp. TM1035]
 gi|149144882|gb|EDM32911.1| permease, YjgP/YjgQ family protein [Roseovarius sp. TM1035]
          Length = 378

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/366 (19%), Positives = 155/366 (42%), Gaps = 12/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +  + +   +  ++++ +IDL    +++G+ P  +  +   +   ++P   
Sbjct: 17  ILERYFGRRFFVSFMGVTITMLVIMGLIDL---MDELGDFPELAFGQVLGIVLLKLPEAY 73

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +IIP + ++ ++ +F  L R+SE+V+ RA G S  + L      ++ +G+  + V NP+
Sbjct: 74  YEIIPLVMILASVALFLRLARSSEMVVLRASGRSALRGLLAPAAVALAIGLLGLAVGNPL 133

Query: 124 ATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL+  +      D   +    W++         I A +   +       + 
Sbjct: 134 VAATAKRHHDLVNTYSGQTYSDLAIASEGLWLRQGGTAGQTVIYAARSSSDLSTLYGPSF 193

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR----IPIDKNSTTLNIPIKMDGF 237
                  + + R  A  A +      L+    +          + +    L++P  +   
Sbjct: 194 YDFAPDGQPLRRISASTARLETGAWLLEDAKIWDLAENINPEAMARQEAQLSVPSDLTQ- 252

Query: 238 QKFSEQFASRSFYEIIKKMSFSNK--SNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
            +  + F S  +  I +   F ++     F   R    F   +  P+ LVA+ LI+A+++
Sbjct: 253 DRILDSFGSPEYIPIWELPKFIDQLEEAGFSARRYAIWFQSELAQPVFLVALVLISAALT 312

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF L+ +       G++G L  + AA  P + ++ + + IL
Sbjct: 313 MGHTRGANVGLSVLTAVLLGFGLHYVRNFAHILGENGQLPILLAAWAPPVASLFIGLGIL 372

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 373 LHLEDG 378


>gi|254436833|ref|ZP_05050327.1| putative permease, YjgP/YjgQ family [Octadecabacter antarcticus
           307]
 gi|198252279|gb|EDY76593.1| putative permease, YjgP/YjgQ family [Octadecabacter antarcticus
           307]
          Length = 364

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 158/374 (42%), Gaps = 27/374 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +  T      G  +L+ +IDL E   + G     S+     L+  ++P ++
Sbjct: 2   ILHRYFARRFAWTFTATFGGFFVLMLLIDLVEQLRRYG--GEASLGDMLQLSLLKLPSLL 59

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS-IWQLLNPFVVGSILLGIFTVLVINP 122
             I+P I ++  +  F  L R+SEL++SRA G S +  L+ P +V ++++G  T+ V NP
Sbjct: 60  YDILPLIMVLATVATFLGLARSSELIVSRAAGRSALRALVAPLIV-TVIIGAITIGVFNP 118

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIP---------WMQISNPQQDIFIGAKKILPEN 173
           +  +  K       +++      +SD            W++  +      I A     + 
Sbjct: 119 LVAATSK-------EFEARKTTLRSDAPSVLAISENGLWLRQGDDNSQTVIRAGGANLDG 171

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKL--KKVVEYQYGRIP--IDKNSTTLN 229
              +D T I   K      R +A  A +      L   KV      R+   +    TTL 
Sbjct: 172 TQLQDVTFIRFSKTGHPTRRIEAATANLTIGAWDLTDAKVWPLVGNRVAESVATIHTTLR 231

Query: 230 IPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNI--FHNYRAETQFYFLIVIPLMLVAM 287
           IP  +    +  + F   S   I +  +F ++  +  F   R +      +  P  L+AM
Sbjct: 232 IPSTLTA-DEIRDSFGVPSSIAIWELPAFIDRLEVAGFSATRHQVWLQMELAQPAFLLAM 290

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
            LI A  ++   R  +  ++V   I   F L+ +    +  G++G +    AA  P +  
Sbjct: 291 VLIGAGFTMRHQRGGRTGVMVLAAILICFALFFLRNFAQILGENGQISAGLAAWAPPLAA 350

Query: 348 ISLSILILLQKEDG 361
           I+ S+ +LL  EDG
Sbjct: 351 IAGSLGLLLHLEDG 364


>gi|295690098|ref|YP_003593791.1| permease YjgP/YjgQ family protein [Caulobacter segnis ATCC 21756]
 gi|295432001|gb|ADG11173.1| permease YjgP/YjgQ family protein [Caulobacter segnis ATCC 21756]
          Length = 353

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/343 (21%), Positives = 143/343 (41%), Gaps = 31/343 (9%)

Query: 12  YYLKTTLYFLLGA-MILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQQIIP 68
           Y L+T    +LGA +IL+ ++ + ++ +   ++ +  +    V   AA R+P + +Q+ P
Sbjct: 6   YVLRTVATRILGAALILMSILQILDLLDVTTDILDRGLGMAGVAYYAALRLPRLFEQVAP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLN---PFVVGSILLGIFTVLVINPIAT 125
              L   +  F  L R S +V  RA GIS ++++    P V+  +LL      V+ P + 
Sbjct: 66  IAVLAGGLFAFSQLARESAVVAMRASGISGYRIVGMAMPAVIAVMLLDALCGQVLAPRSD 125

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
                    +  W  N         P  +      D+ IGA        I    TS+TI 
Sbjct: 126 P-------TLADWWRNTTPVAERKAPSPRTFRAGSDLVIGADASADGREI----TSLTIF 174

Query: 186 KKNK---IIHRKDADLAIIYNDKVKLKKVVEYQY-GRIPIDKNSTTLNIPIKMDGFQKFS 241
           ++N    ++ + +A  A+    +  L+     ++ G +     + ++N P  +   Q   
Sbjct: 175 RRNAKGILVEKVEASKALYDGRRWTLQSPKTTRFAGDLAQTSTAASINWPTALRP-QDVQ 233

Query: 242 EQFASRSFYEIIK-----KMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
             F   S           +   S++   F+     T F      P + + M L++A V+L
Sbjct: 234 GLFGDDSAPTAATARRALENGGSDRPESFY----ATHFQSAFASPFVSLVMLLLSAPVAL 289

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
              RS Q  +++  G+ +G +      ++ + G+SG L P+ A
Sbjct: 290 ANFRSGQGAVLLTAGLGAGLLFLVANGMLTALGESGALSPLLA 332


>gi|91204945|ref|YP_537300.1| putative permeases [Rickettsia bellii RML369-C]
 gi|91068489|gb|ABE04211.1| Putative permeases [Rickettsia bellii RML369-C]
          Length = 362

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 141/318 (44%), Gaps = 30/318 (9%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQ-LLNPFVVGSILLGIFT 116
           +VP ++ Q+   I+    +    NL + +EL    + GI IWQ L+ P++V +++LGI  
Sbjct: 59  KVPYLLNQVSALISFTSMLFFLRNLTKNNELTAILSSGIHIWQVLIIPYIV-TLILGIVF 117

Query: 117 VLVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ-----QDIFIGAK 167
             ++NPI   G    + +   L ++  +     KS ++ +  ++        Q I I  K
Sbjct: 118 TTILNPIGALGLQKYDLLEAKLTKKTHNEAVISKSGLLFFEALNGKNQIIQTQFINISEK 177

Query: 168 KILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT 227
           K+        + T + ID  N  + R DA   II N  + L +V  +         N   
Sbjct: 178 KL-------NNITVLFIDNNNNFLKRIDALYGIIENKSLHLNRVKVFTKDSTEAHNN--- 227

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIK--KM--SFSNKSNIFHNYRAETQFYFLIVIPLM 283
           L IP  +        +F       I K  K+     N      NY  +  +Y  +  P M
Sbjct: 228 LTIPTNL-SVNSLVNKFTHPEMVSIWKLPKLIDELLNSGLPITNY--QVYYYKQLFKPAM 284

Query: 284 LVAMTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
           ++A  ++A+  +SL+  R N    I+  G+FSGF++Y++  I+        L  +AA L+
Sbjct: 285 MIATIILASCFISLK-QRDNSQEKILILGLFSGFIVYSLSEILLKVLTYNNLSLIAAILL 343

Query: 343 PVILTISLSILILLQKED 360
           P +L   +S  I+L  ++
Sbjct: 344 PSMLIFFISNFIILHYKE 361


>gi|157827727|ref|YP_001496791.1| putative permeases [Rickettsia bellii OSU 85-389]
 gi|157803031|gb|ABV79754.1| Putative permeases [Rickettsia bellii OSU 85-389]
          Length = 362

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 138/317 (43%), Gaps = 28/317 (8%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           +VP ++ Q+   I+    +    NL + +EL    + GI IWQ+L    + +++LGI   
Sbjct: 59  KVPYLLNQVSALISFTSMLFFLRNLTKNNELTAILSSGIHIWQVLIIPCIVTLILGIVFT 118

Query: 118 LVINPIATSG----EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ-----QDIFIGAKK 168
            ++NPI   G    + +   L ++  +     KS ++ +  ++        Q I I  KK
Sbjct: 119 TILNPIGALGLQKYDLLEAKLTKKTHNEAVISKSGLLFFEALNGKNQIIQTQFINISEKK 178

Query: 169 ILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL 228
           +        + T + ID  N  + R DA   II N  + L +V  +         N   L
Sbjct: 179 L-------NNITVLFIDNNNNFLKRIDALYGIIENKSLHLNRVKVFTKDSTEAHNN---L 228

Query: 229 NIPIKMDGFQKFSEQFASRSFYEIIK--KM--SFSNKSNIFHNYRAETQFYFLIVIPLML 284
            IP  +        +F       I K  K+     N      NY  +  +Y  +  P M+
Sbjct: 229 TIPTNL-SVNSLVNKFTHPEMVSIWKLPKLIDELLNSGLPITNY--QVYYYKQLFKPAMM 285

Query: 285 VAMTLIAAS-VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIP 343
           +A  ++A+  +SL+  R N    I+  G+FSGF++Y++  I+        L  +AA L+P
Sbjct: 286 IATIILASCFISLK-QRDNSQEKILILGLFSGFIVYSLSEILLKVLTYNNLSLIAAILLP 344

Query: 344 VILTISLSILILLQKED 360
            +L   +S  I+L  ++
Sbjct: 345 SMLIFFISNFIILHYKE 361


>gi|322418226|ref|YP_004197449.1| permease YjgP/YjgQ family protein [Geobacter sp. M18]
 gi|320124613|gb|ADW12173.1| permease YjgP/YjgQ family protein [Geobacter sp. M18]
          Length = 360

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 149/350 (42%), Gaps = 25/350 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVF-VIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
           IL RY  K YL+  L   LG+ I ++ V+D  E  ++       S     +   T++P +
Sbjct: 3   ILTRYVAKAYLRM-LGLCLGSFITIYLVVDFMEKVSRFTR-AGASWKYLVLFFITKIPEM 60

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +    P   L+  ++   + + +SEL   R+ G+S+ ++  P +  S+L+ +  +++   
Sbjct: 61  VVDSAPLAVLMATLLTLGSFSLSSELTAMRSCGVSLARISAPILAISVLMSLVVLMLGEF 120

Query: 123 I--ATSGEKIGID--LIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           +   +  ++I I   LIQ+      K  S       I + ++   + A    P  +  + 
Sbjct: 121 VIPKSYAQRIYIQEVLIQK------KSPSTYFRQHNIWHREEGNVLRASLFEPSQNQLKG 174

Query: 179 FTSITIDKKNKI-IHRKDADLAIIYNDKVKLKKVV--EYQYGRIPIDKNSTTLNIPIKMD 235
            T   +  K  + + R DA L  + N     K VV  E++   I   +    L  P+K+ 
Sbjct: 175 VTLWEVQPKTGLPLRRTDAALGQLGNQGWVFKDVVVREFEGADISRTRKYPQLAAPLKLK 234

Query: 236 G-----FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
                   K+S+    R      KK+    ++  +   R  TQF+  I +P     M  +
Sbjct: 235 PADLKVLGKYSDSMTLRELNRYCKKI----QAGGYDATRYITQFHSRISLPFGCAVMAFL 290

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
               +L   RS+     +   I  GF+   I +++ S G+ G+L P+AAA
Sbjct: 291 GIPFALRGGRSSGIAFGIGLSIGVGFLYVIINSVIISVGQVGLLPPIAAA 340


>gi|189425644|ref|YP_001952821.1| permease YjgP/YjgQ family protein [Geobacter lovleyi SZ]
 gi|189421903|gb|ACD96301.1| permease YjgP/YjgQ family protein [Geobacter lovleyi SZ]
          Length = 359

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 83/371 (22%), Positives = 167/371 (45%), Gaps = 26/371 (7%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATR 58
           M GI+ RY    +L+  L    G + +  ++D  E   ++G       S  A+L     +
Sbjct: 1   MFGIVGRYLAGTWLRLFLLCQGGFLAVYLILDFME---KLGRFSKAGASLSAILQFFLFK 57

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF--- 115
           +P ++ Q +PF  L+  ++    L+R+SEL   R+ G+SI +++ P ++  +L  +    
Sbjct: 58  IPEMLGQTMPFAVLMATLLALGMLSRSSELTALRSCGLSIPRIVLPILMLGLLGSLVLLV 117

Query: 116 -TVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNP--QQDIFIGAKKILPE 172
            +  V+       E I   +I++   N   + ++I  W + +N   Q  +F    + L  
Sbjct: 118 NSEFVVPKSYQQMEHIEKVVIKKQSVNTFFRLNNI--WFRSNNLILQAKVFEPLTRTLKG 175

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPI 232
             +WE      +    + + R DA+ A+  +   +L +V    +        S  L++P+
Sbjct: 176 VTVWE------LSADMQPVRRMDAEQALYGSGGWELLQVRTRSFAGQGGVVASARLSVPL 229

Query: 233 --KMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
             K+D  +       + SF ++ ++ + S +   +   R  T  +  + +P     M ++
Sbjct: 230 TLKVDDLRILDNNADNFSFRKL-REYAVSLEKGGYPAGRYRTMMHAKLALPFGAFVMVVL 288

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA----LIPVIL 346
               +L+  R++   + V  G+  GF  + I   ++S+G+SG+L P  AA    LI V+ 
Sbjct: 289 GIPFALKTGRTSGVAMGVGAGVAIGFAYFIINAAVQSYGRSGVLPPFVAAWGANLIFVLT 348

Query: 347 TISLSILILLQ 357
            I LS+ +  Q
Sbjct: 349 GIWLSMTVKQQ 359


>gi|119383652|ref|YP_914708.1| permease YjgP/YjgQ family protein [Paracoccus denitrificans PD1222]
 gi|119373419|gb|ABL69012.1| permease YjgP/YjgQ family protein [Paracoccus denitrificans PD1222]
          Length = 373

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 89/376 (23%), Positives = 162/376 (43%), Gaps = 22/376 (5%)

Query: 4   ILWRYFFKYYLK--TTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPL 61
           IL  Y  + +L+    +  + GA++  F+ID+ E   +  +  N  +S  A L+   +  
Sbjct: 2   ILSTYVARRFLRMLVMIAAIFGAIL--FLIDIVEQIRRFSD-ENIGLSGAAGLSLLNITA 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
               I+P IT++  I +F NL+R+SELV  RA G S  ++L    V + L G+  V V+N
Sbjct: 59  SFYSILPLITVLAGIALFLNLSRSSELVAIRASGRSGIRVLAAPAVTAALAGMLAVAVLN 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQD---------IFIGAKKIL 170
           P+  +  K   D + Q +  G +  S  D   W++ + P ++         + I A +  
Sbjct: 119 PVVAATTKRYDDAVAQMRSGGGQTVSVGDNAVWLRQALPTRNGNGDETSGQVVIRASRAS 178

Query: 171 PENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEY---QYGRIPIDKNSTT 227
           P+     D T +          R DA  A +     +L  + E+   Q     + + +  
Sbjct: 179 PDATTLYDATFMVFAPDTGPTRRIDAATARLTQGAWELTDIKEWPLTQPNPETMARTAPR 238

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSF--SNKSNIFHNYRAETQFYFLIVIPLMLV 285
           L +P  +    +  + F       + +  +F    +   F   R +  F   +  PL+L 
Sbjct: 239 LELPTDLTA-ARIRDSFGRPEAIPVWQLPAFIKGLERAGFSAQRHKVWFQMELARPLLLA 297

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
           AM  IAA  ++   R  +  ++V      G  L+ +  + +  G +G + P  A   P I
Sbjct: 298 AMIAIAAVFTMRHMRGRRMGLLVLGAFGCGIGLFFLRNLAQVLGDNGGIPPALAGWAPPI 357

Query: 346 LTISLSILILLQKEDG 361
           + +  ++  LL+ EDG
Sbjct: 358 VALLFALGALLRLEDG 373


>gi|224368912|ref|YP_002603074.1| putative permease [Desulfobacterium autotrophicum HRM2]
 gi|223691629|gb|ACN14912.1| putative permease [Desulfobacterium autotrophicum HRM2]
          Length = 359

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/377 (21%), Positives = 153/377 (40%), Gaps = 48/377 (12%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGEL-PNYSISRGAVLAATRVPLI 62
           IL RY+ K +  T  + ++  ++L   + ++ + N    L  N+S+ +G      ++P +
Sbjct: 3   ILHRYWLKEF--TRFFAIVQMLLLCIFLAVDYLSNMEKFLRSNFSLIQGLGYILLKIPFM 60

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI-------- 114
             Q  P   ++  IVVF  +NR +EL+  +  G+S++ LL P V+  ++L +        
Sbjct: 61  FVQFTPAGVVLATIVVFSLMNRNNELLALKGSGVSVYHLLKPVVLVGVILAMTMIFLGET 120

Query: 115 ---FTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP 171
              +T+   N I +S  K    +   W++   +  + II  +   NP  +   G      
Sbjct: 121 IVPYTMAKANHIRSSTLKKNKKIYATWENIWIRDGNKIIH-INYFNPADNSISG------ 173

Query: 172 ENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIP 231
                   T  +     KI  R DA+     + + +L  V+E      P D++    N  
Sbjct: 174 -------ITITSFGADFKIATRVDAENGRFDSGQWQLSNVLEQNN---PGDEH----NAD 219

Query: 232 IKMDGFQKFSEQFASRSFYEIIKK---MSFSNKSNIFHNYRAE--------TQFYFLIVI 280
           I+    + F+          + KK   MS        H    E          F+  I  
Sbjct: 220 IQFYDHKAFALDVEPADLKTVAKKTDQMSIQELKAYIHKIENEGYDATHYIVDFWAKIAF 279

Query: 281 PLMLVAMTLIAASVS-LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           P++ + M L+ A    L  ++ N P + +A GI   F  + +     S G  G++ P  +
Sbjct: 280 PIICLVMALVGAGAGMLSAAKENMP-LGIALGIGVAFCYWVVHGFCTSLGYGGMIPPFLS 338

Query: 340 ALIPVILTISLSILILL 356
           A    ++ I L+ + L+
Sbjct: 339 AWTADLIFICLTTIFLV 355


>gi|189345952|ref|YP_001942481.1| permease YjgP/YjgQ family protein [Chlorobium limicola DSM 245]
 gi|189340099|gb|ACD89502.1| permease YjgP/YjgQ family protein [Chlorobium limicola DSM 245]
          Length = 360

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 85/376 (22%), Positives = 163/376 (43%), Gaps = 49/376 (13%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPL 61
           +L+R+ F+ ++ +   FL  ++    +  L  +   + E  +  I    ++      +P 
Sbjct: 3   LLYRHIFRQFMTS---FLFASIAFAALFTLITMVENLDEFFDRGIGISGIVWYYLLALPS 59

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL--- 118
             Q   P   L+ +I+    L+ +SEL   R+ G+ + QL+ P+V+G +L+    +L   
Sbjct: 60  TFQITAPVAALLASILTAGRLSASSELAAIRSAGVGMSQLMRPYVLGGLLISGINLLNAS 119

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW-- 176
            + P A + EKI  +     K   ++ +S +       +   +I +    I PEN I   
Sbjct: 120 FLEP-AAAKEKISFE-----KQVLNETRSGL-------HEGTNIHV----IEPENRIVTI 162

Query: 177 EDF-------TSITIDKKN--KIIHRKDA-----DLAIIYNDKVKLKKVVEYQYGRIP-- 220
           E F       + +T+++ N  ++I RKDA     D AI   D+  ++K     +G  P  
Sbjct: 163 ESFDAKHLQASKVTVEQFNGSRLISRKDASRMVFDPAI---DRWIMQKAAIRSFGADPGE 219

Query: 221 --IDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLI 278
                 + TLN+ + +   Q+ S Q    +  +  + +    ++      RA  + +   
Sbjct: 220 ISFSTGNDTLNLLLSIQSLQELSLQPEEMNLMQHYRYVKEKMQAGFPGLDRARVKLHAKT 279

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
            +PL  + +  I   +S    RS     I A  +F GF+   +   + S G +GI+ P  
Sbjct: 280 ALPLASLVIIFIGVPLSTVKKRSGLAAEI-AIALFIGFLFLGMQKTVASLGYNGIIEPWI 338

Query: 339 AALIPVILTISLSILI 354
           AA +P+IL +    L+
Sbjct: 339 AAWLPIILFLGAGALL 354


>gi|16125407|ref|NP_419971.1| hypothetical protein CC_1155 [Caulobacter crescentus CB15]
 gi|221234150|ref|YP_002516586.1| hypothetical protein CCNA_01213 [Caulobacter crescentus NA1000]
 gi|13422473|gb|AAK23139.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220963322|gb|ACL94678.1| hypothetical membrane spanning protein [Caulobacter crescentus
           NA1000]
          Length = 353

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/344 (21%), Positives = 141/344 (40%), Gaps = 39/344 (11%)

Query: 12  YYLKTTLYFLLGA-MILVFVIDLNEIQNQMGELPNYSISRGAV--LAATRVPLIIQQIIP 68
           Y L+T    +LGA +IL+ V+ + ++ +   ++ +  +    V   AA R+P + +Q+ P
Sbjct: 6   YVLRTVATRILGAALILMSVLQILDLLDVTSDILDRGLGMAGVGYYAALRLPRLFEQVAP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLN---PFVVGSILLGIFTVLVINPIAT 125
              L   +  F  L R S +V  RA GIS ++++    P  V  +LL      V+ P A 
Sbjct: 66  IAVLAGGLFAFSQLARESAIVAMRASGISGYRIVGMAVPAAVAVMLLDALCGQVLAPRAD 125

Query: 126 SGEKIGIDLIQQWKDNGD-KQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
                   L   W++     ++ + +P  +      D+ IGA        I    T +TI
Sbjct: 126 P------TLADWWRNTTPVAERKEPVP--RTFRAGADLVIGANASADGRTI----TGVTI 173

Query: 185 ---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-GRIPIDKNSTTLNIPIKMD----- 235
              D K  ++ + +A  A        L++    ++ G +     +   + P  +      
Sbjct: 174 FRRDSKGILVEKVEAPAARYDGKAWTLEQPKTTRFAGDLSQASTAAATSWPTALRPQDVQ 233

Query: 236 ---GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAA 292
              G        ++R   E       S++   F+    +  F      P + + M L++A
Sbjct: 234 GLFGDDSMPTAASARRALE----NGGSDRPESFYATHLQAAF----ASPFVSLVMLLLSA 285

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLP 336
            V+L   RS Q  +++  G+ +G M      ++ + G+SG L P
Sbjct: 286 PVALANFRSGQGAVLLTGGLAAGLMFLVANGMLTALGESGALTP 329


>gi|158521443|ref|YP_001529313.1| permease YjgP/YjgQ family protein [Desulfococcus oleovorans Hxd3]
 gi|158510269|gb|ABW67236.1| permease YjgP/YjgQ family protein [Desulfococcus oleovorans Hxd3]
          Length = 359

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 131/305 (42%), Gaps = 23/305 (7%)

Query: 48  ISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP-FV 106
           +SR AV    ++PLI+ Q  P   L+ ++VVF  +NR +E+   ++ GI    L  P  V
Sbjct: 46  LSRMAVFFLFKIPLIVVQTAPVGVLIASLVVFGLMNRRNEVTALKSSGIGPASLFKPAAV 105

Query: 107 VG---SILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIF 163
           VG    +LL I + +V+    +    I +  ++Q K +   QK++I  W++         
Sbjct: 106 VGVGCCVLLLIVSEIVVPRTISRANYIWLQQVRQ-KTSSVDQKNNI--WLK----DDRTI 158

Query: 164 IGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY---GRIP 220
           +  +   P      D     +D+  ++  R DA   +    +  L+ V++ Q+   G + 
Sbjct: 159 VHIRHYQPREKKAFDVVLHDLDEGFRVTRRIDAARGLYDGGQWTLRNVLDQQFDVAGNVQ 218

Query: 221 IDKNSTTLNI-----PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFY 275
           + +    L I     P  +D   + +++       + I+++     S + H      +  
Sbjct: 219 LVEFRERLKIELDLLPEDLDRAAESADEMGFVQLLDRIRQVERQGYSVVSHRVDLHAKLS 278

Query: 276 FLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL 335
           F    P + + M LI A++ +            AYG+ + F+ +   +   S G  G+L 
Sbjct: 279 F----PFVCLLMGLIGAALGIMGRTRGGITANAAYGVGASFVYWIFHSFCISLGYGGMLP 334

Query: 336 PVAAA 340
           P+ AA
Sbjct: 335 PLIAA 339


>gi|117925963|ref|YP_866580.1| permease YjgP/YjgQ family protein [Magnetococcus sp. MC-1]
 gi|117609719|gb|ABK45174.1| permease YjgP/YjgQ family protein [Magnetococcus sp. MC-1]
          Length = 371

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/374 (20%), Positives = 152/374 (40%), Gaps = 21/374 (5%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           MP IL+RY  + +L+  +      + L F++D  E   + G   +        L   R+P
Sbjct: 1   MP-ILFRYLLQLFLQGFVKVFSIFIALFFLMDGAEQIRRFGGRDHVIWQDMVELIFLRMP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
               Q +P I L+  + V   L R +EL + R+ G+S+ ++L PF++G +++    +L++
Sbjct: 60  HFFTQFLPPIALLTTLFVVTRLTRLNELTVIRSGGVSLVRILIPFLLGGVMVAGVQMLLL 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIF--------IGAKKILPE 172
           + I           I  ++ N  +Q +     + +   ++D          + AK+   +
Sbjct: 120 DQIVPRTNAAAERSI--FRMNLPEQAALYESMVSLEGVRKDNLWIRDGGQILHAKRAYGD 177

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-GRIPIDKNSTTLNIP 231
             +  + T      ++ ++ R DA  A   N+   L     Y++ G     +  T +   
Sbjct: 178 KRLLLEVTIFRFTPEHDLLMRADAHKATWENEGWVLHNGQIYRFNGHTTQSEPFTRMPWA 237

Query: 232 IKMDGFQ--KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAE---TQFYFLIVIPLMLVA 286
           I ++  Q  + + Q    S   + K      +      Y A       Y  +  PL  +A
Sbjct: 238 INLEKEQIKRATPQPEELSLQALWKHADRLARE----GYDATPYWVTLYRKLADPLTTLA 293

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
             L+A   +L   R       +  G  +GF ++ ++ +  + G    L P  AA  PV+ 
Sbjct: 294 AILLAFPFALRLHRMGGTFRSMLMGFITGFFMFVVVDLFTALGFGERLPPFLAAFAPVMF 353

Query: 347 TISLSILILLQKED 360
            I +   +LL  E+
Sbjct: 354 FICIGGFLLLHLEE 367


>gi|95928710|ref|ZP_01311456.1| permease YjgP/YjgQ [Desulfuromonas acetoxidans DSM 684]
 gi|95135055|gb|EAT16708.1| permease YjgP/YjgQ [Desulfuromonas acetoxidans DSM 684]
          Length = 360

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/314 (21%), Positives = 133/314 (42%), Gaps = 16/314 (5%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL-GI 114
           A ++PLI+ Q++P   L+   +      +T+EL   RA GI + +++ PF+V ++LL GI
Sbjct: 54  AWKIPLIVSQMLPLTILLGTFLTLGGFTKTNELTAMRAGGIGLQRIVTPFLVTAVLLTGI 113

Query: 115 FTVL--VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
              L   + P+ T           + K     +++D+  W + +N    I +     LPE
Sbjct: 114 NFALNEFLVPVGTQRSNHIFRTEVKGKTQMLAKRNDL--WFREANTLYHIQLA----LPE 167

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVV----EYQYGRIPIDKNSTTL 228
                  +   +D +  ++ R +A  A    D+ + + V     + Q  ++   K     
Sbjct: 168 KKQLRGISLYLVDSQLNLLTRIEAQAATFKEDQWQAEHVTVRHFDPQSRQLTAQKEENLR 227

Query: 229 NIPIKM--DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            +P+K   + F   S +    SF + + K+S   +       R     +  +  P   + 
Sbjct: 228 LLPLKKTPEDFGTVSGKNEELSFTQ-LSKISTQMQREGLDATRYRVDMHSRLSTPFACII 286

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
           M  +A   +L+ SR+    + ++  +  G   + + + + + G S +L P  AA    I+
Sbjct: 287 MAFLAIPFALQKSRNVNLSLGISISVLIGISFFIVQSTLIALGYSTVLPPFIAAWAANII 346

Query: 347 TISLSILILLQKED 360
              + + +LL   D
Sbjct: 347 FALVGLFLLLSTRD 360


>gi|296283031|ref|ZP_06861029.1| permease [Citromicrobium bathyomarinum JL354]
          Length = 365

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/332 (20%), Positives = 136/332 (40%), Gaps = 19/332 (5%)

Query: 38  NQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
            Q+ E+P  + +   + A+ RVP++IQ+ +P+  L+  I+    LN+ SE++  +A G+S
Sbjct: 44  GQILEVPGNTEADLWLYASLRVPMLIQRFLPYSVLLATIITLVTLNQNSEVIAMKAAGLS 103

Query: 98  IWQLLNPFVVGSILL-GIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQIS 156
             Q+L P +V ++L+ GI        +  +  ++      ++    DK KS    +++  
Sbjct: 104 AHQVLAPLIVTALLVAGISFAFNERVVTRATAQLTAWEATEFGALPDKPKSKGSIYLEDG 163

Query: 157 NPQQDIFI-------GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLK 209
              Q+I         G    L       D T        +I  + DA +A+   D   ++
Sbjct: 164 ---QNILTARSYSGGGPAPTL------RDVTYYRRSPTAEITQKVDAPMAVHGPDGWAMQ 214

Query: 210 KVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE-QFASRSFYEIIKKMSFSNKSNIFHNY 268
               +  G   + + S     P       +  E    ++ F+++   +    ++      
Sbjct: 215 NPSVFTVGTASLAQPSQLTVAPGITPATIELQEIDPTTQPFWQLGSSIEAYRQAG-RDTE 273

Query: 269 RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF 328
             E  ++  I  PL  V M ++ A      +RS Q  +    G+  GF  + I     + 
Sbjct: 274 ELEANYWHKISGPLAAVLMPILGAVAGFGLARSGQLFMRALIGMALGFAYFVIDNAALAM 333

Query: 329 GKSGILLPVAAALIPVILTISLSILILLQKED 360
           G  G   P  AA  P +L + +   +L++ E+
Sbjct: 334 GDFGGYPPFLAAWAPFLLFLMIGETVLVRTEE 365


>gi|319789792|ref|YP_004151425.1| permease YjgP/YjgQ family protein [Thermovibrio ammonificans HB-1]
 gi|317114294|gb|ADU96784.1| permease YjgP/YjgQ family protein [Thermovibrio ammonificans HB-1]
          Length = 354

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 140/309 (45%), Gaps = 15/309 (4%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           R+PL   ++IP  TL+  +V     + TSEL ++RA+GIS ++   P V+  +L  + +V
Sbjct: 55  RLPLYGVRVIPIATLIATMVTLSRFSETSELTVARALGISTYRFSAPLVILGVLASVASV 114

Query: 118 LVINPIATSGEKIGIDLIQQWKD---NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
            V   +  +G K   ++  +  +   NG ++    +P +   +   D F+   ++LP+N 
Sbjct: 115 AVQETLLPAGLKRATEIALKAGEEVTNGPQK----VPGVWFKDRAGD-FVFFWELLPKNK 169

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGRI-PIDKNSTTLNIP 231
             E  + I + K      R DA+ A IY    +  L++V    +  +   +K +  +N+ 
Sbjct: 170 RAERVSIIKV-KDFSPTGRIDAEEA-IYKGGGRWLLREVFVRDFKELKSTEKETLPINLG 227

Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
           + +           +    E+   +   +K N   NY    + Y  + + L+ V   +I 
Sbjct: 228 VSVKELLLSVNNPEAMGLLELFLTIKRLSKLNYDTNY-LRVELYSKLALGLLPVITAIIG 286

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLS 351
               +   R+ +   ++   I    M  T +++  S GKS +L P+ AA  P++L  ++ 
Sbjct: 287 IPFGVYNPRNKKGYTVLLAAIIVVSMWIT-VSLFLSLGKSEVLPPLYAAFAPLLLFGAVG 345

Query: 352 ILILLQKED 360
           + +L + E 
Sbjct: 346 LFLLGRVES 354


>gi|242279363|ref|YP_002991492.1| permease YjgP/YjgQ family protein [Desulfovibrio salexigens DSM
           2638]
 gi|242122257|gb|ACS79953.1| permease YjgP/YjgQ family protein [Desulfovibrio salexigens DSM
           2638]
          Length = 376

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 79/370 (21%), Positives = 163/370 (44%), Gaps = 39/370 (10%)

Query: 1   MPGILWRYFFKYYLKTTLYFL---LGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA-- 55
           +PG    Y   Y LK  ++ +   LG    +++  L+++ +++ +     +  G +L   
Sbjct: 6   LPG----YLASYVLKQNIFLMCVCLGVGTGIYL--LSDLFDRLDDFIEAGLGMGTILKYF 59

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
             ++PLI  QI+P + L+  IV    + R+ EL+  R  G+S+   L  FV+ +++    
Sbjct: 60  LVKMPLIFSQILPAVFLISMIVQLCVMARSKELLALRTGGLSLIWFLRFFVIYAVIWSFG 119

Query: 116 TVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHI 175
            +L    I   GE+   +  + WK++  K   D      I   +    + AK+++P  + 
Sbjct: 120 QLLFSQVIGVYGEQ---EAYRIWKEDVRKSMLDKRVLKNIWLKEGRFVVEAKEVMPFGNR 176

Query: 176 WEDFTSITIDKKN----KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST-TLNI 230
            +D T     + N    ++I  + A+++  Y    KL+  VE    +    K+   T+ I
Sbjct: 177 AKDITVYEFAEGNGGIKRVITSESAEVSSKYG--WKLENAVELSPDKFASQKHPIFTMPI 234

Query: 231 PIKMDGFQKFS-----EQFASRSFYEIIKKMSFSNKS--NIFHNYRAETQFYF-LIVIPL 282
            + ++ F+         Q       ++I+++  S  S   +   + ++  + F L+ + L
Sbjct: 235 KLNLNVFKVVDPDIDPAQLPLWQLDQVIEQLKLSGSSVDRLITAWHSKWAYAFSLLTMAL 294

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
           + +A+  I  ++ L           +  G+   F  Y +  +  S G +G L P+ AA +
Sbjct: 295 VSLALVTITENIYLN----------IGLGLAIIFTYYALFMVGASAGDTGALPPIVAAWL 344

Query: 343 PVILTISLSI 352
             IL  SL++
Sbjct: 345 GNILVSSLAL 354


>gi|254468723|ref|ZP_05082129.1| permease YjgP/YjgQ [beta proteobacterium KB13]
 gi|207087533|gb|EDZ64816.1| permease YjgP/YjgQ [beta proteobacterium KB13]
          Length = 355

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 82/362 (22%), Positives = 154/362 (42%), Gaps = 29/362 (8%)

Query: 10  FKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN--YSISRGAVLAATRVPLIIQQII 67
           F++++  +L     A+ LVF+    +   ++G L +  Y +S+  V     +P  + +II
Sbjct: 9   FEFFINISLV----AIGLVFLFAFFDFLQEIGNLNSGKYDLSKIIVFITLSMPGHLYEII 64

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           P   L+  +     L+  SELV+ R  G+SI Q+ +  ++ S+  G+ T +V N I    
Sbjct: 65  PLSCLIGAMFTVGQLSGNSELVVMRTSGMSILQIASSLIIVSLFFGVLTFMVGNLITPVS 124

Query: 128 EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HIWE---DF 179
           EK    +     D           WM+  N     F+  + +LP+      HI+E   DF
Sbjct: 125 EKNAQQIKISSTDGSVTTDFKSGVWMKDGNN----FVNIENVLPDASLRNIHIYEFDNDF 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVE--YQYGRIPIDKNSTTLNIPIKMDGF 237
           +  +I    K  +       I   +K+K   +++  +    +P    S T    IK +  
Sbjct: 181 SLRSIVDAEKGRYEN----GIWELEKIKQSFILDEGFDVKTLP----SGTWKSMIKPEMM 232

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
                     S +++   +++  K+N     R E  F+  I+ P+M + M L A      
Sbjct: 233 NVLLISPDRMSIFDLNDFINYLKKNNQ-KTSRYEVSFWEKIIQPVMPIIMILFAVPFGFF 291

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
             RS    + +  GI  G +   + ++M+  G      P+  A+IP I+ + ++I ++  
Sbjct: 292 QERSGGKYLKMFLGIIFGIIYQIMNSMMRHIGVLNDWEPIITAIIPSIVILGIAIYLMFY 351

Query: 358 KE 359
            E
Sbjct: 352 FE 353


>gi|323140935|ref|ZP_08075848.1| permease, YjgP/YjgQ family [Phascolarctobacterium sp. YIT 12067]
 gi|322414673|gb|EFY05479.1| permease, YjgP/YjgQ family [Phascolarctobacterium sp. YIT 12067]
          Length = 363

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 82/378 (21%), Positives = 151/378 (39%), Gaps = 46/378 (12%)

Query: 7   RYFFKYYLKTTLY---FLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT------ 57
           R   +Y LK  LY   F + A   +F+         + ++  Y    GA L         
Sbjct: 4   RLLDRYVLKELLYPFVFGIAAFSSIFIAS-----TMLFKITQYMTKYGAPLETVARLFMY 58

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
            +P +I    P   L+  ++ F  L+ +SE+   +A G+S ++++ P +V    + +F++
Sbjct: 59  NLPEVINYTFPMSMLLAALMAFGKLSGSSEITAMKAGGVSYYRIVAPVLVVGFFVSMFSM 118

Query: 118 LVINPIA-TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
           +    +  TS  K  I L ++ + N      + I    IS   Q +    K     +   
Sbjct: 119 VWAEKVVPTSKAKASIILNEEIRHNTRPTTQNHIIIKTISGDTQRVTYANKF----DEKL 174

Query: 177 EDFTSITIDK--KNKIIHRKDADLAIIYN--------------DKVKLKKVVEYQYGRIP 220
              T ITI++  K KI   + A      N              DK  ++   +++   IP
Sbjct: 175 GKMTDITIEEFNKGKIARIQTAKEGYWENGSWRIVDGNVFALDDKDGVQSSAKFKEQIIP 234

Query: 221 IDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVI 280
           ++ +      P ++   QK  E+   R   E I  +   + S      R   + +  I I
Sbjct: 235 LNFS------PKQISWEQKEPEEMTIRELREYISMLEEQHTSAA----RQWCEIFMRINI 284

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           PL      +I A +  +  R++   I +   I   F+ Y I+T     GK G + P+ A 
Sbjct: 285 PLASFFFAMIGACLGTQKQRTSS-SIGLGISIIVIFIYYAIMTFTTGLGKGGAMPPLLAC 343

Query: 341 LIPVILTISLSILILLQK 358
            +P IL + + + ++ +K
Sbjct: 344 ALPNILCLGVGVYLMKKK 361


>gi|291287414|ref|YP_003504230.1| permease YjgP/YjgQ family protein [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884574|gb|ADD68274.1| permease YjgP/YjgQ family protein [Denitrovibrio acetiphilus DSM
           12809]
          Length = 361

 Score = 56.2 bits (134), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 81/371 (21%), Positives = 157/371 (42%), Gaps = 32/371 (8%)

Query: 9   FFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGE---LPNYSISRGAVLAA--TRVPLII 63
           F KY +K  L+     ++ VFV  +  I N       L  Y+IS   ++     + P ++
Sbjct: 4   FNKYIIK--LFVQYTVIVQVFVAIITLIANTFQHTKMLSEYNISFMTLIVYDLMKTPYLL 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI---FTVLVI 120
              +P   ++  ++V   L + +EL+   ++G  I  L  PF+V  I L +   F+  VI
Sbjct: 62  YTTMPMTIVISTMLVMVTLLKNNELIAYVSLGGKIRNLAYPFIVSGIFLSVLLYFSADVI 121

Query: 121 NP-IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP I    E+   + I+    N   + +D+  W++ S+     FI    + P        
Sbjct: 122 NPKIMLERERFAYENIKNRTFNVSGKLTDM--WLKESDSS---FININLMDPTEKKIIGI 176

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK-----M 234
           T   ++   ++ +    D A  Y  K   K    +    +P+  +S    I  +     +
Sbjct: 177 TEYHLNNNFQVDYIVTYDSAEYYEGKWIEKNKKVFAMDPVPVMTDSAEEVIQERELFDEL 236

Query: 235 DGFQKFSEQFAS----RSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
                 S +F S    R   EI+KK   +        Y++      +IVI L++  +   
Sbjct: 237 TSLPVLSPKFLSLKEVRRTAEIMKKQDINTAKYYLQLYKSYAHALSVIVIILVIFPL--- 293

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISL 350
                + F+R++    + +  +F+GF  + ++   +S GK+G+  P+AA  IP+     L
Sbjct: 294 ----CIGFNRNHSYIAVASKSLFTGFAYWMLMASFQSLGKTGLFSPLAANFIPIGAFFIL 349

Query: 351 SILILLQKEDG 361
           ++ ++ ++E  
Sbjct: 350 ALALIYRRERA 360


>gi|289523522|ref|ZP_06440376.1| membrane protein, YjgP/YjgQ family [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289503214|gb|EFD24378.1| membrane protein, YjgP/YjgQ family [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 369

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 130/309 (42%), Gaps = 43/309 (13%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           R+P +I   +P   L+  I+ F  L   SEL   RA GIS +++L P  + SIL+G F +
Sbjct: 64  RLPGVIVLTLPMAALLATILSFGKLATQSELTALRASGISFYRILRPVFLASILIGGFAL 123

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQD------IFIGAKKILP 171
           L+   +    ++   D I +++    +QK  ++        ++D      I+IG  K+ P
Sbjct: 124 LLNETLVPLADR-AADNIMRYEVA--RQKPSLLKEQMFLKEERDGALSRVIYIG--KLFP 178

Query: 172 ENHIWED--FTSITIDKKNKIIHRKDADLA----IIYNDKV-KLKK--------VVEYQY 216
           +    +D         +  +I+  K+ D       +YN +V  + K          E Q 
Sbjct: 179 QEGNMDDVLIQEFESGEITRILTAKNGDWKEGQWWLYNGQVFNVTKEGFVEPLFSFEKQQ 238

Query: 217 GRIPIDKNS--TTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQF 274
             +P+  +   T+   P KM  F+           Y  IK M+    S++   +      
Sbjct: 239 LSLPLSPSQVVTSSQDPKKMSAFE----------LYNYIKLMNVQG-SDVNSLW---VLL 284

Query: 275 YFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGIL 334
           +  + +P   V + L+ ASV     RS    + +   I   F  Y  ++  +S G+ G +
Sbjct: 285 HLRLAVPWASVVLALVGASVGAGTRRSGSG-MGIGVSILLVFAYYVFMSFCRSLGQGGYI 343

Query: 335 LPVAAALIP 343
            P+ AA +P
Sbjct: 344 PPLLAAWMP 352


>gi|149186432|ref|ZP_01864745.1| predicted permease [Erythrobacter sp. SD-21]
 gi|148830021|gb|EDL48459.1| predicted permease [Erythrobacter sp. SD-21]
          Length = 365

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 66/338 (19%), Positives = 139/338 (41%), Gaps = 39/338 (11%)

Query: 38  NQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
           N  GEL  Y        A+ RVP +IQ+ +P+  L+  ++    LN+ SE++  +A G+S
Sbjct: 52  NGQGELLKY--------ASLRVPQLIQRFLPYSVLLATLISLVTLNQNSEVIAMKAAGLS 103

Query: 98  IWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISN 157
             Q+L P ++ ++++G  + +    + T         ++ W        +D  P  + S+
Sbjct: 104 AHQVLAPLLLTALVVGGVSFVFNERVVTRATAT----LKAW------DAADWGPVPEESS 153

Query: 158 PQQDIFIG-AKKILPENHI--------WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKL 208
            + ++++     +L    +          D T      +  I+ + DA  A       +L
Sbjct: 154 VRANVYLADGSNVLTAAQLTGSGDAIRMRDVTWYRRSPEGTIVEQVDAARATYAGPGWRL 213

Query: 209 KKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFA-----SRSFYEIIKKM-SFSNKS 262
           + +  ++         S+T +  +  +G        A     +  F+E+ +++ +F +  
Sbjct: 214 ENIERFEVAA----AASSTGDSLVVGEGLTPDQIDLAKIDPDAVPFWELGERIDAFEDAG 269

Query: 263 NIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
                 RA  +++  +  PL    M L+ A  +   +RS Q  +    G+  GF  + + 
Sbjct: 270 RRTGEMRA--KWWHKLSGPLSSFLMPLLGAVAAFGLARSGQLFVRALIGMALGFAYFVVD 327

Query: 323 TIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
               + G  G   P+ AA  P  L   +   +L++ E+
Sbjct: 328 NAALAMGNFGGYPPLLAAWAPFFLFALIGETVLIRTEE 365


>gi|197119770|ref|YP_002140197.1| membrane protein [Geobacter bemidjiensis Bem]
 gi|197089130|gb|ACH40401.1| membrane protein, YjgQ-related protein [Geobacter bemidjiensis Bem]
          Length = 360

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 151/354 (42%), Gaps = 33/354 (9%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVF-VIDLNEIQNQMGELPNYSIS--RGAVLAATRVP 60
           IL RY  + Y+K  L   LG+ I ++ V+D  E   ++     Y  S    A+   T++P
Sbjct: 3   ILTRYIARAYVKM-LSLCLGSFIAIYLVVDFME---KVSRFTRYGASWKHLALFFITKIP 58

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            +I    P   L+  ++    L+ TSEL   R+ G+S++++  P +V S+L+ +  VL I
Sbjct: 59  EMIIDAAPLAVLMATLLTLGTLSLTSELTAIRSCGVSLFRISLPILVISVLMSL-GVLAI 117

Query: 121 NPIA---TSGEKIGID--LIQQWKDNGDKQKSDIIPWMQISNP--QQDIFIGAKKILPEN 173
                  T  ++  I   LIQ+   +   ++ +I  W +      +  +F  A+  L   
Sbjct: 118 GEFVLPKTYAQRTYIQEVLIQKKSPSAFFRQQNI--WFREEGTVLRASLFEPARNELKGI 175

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
            +WE           + + R +ADLAI+       +  V  Q+    +        +P++
Sbjct: 176 TLWE-----LQPGTGEPLKRTEADLAILGAKGWMFRDAVVRQFRDGEVSSTQKYRELPVE 230

Query: 234 MD-------GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
           +           KFS+  +        +K+    +++ +   R  TQ +  I +P     
Sbjct: 231 LQLKPADLKTLGKFSDSMSLVELSRYCRKL----RASGYDPTRYVTQMHSRISMPFGCAV 286

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           M  +    +L   RS+     V   I  GF+   + +++ S G+ G+L PV AA
Sbjct: 287 MAFLGIPFALRGGRSSGIAFGVGLSIGVGFLYVIVNSVIISVGQVGLLPPVVAA 340


>gi|78222462|ref|YP_384209.1| permease YjgP/YjgQ [Geobacter metallireducens GS-15]
 gi|78193717|gb|ABB31484.1| permease YjgP/YjgQ [Geobacter metallireducens GS-15]
          Length = 359

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 145/350 (41%), Gaps = 26/350 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSIS--RGAVLAATRVPL 61
           IL RY    YL+     L   + +  VID  E   ++G    +       A     ++P 
Sbjct: 3   ILTRYIASAYLRVFWLCLASFIAIYLVIDFLE---KIGRFLRFDPQWIHVAQFFLYKIPE 59

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV---- 117
           I  Q+IP   L+  ++    L+R SE++  R+ G+S+ ++  P +  +    +F +    
Sbjct: 60  IATQVIPLAVLMATLLTLGMLSRNSEIIAMRSCGVSLRKISAPILAIACAASLFVIVSNE 119

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           L++    +    I   LI++   N   ++++I  W    +      + A+   P++    
Sbjct: 120 LILPKTYSQMRFIEEVLIRKKSSNTFLRQNNI--W----HKDNKAILMARAFDPDHQTLR 173

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVV--EYQYGRIP----IDKNSTTLNIP 231
             T  +  +      R DA+       +  L KV   ++Q G +     I      LN+ 
Sbjct: 174 GVTLWSFSEGMTPSRRIDAEQGSWDGGQWTLWKVTVRDFQGGGVANTTQIASMPVNLNLQ 233

Query: 232 IK-MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
           I+ +    K+++        E I+K+    K   +   R E Q +  I +P   + M  +
Sbjct: 234 IEDLKVVDKYADNMGFLKLREYIQKL----KKGGYETTRYEAQMHSKISLPFASLIMAFL 289

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
               +L  SRS+   + +   I  GF  + I  I+ SFG++G+L  + +A
Sbjct: 290 GIPFALRGSRSSGVALGIGASIGFGFAYFIINAILISFGQTGVLPSLVSA 339


>gi|260886292|ref|ZP_05897555.1| membrane protein, YjgP/YjgQ family [Selenomonas sputigena ATCC
           35185]
 gi|330839725|ref|YP_004414305.1| permease YjgP/YjgQ family protein [Selenomonas sputigena ATCC
           35185]
 gi|260864011|gb|EEX78511.1| membrane protein, YjgP/YjgQ family [Selenomonas sputigena ATCC
           35185]
 gi|329747489|gb|AEC00846.1| permease YjgP/YjgQ family protein [Selenomonas sputigena ATCC
           35185]
          Length = 363

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 130/294 (44%), Gaps = 16/294 (5%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I     P   L+  ++ F  L+ +SE+   ++ G+S +++  P +V  +++ IF++L
Sbjct: 60  LPAIAIYTFPMSMLLAALLTFGRLSSSSEITAMKSCGVSFYRIAAPVIVLGVVVSIFSIL 119

Query: 119 VINPIATSGEKIGIDLIQ-QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               I         ++I  + + N   +  D I   +I + +    + A++        E
Sbjct: 120 FTEHIVPRANNAYENVIAYEIQGNAAPKSQDHIVIKEIKDGEMQRLMYARRYDAATETLE 179

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKK--VVEYQYGR----IPIDKNSTTLNI- 230
             T  + + + +  + +DA  A     +  + +  + E   G+    +  DK    +N  
Sbjct: 180 GVTLQSFE-QGETKYVQDAAYAKWEGTQWTMYRGAIYEVSGGKSEHTMRFDKQVLPINAG 238

Query: 231 PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
           P ++   QK  E+   +   + I+ M    ++      + ET+ Y  I IP+  +   +I
Sbjct: 239 PGRIVREQKKPEELTMKELRQQIELM----RTQFVDTKKLETELYQRITIPMASLVFAII 294

Query: 291 AASVSLEFSRSNQPR-IIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIP 343
              + ++ +RS+  R I ++  IF  F  Y ++T+  + G+SG L P  A  +P
Sbjct: 295 GVPLGIQPTRSSSSRGIGLSLLIF--FCYYVLMTLAGALGQSGALNPAYAVWLP 346


>gi|78188283|ref|YP_378621.1| hypothetical protein Cag_0302 [Chlorobium chlorochromatii CaD3]
 gi|78170482|gb|ABB27578.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 359

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 84/361 (23%), Positives = 162/361 (44%), Gaps = 37/361 (10%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATR----- 58
           IL RY F+ ++K    FL  A++ V +  +  +  ++G   ++ +S    L   R     
Sbjct: 3   ILERYIFQQFIKA---FLFTALVFVSLFIIINMIEKLGNFMDHHVS---ALEIARYYLLS 56

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I     P   L+ +I+V   L   +EL   R+ G+S+ QLL PF  G++LL +F   
Sbjct: 57  IPSIFLVTSPVSALLASILVAGKLATQNELPAIRSAGVSMRQLLTPFAWGALLLFLFNFF 116

Query: 119 VINPIA--TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
               +A  T       + +   K+ GD++  ++     + +  + I IGA      N I 
Sbjct: 117 NAGWLAPTTYSHNRTFEQLYLGKNAGDQETRNL---HLLDSGNRFISIGAF-----NPIN 168

Query: 177 EDFTSITIDKKN--KIIHRKDADLAIIYNDKVK---LKKVVEYQYG---RIPIDKNSTTL 228
           E   +++I++ +   +I R DAD ++ YN + K   + +V E  +    +    K + T+
Sbjct: 169 ESLNNVSIERLSGATMISRIDAD-SMHYNRRTKRWTMWRVTERYFSNGYQSFTTKPTATI 227

Query: 229 NIPIKMDGFQKFS---EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
            + ++     +     ++      Y+ +++   +  S +    R+  +F+  I +P   +
Sbjct: 228 RLALRPKALHEMRLQPDEITLPRHYQFLREKEEAGFSGL---ERSAVKFHNKIAMPFASL 284

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
            +TLI   ++    R      I A  +F GF+   I   +   G  G+L P+ AA +P +
Sbjct: 285 IITLIGVPLAARKKRGGIAAEI-AITLFIGFLYLGIQRTIAIAGYQGVLPPIVAAWLPNL 343

Query: 346 L 346
           L
Sbjct: 344 L 344


>gi|77919519|ref|YP_357334.1| hypothetical protein Pcar_1923 [Pelobacter carbinolicus DSM 2380]
 gi|77545602|gb|ABA89164.1| conserved hypothetical membrane protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 362

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/371 (20%), Positives = 142/371 (38%), Gaps = 35/371 (9%)

Query: 10  FKYYLKTTLYFLLGAMILVF--VIDLNEIQNQMGELPNYSISRGAVLA--ATRVPLIIQQ 65
           +  Y+  T + L G  I  F  +  L E   ++ +   Y  S    +A    + PLII Q
Sbjct: 5   YSRYILATFFRLFGLAIGAFAGLYLLVEFFERIDDFIEYHASVTLCVAYFLNKTPLIITQ 64

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT 125
           + P   L+   +      R+ ELV   A GIS+ ++  P +   +L  +  +     I  
Sbjct: 65  VAPLACLMAVFMTLGGFTRSGELVAMHAGGISLAKIAAPMLRMGLLFSLIILAANEVIVP 124

Query: 126 SGEKIGIDLIQQWKDNGD--KQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
              +    ++      G     K D I W++ +    +I    ++I P     +  T ++
Sbjct: 125 PSIQRARHILTTEVRGGPAVHYKQDKI-WLRHNRSILNI----RQIEPVQQTLKGITLLS 179

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL-----------NIPI 232
            DK  +I  R DA  A+    +   +  V  ++     D  S  L           ++P+
Sbjct: 180 FDKNFRIQQRFDAGSAVYSGGRWYCQDAVTRRF-----DTTSGNLLTEQRLAEKIEDLPV 234

Query: 233 KMDGFQ----KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMT 288
             + F+    K +E      F+ + KK+    K   ++  R +   +  I  P   + MT
Sbjct: 235 VPEDFKVPGSKRNEDLPISEFHRLGKKL----KREGYNPTRFQVDMHARIAAPFGCLMMT 290

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTI 348
            +    ++   R     + +A  +  G + + +   + +FG SG   P+ AA    IL +
Sbjct: 291 FLGIPFAIRKGRGASMALGIAISVAIGALYFILNATLLAFGYSGTFPPIIAAWSANILFL 350

Query: 349 SLSILILLQKE 359
                + L  E
Sbjct: 351 LFGTWLFLHSE 361


>gi|271498969|ref|YP_003331994.1| permease YjgP/YjgQ family protein [Dickeya dadantii Ech586]
 gi|270342524|gb|ACZ75289.1| permease YjgP/YjgQ family protein [Dickeya dadantii Ech586]
          Length = 356

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 79/363 (21%), Positives = 147/363 (40%), Gaps = 17/363 (4%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           +L RY  K    T +  L   + L  +I   +   ++G+   YS+    +     VP  I
Sbjct: 4   VLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLRKVGQ-GGYSVMGAGLYTLLSVPKDI 62

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ +   +
Sbjct: 63  EIFFPMAALLGALLGLGALATRSELVVMQASGFTRLQIAGSVMKTAIPLVLLTMAIGEWV 122

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           A +GE++  +   Q    G    +    W +  N     F+  +++  +N + +      
Sbjct: 123 APAGEQMARNYRSQMMYGGSMLSTQSGLWAKDGND----FVYIQRVAGDNEL-QGVNLYH 177

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-------GRIPIDKNSTTLNIPIKMDG 236
            DK +K++  + A  A+  N   KL +V E          G   +     T   P K+  
Sbjct: 178 FDKHSKLLSVRYAASAVYENGSWKLSQVEESDLNDSKQIGGSQTVSGEWKTNLTPDKLGV 237

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
                +  + R  Y+ IK +  S +       R +   +  +  PL +  M L+A S   
Sbjct: 238 VALDPDALSIRGLYDYIKYLRQSGQ----EANRYQLNMWSKLFAPLSVAVMMLMALSFIF 293

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
              RS    + +  GI  GF+ Y +  I         + PV  AL+P  L + +S+++LL
Sbjct: 294 GPLRSVPAGMRIVIGISFGFLFYVLDQIFGPLSLVYHMPPVLGALLPSALFLFISVMLLL 353

Query: 357 QKE 359
           ++ 
Sbjct: 354 KRR 356


>gi|332187143|ref|ZP_08388883.1| hypothetical protein SUS17_2304 [Sphingomonas sp. S17]
 gi|332012843|gb|EGI54908.1| hypothetical protein SUS17_2304 [Sphingomonas sp. S17]
          Length = 366

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 80/368 (21%), Positives = 140/368 (38%), Gaps = 31/368 (8%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  K +L  T   L   +I++  +D+      +   P    ++     + R P II  I+
Sbjct: 15  YMAKMFLLRTFAILFALVIVLQALDILSESGAILATPGNGEAQVWRYVSLRAPQIIAFIL 74

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV---INPIA 124
           PF  L+  I+ FF +N+ SE++  +A G+S  Q+L P +V S  + + +      I P A
Sbjct: 75  PFSVLLGTILTFFTMNQNSEVIALKAAGLSAHQVLAPLLVASAGVAVLSFAFNDRIVPRA 134

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
           T+        +  W      QK D  P    S  + ++++     L    + +   + T 
Sbjct: 135 TA-------TLSAW------QKVDYGPIPIDSGDRSNVWVRDGDDLISVDLVQGRGANTQ 181

Query: 185 DKKNKIIHRK-DADLAIIYNDKVKLKKVVEYQYG---RIPIDKNSTTLNIPIKMDGFQKF 240
                +  RK    L  I       +    +Q G   R  +     T +IP  + G    
Sbjct: 182 LGGVTLYDRKGGGSLQAIVRAPRGRRMGDGWQIGPATRFEVASGKLT-SIPSMIIGRGVT 240

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRA--------ETQFYFLIVIPLMLVAMTLIAA 292
            EQ    S       +SF   SN   + R         E   +  +  P+  + M L+ A
Sbjct: 241 PEQLTLASVNA--DGLSFKGLSNAIDDLREAGRPTKTLEGSLWHKLSAPMSAILMPLLGA 298

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSI 352
             +   +RS +  +    G+  GF  +       + G  G   P  AA  P++L   +  
Sbjct: 299 VAAFGIARSGKLFVRAVIGMALGFAFFVADNFSMAMGDLGAYPPFLAAWAPILLFFLIGE 358

Query: 353 LILLQKED 360
            +L + E+
Sbjct: 359 AVLFRTEE 366


>gi|37528300|ref|NP_931645.1| hypothetical protein plu4479 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787738|emb|CAE16851.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 359

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 90/371 (24%), Positives = 157/371 (42%), Gaps = 25/371 (6%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L+T L  L   + L  +I   E   ++G+    +IS G  +  + VP
Sbjct: 1   MFGVLDRYIGRTILQTILMTLFMLVSLSGIIKFVEQLRKVGQGEYTTISAGLYVLLS-VP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             IQ   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L I T+++ 
Sbjct: 60  KDIQIFFPMAALLGALLGLGTLATRSELVVMQASGFTRMQIAGSVMKTAIPLVILTMVIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN------- 173
             +A  GE++  +   Q    G    ++   W        D FI  ++I+ +        
Sbjct: 120 EWVAPQGEQMARNYRAQKMLGGSLVSTNKGMW----TIDGDDFIYIQRIVSDTEIKGVNI 175

Query: 174 -HIWEDFTSITIDKKNKIIHRKDADL----AIIYNDKVKLKKVVEYQYGRIPIDKNSTTL 228
            H  +D   +++      ++ KD DL     +  +D    KK+   Q  RI  D     L
Sbjct: 176 YHFNDDKKLLSVKYAASAVYDKDNDLWKLSQVEESDLTDSKKITGSQ--RISADWK--IL 231

Query: 229 NIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMT 288
             P +++      E  +    Y+ IK +  S +     + R +   +  I  PL +  M 
Sbjct: 232 LTPEQLNVVALEPEALSISGLYQYIKYLKQSEQ----ESGRYQLNMWKKIFAPLSVAVMM 287

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTI 348
           L+A S      RS    + +  GI  GF+ Y +  I         +  V AAL+P +L +
Sbjct: 288 LMALSFIFGPLRSVPMGVRIVTGISFGFLFYVLNEIFGPLSLVYSVPAVLAALLPSLLFL 347

Query: 349 SLSILILLQKE 359
           ++SI +LL++ 
Sbjct: 348 TVSIYLLLKRR 358


>gi|291532164|emb|CBL05277.1| Predicted permeases [Megamonas hypermegale ART12/1]
          Length = 361

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 151/318 (47%), Gaps = 31/318 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P II    P   L+  ++ F  L+  SE++  +A G+S  +L+ P +  S+ + IF++ 
Sbjct: 58  LPGIIVWTFPMSMLLAALLTFGRLSGNSEIIAMKACGVSFKRLVTPVIAFSLGVSIFSIG 117

Query: 119 VINPIATSGEKIGIDLIQ---QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHI 175
               +  +  +   DL++   Q   + + Q+  II  +Q  N Q+ ++  A+K   E   
Sbjct: 118 FNEYVVPASNQAYADLVRYEIQGNTSPESQEHIIIKQIQDGNIQRLVY--ARKYDAETGN 175

Query: 176 WEDFTSITIDKKNKIIHRKDADLA-------IIYN------DKVKLKKVVEYQYGRIPID 222
            ++  SI   ++ K++  ++A+ A       ++YN       +   ++++++    +PI+
Sbjct: 176 LDNL-SIQEFEQGKMVRVENAEYAKWSVDEWVMYNGVLYDLSQPNTERMMKFDSQVLPIN 234

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPL 282
           +       P ++   QK  ++   +   E I  M    KS      + E + Y    +P+
Sbjct: 235 QT------PKQIIKSQKKPDEMTIKELREQINIM----KSQYVDTKKLEIELYQRFTVPM 284

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
             +   LI A + ++ +RS+   I     I   F+ YT++T+  + G++  + PV A  I
Sbjct: 285 ASLMFALIGAPLGIQPNRSSS-SIGFGISIIIIFIYYTLMTLAGAIGQNSFIPPVIAVWI 343

Query: 343 PVILTISLSILILLQKED 360
           P I+T+ ++ + L++KE 
Sbjct: 344 PNIVTL-IAGIYLIRKES 360


>gi|222054622|ref|YP_002536984.1| permease YjgP/YjgQ family protein [Geobacter sp. FRC-32]
 gi|221563911|gb|ACM19883.1| permease YjgP/YjgQ family protein [Geobacter sp. FRC-32]
          Length = 357

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 73/336 (21%), Positives = 137/336 (40%), Gaps = 27/336 (8%)

Query: 18  LYFLLGAMILVF-VID-LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVN 75
           L   LG  I +F V+D L +I    G  P Y     A+   TR+P +I Q      L+  
Sbjct: 16  LCLCLGTFIAIFLVVDFLEKIGRFAGANPAYI----ALFFLTRIPEVICQTSAMAVLMAT 71

Query: 76  IVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL----VINPIATSGEKIG 131
           ++     + +SEL   R  G+S+ ++  P +V +  + I  +     V+      G+ I 
Sbjct: 72  LLTLGMFSMSSELTAMRGCGLSLGRIAMPILVIAFSVSILNLAINEYVLPRCIVQGQYIR 131

Query: 132 IDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKII 191
             LI++      K  +     M I +   +  + A    P +   +  T   +    +  
Sbjct: 132 EVLIEK------KSPNLFFRQMNIWHRDDNFILKANLFDPASGQLKGITVWRMGAGMQPE 185

Query: 192 HRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD-------GFQKFSEQF 244
            R DA  A +      L  VV  ++    I K S   ++P+ ++         +KFS+  
Sbjct: 186 QRLDAATAKLDAGGWLLTDVVAREFSESNIIKTSEVASMPVPLNLRATDLKVMRKFSDNM 245

Query: 245 ASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
             R      +K+    +   +   R   Q +  I +    + M  +    ++  SRS+  
Sbjct: 246 GIRELAAYCEKL----RKGGYDPTRYLAQMHGRISLAFAPLVMAFLGVPFAVRGSRSSGI 301

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
            + ++  +  GF  + + +I+ SFG++G+L PV +A
Sbjct: 302 ALGISASLGIGFGFFVLNSIVLSFGQAGVLSPVISA 337


>gi|261401001|ref|ZP_05987126.1| permease, YjgP/YjgQ family [Neisseria lactamica ATCC 23970]
 gi|269209118|gb|EEZ75573.1| permease, YjgP/YjgQ family [Neisseria lactamica ATCC 23970]
 gi|309378517|emb|CBX22870.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 356

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 80/378 (21%), Positives = 160/378 (42%), Gaps = 54/378 (14%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  +     T+Y LL  + L    ++      +G+  +Y I       A ++P    ++
Sbjct: 6   RYIIRQMTAMTVYTLLAFLALYSFFEILYETGNLGK-GSYGIWEMLGYTALKMPARAYEL 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +P  TL+  ++    L   SEL + +A G+S  +LL+       +L  F ++     A  
Sbjct: 65  MPLATLIGGLLSLGRLAADSELTVIKAGGVSTRKLLS-------VLSQFGLIFALATAAL 117

Query: 127 GEKIGIDLIQQWKD------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HI 175
           GE I   L Q+ ++      NG     +   W++    +Q+  I  +++LP++      I
Sbjct: 118 GEWIAPALNQKAENIKAAAINGKISTGNTGLWLK----EQNSIINIREMLPDHTLLGIKI 173

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKV-KLKKVVEYQYGRIPIDKNSTT-LNIPIK 233
           WE       + KN+++   +A+ A++ +D   +LK +     G   ++ +S    N+PI 
Sbjct: 174 WER------NDKNELVQATEAESAVLNDDGSWQLKNIRRSTLGEDKVETSSAAEENLPIS 227

Query: 234 MDGFQKFSEQFASRSFYEII----KKMSFSN-KSNIFH--NYRAETQFYFL-----IVIP 281
           +            R+  E++     +MS     + I H  N R  TQ Y +     +V P
Sbjct: 228 VK-----------RNLMEVLLVKPDQMSVGELTAYISHLENNRQNTQIYAIALWHKLVYP 276

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           +    M L+A + + + +R     + +  GI  G + +    +     +   + P  A +
Sbjct: 277 VAAWVMALVALAFTPQTTRHGNMGLKLFGGICLGLLFHFAGRLFGFTARLYGVPPFLAGI 336

Query: 342 IPVILTISLSILILLQKE 359
           +P  L   + I ++ ++E
Sbjct: 337 LPTALFALIGIWLIRKQE 354


>gi|152985629|ref|YP_001346669.1| hypothetical protein PSPA7_1284 [Pseudomonas aeruginosa PA7]
 gi|150960787|gb|ABR82812.1| membrane protein, putative [Pseudomonas aeruginosa PA7]
          Length = 355

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 80/357 (22%), Positives = 141/357 (39%), Gaps = 52/357 (14%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLN 83
           A++  F+ +LN+I        +Y I       A   P     ++P   L+  +V    L 
Sbjct: 27  ALLFAFIDELNDIS------ASYGIGEALRFIALTAPRRAYDMLPMAALIGCLVGLGTLA 80

Query: 84  RTSELVISRAIGIS----IWQLLNPFVV---GSILLGIFTVLVINPIATSGEKIGIDLIQ 136
             SEL I RA G+S    +W ++ P +V     IL+G +       IA SG  +      
Sbjct: 81  SNSELTIMRAAGVSLSRIVWAVMKPMLVLMLAGILVGEYVAPWTENIAQSGRALA----- 135

Query: 137 QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDA 196
             +  GD Q S    W +    Q   +I    + P N +    T    D++  +     A
Sbjct: 136 --QGGGDSQSSKRGLWHR----QGREYIHINAVQP-NGVLYGVTRYRFDEQRGLQSASFA 188

Query: 197 DLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEII--- 253
             A    D  +L+ V        P +K S  + +P      +++  Q + +    ++   
Sbjct: 189 KRARFETDHWQLEDVTTTLLH--PQEKRSEVVKLPT-----ERWDAQLSPQLLNTVVMEP 241

Query: 254 KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPR 305
           + +S S      H        N R    F+  ++ PL+  A+ L+A S      RS    
Sbjct: 242 EALSISGLWQYIHYLADQGLNNNRYWLAFWTKVLQPLVTAALVLMAISFIFGPLRS---- 297

Query: 306 IIVAYGIFSGFMLYTIITIMKS-FGKSGILL---PVAAALIPVILTISLSILILLQK 358
           + +   IF+G ++  +  I +   G S ++    P+ A +IP     +L+ L LL++
Sbjct: 298 VTLGQRIFTGVLVGFVFRIAQDLLGPSSLVFDFPPLLAVVIPAS-ACALAGLWLLRR 353


>gi|148556807|ref|YP_001264389.1| permease YjgP/YjgQ family protein [Sphingomonas wittichii RW1]
 gi|148501997|gb|ABQ70251.1| permease YjgP/YjgQ family protein [Sphingomonas wittichii RW1]
          Length = 364

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 72/318 (22%), Positives = 124/318 (38%), Gaps = 32/318 (10%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           R P II + +PF  L+  ++ F  LN+ SE++  +A GIS  Q+L P VV S+ +GI + 
Sbjct: 64  RTPQIIARFLPFAALLATLITFVTLNQNSEIISMKAAGISAHQILAPLVVASLGVGIVSF 123

Query: 118 LVINPIATSGEKI---GIDLIQQWKDNGDK---QKSDIIPWMQISNPQQDIFI------G 165
                  T  E++       +  W+D       +   I+P + + +    I        G
Sbjct: 124 -------TFNERVVARATATLTAWQDADYGPIPRDRGIVPNIWVRDGDDLIHATAVRGRG 176

Query: 166 AKKILPENHIWEDFTS--ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDK 223
           A+  L    I++      I+I K  + +        I    +  + K V  +       K
Sbjct: 177 AQARLDSVTIYDRDGGRLISIIKGERAVQAA-GGWRITGASRFDVAKGVTLRLAGFDFAK 235

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMS-FSNKSNIFHNYRAETQFYFLIVIPL 282
             T        D F   +   AS+S  ++   ++            RA    +  +  PL
Sbjct: 236 GVTA-------DRFTLANVDPASKSIVQLRTAIADLDAAGRPTGPLRA--GLWHKLSGPL 286

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
             V M L+AA  +   +RS    I    G+  GF  +       + G  G   P  AA  
Sbjct: 287 SAVLMPLLAAVAAFGLARSGHLFIRAVIGMALGFAYFVADNFALAMGNLGAYPPFLAAWA 346

Query: 343 PVILTISLSILILLQKED 360
           P +L + +   +L++ E+
Sbjct: 347 PFLLFLLIGETVLIRTEE 364


>gi|297537469|ref|YP_003673238.1| permease [Methylotenera sp. 301]
 gi|297256816|gb|ADI28661.1| permease YjgP/YjgQ family protein [Methylotenera sp. 301]
          Length = 356

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 80/371 (21%), Positives = 156/371 (42%), Gaps = 34/371 (9%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL +Y  K  +   L  +L  + +    DL +  + +G+  +Y + +  +      P  +
Sbjct: 3   ILNKYLLKEIVSNVLMVMLALIAMFSFFDLIQELDALGK-GSYGLGKILLFVLLSAPGHV 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             ++P   LV  +     L R SELV+ R  G+SI+ +    +    +  I T L+   +
Sbjct: 62  YDVMPVAVLVGCMYSLGQLARYSELVVLRVSGLSIFDIAVLLLKIGAIFTIITFLIGELV 121

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HIWED 178
               EK    +  +  D+   Q+     W++  N     FI  +++LP+      HI+ D
Sbjct: 122 TPFSEKTAQRMRIKATDSVVAQEFRSGLWVKDGNS----FINVEEVLPDATLLNIHIF-D 176

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST------TLNIPI 232
           F     DK  K+I  ++A      ++  KLK V +  + +  +  + +      +L  P 
Sbjct: 177 F-----DKNAKLISTRNAKAGEFKHESWKLKDVTDTSFDKDSVKVSQSLEATWHSLIRPE 231

Query: 233 KMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAA 292
            ++      E+ ++ + Y  I  +S + +       R E   +  ++ PL  + M ++A 
Sbjct: 232 LLNVLLIMPEKMSAWNLYTYINHLSINKQKTT----RYEVALWAKMIYPLACMVMVVLA- 286

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIM-KSFGKSGIL---LPVAAALIPVILTI 348
              L F    Q     +  IF G ML  +  I+ + F   G+L    P+ +A++P I+ +
Sbjct: 287 ---LPFGFVQQRAAGASTKIFVGIMLGVMYQILNRVFAHLGLLNDWPPLFSAIMPTIMFL 343

Query: 349 SLSILILLQKE 359
              + +L   E
Sbjct: 344 MAGVAMLFYVE 354


>gi|289649165|ref|ZP_06480508.1| hypothetical protein Psyrpa2_15669 [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 353

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 82/373 (21%), Positives = 156/373 (41%), Gaps = 50/373 (13%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVIN 121
              L+  ++    L  +SEL I RA G+SI    W ++ P    +V  +L+G +    + 
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLLLMVAGVLVGEY----VA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T 
Sbjct: 122 PYAENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              D +  ++    A  A    D  +LK V    +     D  +  +N P+     +++ 
Sbjct: 174 YRFDDQRHMLTSSFAKEANFKTDYWELKDVSTTHFN----DGRTEVINTPV-----ERWD 224

Query: 242 EQFASRSFYEII---KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLI 290
              + +    +I   + +S S   N  H        N R    F+  ++ P + VA+ L+
Sbjct: 225 VALSPQLLSTVIMPPESLSISGLWNYAHYLADQGLSNGRYWLAFWTKVLQPAVTVALVLM 284

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFML-YTIITIMKSFGKSGILL---PVAAALIPVIL 346
           A S      RS    + +   +F+G ++ +T   I    G S +L    P+ A L+P   
Sbjct: 285 AISFIFGPLRS----VTLGQRVFTGVVVGFTFRIIQDLLGPSSLLFGFPPLLAVLMPAA- 339

Query: 347 TISLSILILLQKE 359
             +L+ + LL++ 
Sbjct: 340 ACALAGVYLLRRS 352


>gi|289623814|ref|ZP_06456768.1| hypothetical protein PsyrpaN_01505 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298485820|ref|ZP_07003898.1| putative membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298159644|gb|EFI00687.1| putative membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|330867847|gb|EGH02556.1| hypothetical protein PSYAE_11466 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330890524|gb|EGH23185.1| hypothetical protein PSYMO_17663 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330989712|gb|EGH87815.1| hypothetical protein PLA107_32131 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009019|gb|EGH89075.1| hypothetical protein PSYTB_04820 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 353

 Score = 52.8 bits (125), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 82/372 (22%), Positives = 156/372 (41%), Gaps = 50/372 (13%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVIN 121
              L+  ++    L  +SEL I RA G+SI    W ++ P    +V  +L+G +    + 
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLLLMVAGVLVGEY----VA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T 
Sbjct: 122 PYAENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              D +  ++    A  A    D  +LK V    +     D  +  +N P+     +++ 
Sbjct: 174 YRFDDQRHMLTSSFAKEANFKTDYWELKDVSTTHFN----DGRTEVINTPV-----ERWD 224

Query: 242 EQFASRSFYEII---KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLI 290
              + +    +I   + +S S   N  H        N R    F+  ++ P + VA+ L+
Sbjct: 225 VALSPQLLSTVIMPPESLSISGLWNYAHYLADQGLSNGRYWLAFWTKVLQPAVTVALVLM 284

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFML-YTIITIMKSFGKSGILL---PVAAALIPVIL 346
           A S      RS    + +   +F+G ++ +T   I    G S +L    P+ A L+P   
Sbjct: 285 AISFIFGPLRS----VTLGQRVFTGVVVGFTFRIIQDLLGPSSLLFGFPPLLAVLMPAA- 339

Query: 347 TISLSILILLQK 358
             +L+ + LL++
Sbjct: 340 ACALAGVYLLRR 351


>gi|313668050|ref|YP_004048334.1| hypothetical protein NLA_7120 [Neisseria lactamica ST-640]
 gi|313005512|emb|CBN86948.1| conserved hypothetical integral membrane protein [Neisseria
           lactamica 020-06]
          Length = 356

 Score = 52.8 bits (125), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 79/378 (20%), Positives = 160/378 (42%), Gaps = 54/378 (14%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  +     T+Y LL  + L    ++      +G+  +Y I       A ++P    ++
Sbjct: 6   RYIIRQMTAMTVYTLLAFLALYSFFEILYETGNLGK-GSYGIWEMLGYTALKMPARAYEL 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +P  TL+  ++    L   SEL + +A G+S  +LL+       +L  F ++     A  
Sbjct: 65  MPLATLIGGLLSLGRLAADSELTVIKAGGVSTRKLLS-------VLSQFGLIFALATAAL 117

Query: 127 GEKIGIDLIQQWKD------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HI 175
           GE I   L Q+ ++      NG     +   W++    +Q+  I  +++LP++      I
Sbjct: 118 GEWIAPALNQKAENIKAAAINGKISTGNTGLWLK----EQNSIINIREMLPDHTLLGIKI 173

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKV-KLKKVVEYQYGRIPIDKNSTT-LNIPIK 233
           WE       + KN+++   +A+ A++ +D   +LK +     G   ++ ++    N+PI 
Sbjct: 174 WER------NDKNELVQATEAESAVLNDDGSWQLKNIRRSTLGEDKVETSTAAEENLPIS 227

Query: 234 MDGFQKFSEQFASRSFYEII----KKMSFSN-KSNIFH--NYRAETQFYFL-----IVIP 281
           +            R+  E++     +MS     + I H  N R  TQ Y +     +V P
Sbjct: 228 VK-----------RNLMEVLLVKPDQMSVGELTAYISHLENNRQNTQIYAIALWHKLVYP 276

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           +    M L+A + + + +R     + +  GI  G + +    +     +   + P  A +
Sbjct: 277 VAAWVMALVALAFTPQTTRHGNMGLKLFGGICLGLLFHFAGRLFGFTARLYGVPPFLAGI 336

Query: 342 IPVILTISLSILILLQKE 359
           +P  L   + I ++ ++E
Sbjct: 337 LPTALFALIGIWLIRKQE 354


>gi|91203264|emb|CAJ72903.1| hypothetical protein kustd2158 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 357

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 163/370 (44%), Gaps = 51/370 (13%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K +  T    LL       +IDL +  +   E+   S    +   A   P+II Q 
Sbjct: 7   RYLLKAFFPTFFLCLLIISGTYVIIDLLQKLDDFLEMGINSFGVASRYYAYLFPVIITQF 66

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P ITLV   +V   L+R  E++  +  GIS+++         ILL IF V V    A+ 
Sbjct: 67  FPAITLVAVGIVLVRLSRNKEILAMQVAGISLYR---------ILLPIFVVTVFMGFASF 117

Query: 127 GEKIGI--------DLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           G++  I        + +QQ   + D Q++     + + + + +  I   K   +    + 
Sbjct: 118 GDQEWIVPRFAEKLEAMQQNTFDSDVQRN-----LLVHDDENNALIRIWKYSNKTQKMDS 172

Query: 179 FTSITID---KKNKIIHRKDADLAIIYNDKVKLKKVVEYQY---GR--IPIDKNSTTLNI 230
              ++ D   KK   ++ K A+   I N+   L K++++ Y   GR   P+ +  T   +
Sbjct: 173 VFILSRDENGKKRFTLNAKKAEW--IGNNTWVLSKILKHVYDERGRWVAPVHRLDTLEFV 230

Query: 231 ----PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNI-FHNYRAETQFYFLIV---IPL 282
               P+++   +  S   +     E+ +K   + K+ + FH+  A T  + +++   IPL
Sbjct: 231 SSVTPLELGKKKLDSSLLSLEQLNELCEKEPDNPKNKVLFHSRIAYTLTHIVLLFLGIPL 290

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
            +V    ++ ++ L  S       I+A G+F     Y +  I  + G +G++ PV AA +
Sbjct: 291 -VVGFERMSKNIFLRVSLC-----ILACGVF-----YAVSFICSNLGNTGMVHPVLAAWM 339

Query: 343 PVILTISLSI 352
           P++L  S+ I
Sbjct: 340 PIVLFGSVGI 349


>gi|114798132|ref|YP_760297.1| putative permease [Hyphomonas neptunium ATCC 15444]
 gi|114738306|gb|ABI76431.1| putative permease [Hyphomonas neptunium ATCC 15444]
          Length = 351

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 132/312 (42%), Gaps = 29/312 (9%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIW---QLLNPFVVGSILLGI 114
           R+P +  +I+ F  L+  ++ + +L R +ELV   A GIS++   + L P V  + +   
Sbjct: 56  RLPALFDRIVVFAFLLAALLTYASLIRRNELVAISAAGISVFGQMRTLIPVVFLTAVAAA 115

Query: 115 FTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE-- 172
           F +  + P A+         +  W      Q+   +P        +++++   K L E  
Sbjct: 116 FIIDTVGPPASRS-------LLAWLGPEALQEDAQVP--------EELWLSDGKFLIELK 160

Query: 173 NHIWEDFTSITIDKKNK---IIHRKDADLAIIYNDKVKLKKVVEYQY-GRIPIDKN-STT 227
           +   E+ T ITI ++N    ++    A+ A   +    L    + ++ G  P D    T+
Sbjct: 161 SMQAEELTGITIFERNAEGAVVAITTAETARPADGGWALSGTGQRRFDGEPPTDMTFWTS 220

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
              P  +          A  +   + +     ++ +  +   A  +F    ++PL  V  
Sbjct: 221 PQTPESLQLLLSPPRDLAISNLIALSEMRGSGSRPSGAYELWALNRF----LLPLTAVGF 276

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
            L+A  V   + R +   I VA G+  GF    +  I+K+  ++G + P+ A  +P++  
Sbjct: 277 LLLAVPVMQVYGRRSNADIAVAAGVAVGFFYMVVDGILKTLAENGSISPILAVALPILAL 336

Query: 348 ISLSILILLQKE 359
              S+ + L++E
Sbjct: 337 FLGSMWLALERE 348


>gi|332160138|ref|YP_004296715.1| hypothetical protein YE105_C0514 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607296|emb|CBY28794.1| putative Permease [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664368|gb|ADZ41012.1| hypothetical protein YE105_C0514 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859698|emb|CBX70034.1| lipopolysaccharide export system permease protein lptG [Yersinia
           enterocolitica W22703]
          Length = 356

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 83/377 (22%), Positives = 159/377 (42%), Gaps = 39/377 (10%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L T L  L   + L  +I   +   ++G+  +YS +   +     +P
Sbjct: 1   MFGVLDRYIGRTILNTILMTLFMLVSLSGIIKFVDQLRKVGQ-GDYSAASAGMYTLLSIP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ + 
Sbjct: 60  KDIEIFFPMAALLGALLGLGTLATRSELVVMQASGFTRMQIAASVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE++  +   Q    G    +    W +  +     FI  +++  +    ++ T
Sbjct: 120 EWVAPQGEQMARNFRAQQMYGGSLLSTQSGLWAKDGSD----FIYIQRVSGD----KELT 171

Query: 181 SITI---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
            + I   DK+++++  + A  A   ++  +L +V E            + L+ P K+ G 
Sbjct: 172 GVNIYHFDKQDRLLSVRYAATATFEDNLWRLSQVDE------------SDLSNPNKVTGS 219

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKS---NIFHNY------------RAETQFYFLIVIPL 282
           Q  + ++ +    E +  ++ +  S   +  H+Y            R E   +  I  P 
Sbjct: 220 QTLTGEWKTNLTPEKLGVVAMNPDSLSISGLHDYSKYLRQSGQESSRYELNMWGKIFAPF 279

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
            +  M L+A S      RS    + V  GIF GF+ Y +  I         + PV  AL+
Sbjct: 280 SVAVMMLMALSFIFGPLRSVPMGVRVVTGIFFGFVFYVLDQIFGPLSLVYNIPPVIGALL 339

Query: 343 PVILTISLSILILLQKE 359
           P IL + +S+ +LL++ 
Sbjct: 340 PSILFLLISVYLLLKRR 356


>gi|39997021|ref|NP_952972.1| hypothetical protein GSU1923 [Geobacter sulfurreducens PCA]
 gi|39983909|gb|AAR35299.1| membrane protein, putative [Geobacter sulfurreducens PCA]
 gi|298506038|gb|ADI84761.1| membrane protein, YjgQ-related [Geobacter sulfurreducens KN400]
          Length = 358

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/349 (20%), Positives = 142/349 (40%), Gaps = 25/349 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAA--TRVPL 61
           IL RY    YLK     L   + +  VID  E   ++G L  +      ++     ++P 
Sbjct: 3   ILTRYIAGAYLKILGLCLASFVAIYLVIDFLE---KIGRLLRFQPRWIDIIQYFICKLPE 59

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
           II Q+IP   L+  ++    L+R SE+V  R  G+ + ++  P +V +  + + T+    
Sbjct: 60  IITQVIPLAVLMSTLLTLGMLSRNSEIVAMRGCGVGLGRISAPLIVIAAAVSLLTIFSNE 119

Query: 122 PIATSGEK----IGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
            +  S  +    +   LI++   N   ++++I  W    +  +   + A+   P      
Sbjct: 120 FVLPSSYRQMRYVDQVLIRKQGTNTFFRQNNI--W----HKDESAIMMARVFDPGRQALR 173

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNS-----TTLNIPI 232
             T        + + R DA        +   K V         ++  +       LN+ I
Sbjct: 174 GITLWRFSDGMRPVSRIDAAEGTWDGARWTFKTVTVRGLAGPSVETRTLASLPAELNLKI 233

Query: 233 K-MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
           + +    K+++        + ++K+    K+  +   R E Q +  I +P   + M  + 
Sbjct: 234 EDLKVVDKYADNMGFFKLRDYVRKL----KAGGYDTTRYEAQMHSKISLPFASLIMAFLG 289

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
              +L   RS+   + +   I  GF  +   +I+ SFG++GIL P+ +A
Sbjct: 290 IPFALRGGRSSGVALGITASIGIGFAYFITNSILISFGQTGILPPLISA 338


>gi|189219653|ref|YP_001940294.1| permease [Methylacidiphilum infernorum V4]
 gi|189186511|gb|ACD83696.1| Predicted permease [Methylacidiphilum infernorum V4]
          Length = 395

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/375 (21%), Positives = 154/375 (41%), Gaps = 58/375 (15%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDL-----NEIQNQM--GELPNYSISRGAV 53
           M  IL+RY FK +L   L+ ++    LV + DL     + IQN+   G++ +Y ++    
Sbjct: 26  MKKILFRYLFKGFLFPLLFTIVAFCSLVIIADLFGSLEDFIQNKATPGQIFHYYLAY--- 82

Query: 54  LAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG 113
                +P +I  I+P  +L  ++     L+R  EL+  +A G+ + ++  PF++  +L+ 
Sbjct: 83  -----LPAVIIMIVPPASLFSSLYFLMQLHRHGELIAMQACGVPLQKIFTPFLIIGVLVT 137

Query: 114 IF-TVLVINPIATS------------GEKIGIDLIQQ--WKDNGDKQKSDIIPWMQISNP 158
           +F   L + P   S            G K  +  ++   +K+  +K+         I N 
Sbjct: 138 LFLAALQLGPGGNSQAKRDQILEDIKGNKTAVHALRGIIYKEEAEKRIWYFRQLDFIKNQ 197

Query: 159 QQDIFI--------GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKK 210
            +D+ +          KK       W+D   I  +     ++R D D A   N+ ++   
Sbjct: 198 GEDVEVVVQENSGKDLKKYFARKAAWKDNHWIFYE-----VNRIDYDSA---NNFLQ--- 246

Query: 211 VVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRA 270
                +  +P+   +T    P +M   +K      +   +++I K   S +  +   Y  
Sbjct: 247 --STYFETLPLVSWNTP---PRQMVALEKKPRDLNASELWKLINKPR-SIQKTLLAPY-- 298

Query: 271 ETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGK 330
           + QFY L+  PL ++ + LI  +     S S  P   V   +F     Y I    +  G+
Sbjct: 299 QVQFYTLVAEPLTILVLLLIGLAEGGRLS-SRHPTAGVFNALFILIAFYLIFHFFQILGQ 357

Query: 331 SGILLPVAAALIPVI 345
              + P  A   P++
Sbjct: 358 GSRIPPAVAIFSPLV 372


>gi|253702061|ref|YP_003023250.1| permease YjgP/YjgQ family protein [Geobacter sp. M21]
 gi|251776911|gb|ACT19492.1| permease YjgP/YjgQ family protein [Geobacter sp. M21]
          Length = 360

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 83/351 (23%), Positives = 149/351 (42%), Gaps = 27/351 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVF-VIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
           IL RY  + YLK  L   LG+ + ++ V+D  E  ++       S    A+   T++P +
Sbjct: 3   ILTRYIARAYLKM-LSLCLGSFLTIYLVVDFMEKVSRFTR-AGASWKHLALFFITKIPEM 60

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL--LGIFTV--L 118
           I    P   L+  ++    L+ TSEL   R+ G+S++++  P +V S+L  LG+  +   
Sbjct: 61  IIDAAPLAVLMATLLTLGTLSLTSELTAIRSCGVSLFRISLPILVISVLMSLGVLAIGEF 120

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNP--QQDIFIGAKKILPENHIW 176
           V+         I   LIQ+   +   ++ +I  W +      +  +F  A+  L    +W
Sbjct: 121 VLPKSFAQRTYIQEVLIQKKSASAFFRQQNI--WFREEGTVLRASLFEPARNELKGITLW 178

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY--GRIPIDKNSTTLNI---- 230
            D    T     + + R +ADLA++      L+  V  Q+  G +   +    L +    
Sbjct: 179 -DLQPGT----GEPLKRTEADLALLGPKGWVLRDAVVRQFRDGEVSATQKYRELPVQLQL 233

Query: 231 -PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
            P  +    K+S+  +        +K+  S     +   R  TQ +  I +P     M  
Sbjct: 234 KPADLKTLGKYSDSMSLVELNRYCRKLRASG----YDPTRYVTQMHSRISMPFGCAVMAF 289

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           +    +L   RS+     V   I  GF+   + +++ S G+ G+L PV AA
Sbjct: 290 LGIPFALRGGRSSGIAFGVGLSIGVGFLYVIVNSVIISVGQVGLLPPVVAA 340


>gi|87121691|ref|ZP_01077578.1| permease YjgP/YjgQ [Marinomonas sp. MED121]
 gi|86162942|gb|EAQ64220.1| permease YjgP/YjgQ [Marinomonas sp. MED121]
          Length = 353

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 89/368 (24%), Positives = 161/368 (43%), Gaps = 44/368 (11%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
           G++W +F        ++ LLG   L +V+   E   ++ E   Y+IS    +   R+P  
Sbjct: 11  GVVWAFF------AVVFILLG---LDYVLTFIEQVKRISEF--YTISNLLEVLLLRLPSK 59

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQL----LNPFVVGSILLGIFTVL 118
             + IP  +L+  +V    L  TSEL + RA GI IW++    + P ++ S L+G+    
Sbjct: 60  FAEYIPIASLIGTLVGLGALASTSELTVIRAAGIPIWRIGWSAIKPILIIS-LIGVGISE 118

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSD--IIPWMQISNPQQDIFIGAKKILPENHIW 176
            I P A        +LI+  K    +Q SD  I   + I + ++ IFIGA      +   
Sbjct: 119 FIAPNADQRA----NLIENLK---KQQTSDNIISGGVWIRSEEKYIFIGAA-----DQKG 166

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYN--DKVKLKKVVEYQYGRIPIDKNST---TLNIP 231
             +     + KN+ +          Y   D+  L +V   Q+    I+ N+T   +L + 
Sbjct: 167 TLYNVKVFNSKNQTLQSTQIAKTAQYKTADEWTLNQVTNTQFLADKIESNNTNFESLTMT 226

Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
            K +     +++  + S  + I   ++    ++ +  R E +F+   + P+  +A+ LIA
Sbjct: 227 FKPEHLYLATQEPEALSLSQSISYQNYLEGQDL-NTSRYELEFWTKALRPVASIALVLIA 285

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTII-TIMKSFGKSGILL---PVAAALIPVILT 347
            S      RS+     +   IFSG M+  I    +  FG+  +     P+   LIP+ + 
Sbjct: 286 LSSVFGPLRSS----TMGSRIFSGVMIGIIFQNGLNLFGRMSLAADFSPLLGVLIPIAIC 341

Query: 348 ISLSILIL 355
           +++  L L
Sbjct: 342 LAIGTLQL 349


>gi|91774576|ref|YP_544332.1| permease YjgP/YjgQ [Methylobacillus flagellatus KT]
 gi|91708563|gb|ABE48491.1| permease YjgP/YjgQ [Methylobacillus flagellatus KT]
          Length = 356

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 78/364 (21%), Positives = 151/364 (41%), Gaps = 34/364 (9%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  +  + + +  +L  + +    DL +    +G+  NY IS+  +      P  + ++
Sbjct: 6   RYLAQEIVSSIMLIMLALLAMFSFFDLIQELESLGK-GNYGISKVLLYVLLSAPGHVYEV 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +P   LV  +      +R SEL+I R  GISI ++    +   ++  + T LV   IA  
Sbjct: 65  VPVAVLVGTMYALGQFSRYSELIILRVSGISIRKIAFSLLRVGLVFAVITFLVGELIAPM 124

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HIWEDFTS 181
            EK    +  Q  D+   Q      W++  N     F+  + ++P+      HI+E    
Sbjct: 125 SEKAAQRIRIQATDSVVAQDFRSGLWVKDGNS----FVNVQNVMPDASLMDIHIYE---- 176

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNS------TTLNIPIKMD 235
              D + ++    +A       +   L +V +  +    I  N        +L  P  ++
Sbjct: 177 --FDNEFRLRTISNAKEGSFDGNSWNLHQVTQTHFEEQKIRTNVFQEATWQSLIRPELLN 234

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
                 E+ ++ + Y  I  ++ SNK       R +   +  ++ PL  + M ++A    
Sbjct: 235 VLLVVPEKMSAWNLYFYINHLA-SNKQK---TSRHQIALWSKMIYPLACLVMVILA---- 286

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIM-KSFGKSGIL---LPVAAALIPVILTISLS 351
           L F    Q     +  IFSG ML  +  ++ + F   G+L    P+ +A++P +L ++  
Sbjct: 287 LPFGFLQQRSSSASTKIFSGIMLGIVYQVLNRVFVHLGLLNDWSPLFSAVMPTLLFMAAG 346

Query: 352 ILIL 355
           I +L
Sbjct: 347 IFML 350


>gi|123440875|ref|YP_001004866.1| hypothetical protein YE0502 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087836|emb|CAL10622.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 356

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 82/377 (21%), Positives = 159/377 (42%), Gaps = 39/377 (10%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L T L  L   + L  +I   +   ++G+  +YS +   +     +P
Sbjct: 1   MFGVLDRYIGRTILNTILMTLFMLVSLSGIIKFVDQLRKVGQ-GDYSAASAGMYTLLSIP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ + 
Sbjct: 60  KDIEIFFPMAALLGALLGLGTLATRSELVVMQASGFTRMQIAASVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE++  +   Q    G    +    W +  +     FI  +++  +    ++ T
Sbjct: 120 EWVAPQGEQMARNFRAQQMYGGSLLSTQSGLWAKDGSD----FIYIQRVSGD----KELT 171

Query: 181 SITI---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
            + I   D++++++  + A  A   ++  +L +V E            + L+ P K+ G 
Sbjct: 172 GVNIYHFDQQDRLLSVRYAATATFEDNLWRLSQVDE------------SDLSNPNKVTGS 219

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKS---NIFHNY------------RAETQFYFLIVIPL 282
           Q  + ++ +    E +  ++ +  S   +  H+Y            R E   +  I  P 
Sbjct: 220 QTLTGEWKTNLTPEKLGVVAMNPDSLSISGLHDYSKYLRQSGQESSRYELNMWGKIFAPF 279

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
            +  M L+A S      RS    + V  GIF GF+ Y +  I         + PV  AL+
Sbjct: 280 SVAVMMLMALSFIFGPLRSVPMGVRVVTGIFFGFVFYVLDQIFGPLSLVYSIPPVIGALL 339

Query: 343 PVILTISLSILILLQKE 359
           P IL + +S+ +LL++ 
Sbjct: 340 PSILFLLISVYLLLKRR 356


>gi|118580062|ref|YP_901312.1| permease YjgP/YjgQ family protein [Pelobacter propionicus DSM 2379]
 gi|118502772|gb|ABK99254.1| permease YjgP/YjgQ family protein [Pelobacter propionicus DSM 2379]
          Length = 359

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/316 (19%), Positives = 147/316 (46%), Gaps = 20/316 (6%)

Query: 38  NQMGELPNYSISRGAVLA-----ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISR 92
           + M  +P +   +GA++      A ++P +I Q   F  L+  ++    L R+SE+V  R
Sbjct: 31  DMMERIPRFLRVQGALVDIARFFAWKLPEMIGQTAAFSVLMATLLTLGLLTRSSEIVAMR 90

Query: 93  AIGISIWQLLNPFVVGSILLGIFTVLVINPIA-TSGEKIG-IDLIQQWKDNGDK--QKSD 148
           + GIS+ ++  P ++    + +  ++    I   S E++  I+ +   K  G    ++++
Sbjct: 91  SCGISLPRISLPMLLLGGGVSLLLLVNAELIVPDSYERMSRIERVDIKKQAGSAVFKRNN 150

Query: 149 IIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKL 208
           I  W +  N      + A+   P + +       ++D+    + R DA+ A +  +   L
Sbjct: 151 I--WFRSDNR----IMQARLFDPRSQVLRGVVVWSLDQYTNPLSRLDAESAELRGESWLL 204

Query: 209 KKVV--EYQYGRIPIDKN--STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNI 264
           + V   E+  G   + +   + ++++ +K+D  +   +   + SF ++ ++ + + +   
Sbjct: 205 RGVELKEFTAGEGVVVRKLPTRSIDLNLKVDDLRVLDKNADNLSFGKL-REYADNLRKGG 263

Query: 265 FHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITI 324
           + +++  T  +     PL  + M ++    +L  SRS    + V   +  GF  + +  +
Sbjct: 264 YEDFKYRTMMHTKFAAPLSALVMVILGIPFALRGSRSGGVAMGVGASVTIGFAYFVVNAV 323

Query: 325 MKSFGKSGILLPVAAA 340
           + S+G+SG+L P+ AA
Sbjct: 324 LLSYGRSGVLPPLVAA 339


>gi|290968957|ref|ZP_06560492.1| YjgP/YjgQ family [Megasphaera genomosp. type_1 str. 28L]
 gi|290780913|gb|EFD93506.1| YjgP/YjgQ family [Megasphaera genomosp. type_1 str. 28L]
          Length = 362

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 134/323 (41%), Gaps = 45/323 (13%)

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+    P   L+  ++ F  L+  SE+++ RA G    +L  P +V +  + + T   
Sbjct: 59  PSIVVLTFPMSVLLGALMAFGRLSAASEIIVMRAGGQHFVRLAMPVLVAAFFISLGTTAF 118

Query: 120 ---INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQ----ISNPQQDIFIGAKKILPE 172
              + P A +     I+         ++ +   +P  Q    I N       G       
Sbjct: 119 NEFVVPRANNAYNRIIN---------EEIRHHALPVSQEHVIIKNVHGQNIYGLLYARQY 169

Query: 173 NHIWEDFTSITIDK--KNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT--- 227
           +   ++F  IT+ +  +++++  + AD A     K   KK + +Q     +  N  T   
Sbjct: 170 DGTEKEFRDITVQEFEQDRLVRVEKADRA-----KWNGKKWIVHQGSIYDVSSNDNTSRT 224

Query: 228 ----------LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL 277
                     +  P K+   QK  E+   R   + I+ ++    ++     + + + Y  
Sbjct: 225 MTFENQELPFMQRPEKVQEAQKKPEELTIRELRQQIRVLT----AHGVDVNKLKVEMYNR 280

Query: 278 IVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGI--FSGFMLYTIITIMKSFGKSGILL 335
             +PL  +   LI A + L+  R +     + +GI   + F+ Y+I+T+  + G  G + 
Sbjct: 281 FALPLASLVCALIGAPLGLQKQRGSSS---IGFGISVVTIFIYYSIMTLADALGNGGTIA 337

Query: 336 PVAAALIPVILTISLSILILLQK 358
           P AAA +P I+  S+ I ++++K
Sbjct: 338 PAAAAFLPDIICGSVGIFLMIRK 360


>gi|46446271|ref|YP_007636.1| hypothetical protein pc0637 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46399912|emb|CAF23361.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 383

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 63/127 (49%), Gaps = 6/127 (4%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQN--QMGELPNYSISRGAVLAATR 58
           M  ILWRY   ++LK     +   + ++  + L+EI N   +G      IS   + A  +
Sbjct: 1   MIPILWRYSINHFLKIVFACVFAFISILLTMRLDEIANFAALGA----PISYILLFAFYQ 56

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+   +P   L+ +++    L+ T EL   RA G ++  LL P ++ +  L IF   
Sbjct: 57  IPYILPIALPLSCLIASLIFVQRLSNTHELTALRACGFALKDLLAPILLTAAFLTIFNFW 116

Query: 119 VINPIAT 125
           +++ +AT
Sbjct: 117 IVSEVAT 123


>gi|71737643|ref|YP_273426.1| hypothetical protein PSPPH_1159 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71558196|gb|AAZ37407.1| membrane protein, putative [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320322887|gb|EFW78978.1| hypothetical protein PsgB076_20532 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329804|gb|EFW85792.1| hypothetical protein PsgRace4_11126 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 353

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 156/372 (41%), Gaps = 50/372 (13%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVIN 121
              L+  ++    L  +SEL I RA G+SI    W ++ P    +V  +L+G +    + 
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLLLMVAGVLVGEY----VA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q    +GD Q +    W +    Q + FI    + P N +    T 
Sbjct: 122 PYAENQAQAARSLAQ---GSGDAQSARHGLWHR----QGEEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              D +  ++    A  A    D  +LK V    +     D  +  +N P+     +++ 
Sbjct: 174 YRFDDQRHMLTSSFAKEANFKTDYWELKDVSTTHFN----DGRTEVINTPV-----ERWD 224

Query: 242 EQFASRSFYEII---KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLI 290
              + +    +I   + +S S   N  H        N R    F+  ++ P + VA+ L+
Sbjct: 225 VALSPQLLSTVIMPPESLSISGLWNYAHYLADQGLSNGRYWLAFWTKVLQPAVTVALVLM 284

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFML-YTIITIMKSFGKSGILL---PVAAALIPVIL 346
           A S      RS    + +   +F+G ++ +T   I    G S +L    P+ A L+P   
Sbjct: 285 AISFIFGPLRS----VTLGQRVFTGVVVGFTFRIIQDLLGPSSLLFGFPPLLAVLMPAA- 339

Query: 347 TISLSILILLQK 358
             +L+ + LL++
Sbjct: 340 ACALAGVYLLRR 351


>gi|326565139|gb|EGE15330.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis 103P14B1]
 gi|326572842|gb|EGE22827.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis CO72]
 gi|326574664|gb|EGE24600.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis 101P30B1]
          Length = 369

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 83/377 (22%), Positives = 162/377 (42%), Gaps = 42/377 (11%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQI 66
           KY +++ L  + GA++ ++++ +  +   + EL N    Y+++   +    R P  + Q 
Sbjct: 8   KYVIRSALLAMAGAVVGLWLVQM--VFAYLAELDNISETYTLTDALLFILYRSPYFLVQF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISI-----WQLLNPFVVGSILLGI--FTVLV 119
           IP  TL+  ++    L   SEL++ RA G+SI     W +L   +  +I LG+  F +  
Sbjct: 66  IPTGTLLGAVIGLGLLANHSELIVMRAAGMSIYRIVSWAMLPAVIFVAISLGVNQFVLPT 125

Query: 120 INPIATS--GEKIGIDLIQ---QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
            N  AT+   + I   LI     W  N D    D++    IS    +  +G  K     +
Sbjct: 126 ANQYATAIRADTIYDKLITIDGYWSVNHDGDSQDVV---YISYADNEGGLGEVK----RY 178

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK----LKKVVEYQYGRIPIDKNSTT--- 227
             +D   I   K    ++   +D  ++   K +    L  + E   G   + +  +    
Sbjct: 179 QLKDGQLIAALKAKSGVYLPQSD-DVMNAQKARYTWQLSGIDEIGIGTSQVQQAHSEGKI 237

Query: 228 LNIPIKMDG---FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
           L +PI         K  E  +  S Y   + M+     ++ H    E  F+  ++ P  +
Sbjct: 238 LTLPIAPTDVYLLTKEPEDLSLSSLYAHRQLMAHQGTRSLRH----ELAFWQKLLSPFAV 293

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF-GKSGILLPVAAALIP 343
           +++ L+A+S      RS    + V   + +G +L++ +T +  F   +  L P+  AL+P
Sbjct: 294 LSLVLVASSFVFGSLRSQGLGLRVVLALLTG-LLFSYLTDLTGFVALATGLSPLLMALVP 352

Query: 344 VILTISLSILILLQKED 360
           ++L+    + +L +K  
Sbjct: 353 IVLSAMAGMYLLNRKSS 369


>gi|323144744|ref|ZP_08079321.1| lipopolysaccharide export system permease protein LptG
           [Succinatimonas hippei YIT 12066]
 gi|322415495|gb|EFY06252.1| lipopolysaccharide export system permease protein LptG
           [Succinatimonas hippei YIT 12066]
          Length = 355

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 133/318 (41%), Gaps = 34/318 (10%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGI-------SIWQLLNPFVVG 108
           A  VP I+    P   L+  ++   NL RTSEL++ ++IGI       S  + + P ++ 
Sbjct: 56  ALEVPGIVVLFFPVAVLLGGVIALGNLARTSELIVMQSIGISRTGIVLSALKTVIPLILV 115

Query: 109 SILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKK 168
            + LG F V  +       E+   + +     NG+   ++   W++    +   FIG + 
Sbjct: 116 IVCLGEFVVPRV-------EQYAENRLNFASSNGNLSVTNDGLWLR----EGHSFIGIRY 164

Query: 169 ILPENHIWEDFTSITIDKKN-KIIHRKDADLAIIYND------KVKLKKVVEYQYGRIPI 221
            + +  +  D     ++ KN K   R  +    +Y+D       V+     E +  R  +
Sbjct: 165 TMSDGSLL-DIVRYEVEGKNLKAFSRAKSG---VYSDGKWVMRDVRKTVFAENKVIRTSL 220

Query: 222 DKNSTTLNI-PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVI 280
            +   +LN+ P +++          +R   + I  +  +N+     +YR E   Y   + 
Sbjct: 221 AEEKWSLNLTPERVEVVGVKGYNLTARGLIDYINYLEENNQDA--SSYRLE--LYNKFMS 276

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           PL ++ M L+AAS      RS      V  GI  GF  Y    I   F     + P+  A
Sbjct: 277 PLTMIVMLLLAASTVFGPLRSMTMGARVLAGIALGFGFYLANQIGAPFALVYGIPPILGA 336

Query: 341 LIPVILTISLSILILLQK 358
            +P ++ + L+I +L +K
Sbjct: 337 SLPTLVFMLLAIALLRRK 354


>gi|78186277|ref|YP_374320.1| hypothetical protein Plut_0389 [Chlorobium luteolum DSM 273]
 gi|78166179|gb|ABB23277.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 360

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 160/376 (42%), Gaps = 37/376 (9%)

Query: 4   ILWRYFFKYYLKT----TLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           IL RY F+ ++KT    +L F+   M++  V +L++  ++     N      A      +
Sbjct: 3   ILDRYIFRQFVKTFIFTSLAFVALFMLIHMVENLDDFMDK-----NQGFEAIAQYYLFAI 57

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV-- 117
           P  I    P  +L+  I+V   L  +SEL   R+ G+S+ QLL PF++G +++    +  
Sbjct: 58  PQTILITSPVSSLLAAILVAGKLAVSSELPAIRSAGVSMGQLLYPFLLGGMIISTINLTN 117

Query: 118 -LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
              I P AT       +L +      D++           N    I     +I+    + 
Sbjct: 118 SFWIAPAATLRNN-NFELTELGHQRRDEEG---------GNSNLHILEPGNRIITLGSLN 167

Query: 177 EDFTS---ITIDK--KNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNS---TTL 228
            D +S   ++I++  +  I+ R DAD  + YN + K   V+E    R+  D +    T  
Sbjct: 168 PDMSSAREVSIEQFSQKGIVSRSDAD-GMRYNPEKK-AWVLENAAERMFEDGSERFWTEP 225

Query: 229 NIPIKMD-GFQKFSEQFASRSFYEIIKK---MSFSNKSNIFHNYRAETQFYFLIVIPLML 284
            +P+++    Q  +E         I +    +S    +      R+  + +  + +P   
Sbjct: 226 MLPVQLHLSLQSLAELNLRPDEMNIARHWQYLSEKKHAGFAGLERSSVKLHTKLSLPFAS 285

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
           + + +I   +S +  R      I    +F+GF+   +   + +FG +G++ P+ AA +P 
Sbjct: 286 LIIIIIGVPLSAKKKRGGLAAEI-GISLFAGFLFLGLQKTIATFGYNGVMPPMLAAWLPN 344

Query: 345 ILTISLSILILLQKED 360
           +L + +  +I     D
Sbjct: 345 LLFLGVGYVIYRYSPD 360


>gi|94987323|ref|YP_595256.1| permease [Lawsonia intracellularis PHE/MN1-00]
 gi|94731572|emb|CAJ54935.1| predicted permeases [Lawsonia intracellularis PHE/MN1-00]
          Length = 366

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 138/305 (45%), Gaps = 24/305 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           + P  I QI+PFI L+  ++    + +  EL+  +A GIS  ++ +  ++ S+  G    
Sbjct: 56  KTPFAIAQILPFIFLISTVIQLCIMAKKKELIALQAGGISFTRIASIIIIASLFWGTIQF 115

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKS---DIIPWMQISNPQQDIFIGAKKILPENH 174
           +    I T+  +  + + Q++  N  K K+   DI  W    N     +I +   L  + 
Sbjct: 116 IFSEYIGTACGRKSLQIWQEYVHNQHKSKTILKDI--WFTDKN-----WIVSINTLKPDD 168

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAI-IYNDKVKLKKVVEYQ---YGRIPIDKNSTTLNI 230
               F++  +DK    I +    L+  I+N++  LKKV   +   Y +  + + + T N 
Sbjct: 169 TGSGFSAYLLDKNGLTIEKIIWALSFSIHNNEWILKKVAVSEPALYSQEMLQELTLTFNQ 228

Query: 231 PIKMDGFQKFSEQFASRSFYEI---IKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
             +   F + +      SF+E+   I K+  S  SN+      +T ++  +     LV M
Sbjct: 229 SSETLKFIQNNNAPQQLSFWELRETIHKLERSG-SNV---ELLKTSWHTKLSYSFSLVVM 284

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
            L+A ++    +  N   I +A+ +   F+   + TI  S G  GI+ P+  A I  ++ 
Sbjct: 285 ALLATTI---VAWKNNIYIAIAFSLLYTFIYNALNTIGISLGNKGIISPIIGAWIANLVI 341

Query: 348 ISLSI 352
           +S++I
Sbjct: 342 MSVTI 346


>gi|251791279|ref|YP_003006000.1| permease YjgP/YjgQ family protein [Dickeya zeae Ech1591]
 gi|247539900|gb|ACT08521.1| permease YjgP/YjgQ family protein [Dickeya zeae Ech1591]
          Length = 356

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 79/363 (21%), Positives = 145/363 (39%), Gaps = 17/363 (4%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           +L RY  K    T +  L   + L  +I   +   ++G+   YS+    +     VP  I
Sbjct: 4   VLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLRKVGQ-GGYSVMGAGLYTLLSVPKDI 62

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ +   +
Sbjct: 63  EIFFPMAALLGALLGLGTLATRSELVVMQASGFTRLQIAGSVMKTAIPLVLLTMAIGEWV 122

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           A +GE++  +   Q    G    +    W +  N     F+  +++  E+ +        
Sbjct: 123 APAGEQMARNYRSQMMYGGSMLSTQSGLWAKDGND----FVYIQRVAGESELL-GVNIYH 177

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-------GRIPIDKNSTTLNIPIKMDG 236
            DK+NK++  + A  A+  N   KL +V E          G   +     T   P K+  
Sbjct: 178 FDKQNKLLSVRYAASAVYENGGWKLSQVEESDLSDGKQIGGSQTVSGEWKTNLTPDKLGV 237

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
                +  + R  Y+ I  +  S +       R +   +  +  PL +  M L+A S   
Sbjct: 238 VALEPDALSIRGLYDYINYLRQSGQ----EASRYQLNMWSKLFAPLSVAVMMLMALSFIF 293

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
              RS    + +  GI  GF+ Y +  I         + PV  A +P  L + +SI++LL
Sbjct: 294 GPLRSVPAGMRIVIGISFGFLFYVLDQIFGPLSLVYHIPPVLGASLPSALFLFISIMLLL 353

Query: 357 QKE 359
           ++ 
Sbjct: 354 KRR 356


>gi|107103347|ref|ZP_01367265.1| hypothetical protein PaerPA_01004416 [Pseudomonas aeruginosa PACS2]
          Length = 355

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 78/357 (21%), Positives = 142/357 (39%), Gaps = 52/357 (14%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLN 83
           A++  F+ +LN+I        +Y I           P     ++P   L+  +V    L 
Sbjct: 27  ALLFAFIDELNDIS------ASYGIGDALRFIFLTAPRRAYDMLPMAALIGCLVGLGTLA 80

Query: 84  RTSELVISRAIGIS----IWQLLNPFVV---GSILLGIFTVLVINPIATSGEKIGIDLIQ 136
             SEL I RA G+S    +W ++ P +V     IL+G +       IA SG  +      
Sbjct: 81  SNSELTIMRAAGVSLSRIVWAVMKPMLVLMLAGILVGEYVAPWTENIAQSGRALA----- 135

Query: 137 QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDA 196
             +  GD Q S    W +    Q   +I    + P N +    T    D++  +     A
Sbjct: 136 --QGGGDSQSSKRGLWHR----QGREYIHINAVQP-NGVLYGVTRYRFDEQRGLESASFA 188

Query: 197 DLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEII--- 253
             A    D  +L++V        P +K S  + +P      +++  Q + +    ++   
Sbjct: 189 KRARFETDHWQLEEVTTTLLH--PREKRSEVIKLPT-----ERWDAQLSPQLLNTVVMEP 241

Query: 254 KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPR 305
           + +S S      H        N R    F+  ++ PL+  A+ L+A S      RS    
Sbjct: 242 EALSISGLWQYIHYLADQGLNNNRYWLAFWTKVLQPLVTAALVLMAISFIFGPLRS---- 297

Query: 306 IIVAYGIFSGFMLYTIITIMKS-FGKSGILL---PVAAALIPVILTISLSILILLQK 358
           + +   IF+G ++  +  I +   G S ++    P+ A +IP  +  +L+ + LL++
Sbjct: 298 VTLGQRIFTGVLVGFVFRIAQDLLGPSSLVFDFPPLLAVVIPASIC-ALAGVWLLRR 353


>gi|165936803|ref|ZP_02225370.1| putative permease [Yersinia pestis biovar Orientalis str. IP275]
 gi|167420748|ref|ZP_02312501.1| putative permease [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|165915452|gb|EDR34062.1| putative permease [Yersinia pestis biovar Orientalis str. IP275]
 gi|166961554|gb|EDR57575.1| putative permease [Yersinia pestis biovar Orientalis str.
           MG05-1020]
          Length = 358

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 84/382 (21%), Positives = 160/382 (41%), Gaps = 47/382 (12%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L T L  LL  + L  +I   +   ++G+  +YS +   +     +P
Sbjct: 1   MFGVLDRYIGRTILNTILMTLLMLVSLSGIIKFVDQLRKVGQ-GDYSAASAGMYTILSIP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I    P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ + 
Sbjct: 60  KDIAVFFPMAALLGALLGLGTLASRSELVVMQASGFTRMQIAASVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE+   +   Q    G    +    W +  +     FI  +++  E+ +    T
Sbjct: 120 EWVAPQGEQTARNFRTQQMYGGSLLSTQSGLWAKDGSD----FIYIQRVSGESEL----T 171

Query: 181 SITI---DKKNKIIHRKDADLAIIYNDKV--KLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
            + I   DK+++++  + A  A    D    +L +V E            + L+ P ++ 
Sbjct: 172 GVNIYHFDKEDRLLSVRYAATATYEKDNKTWRLSQVDE------------SDLSNPTQVT 219

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKS---NIFHNY------------RAETQFYFLIVI 280
           G Q  + ++ +    E +  ++    S   +  H+Y            R E   +  +  
Sbjct: 220 GSQTLTGEWKTNLTSEKLGVVAMDPDSLSISGLHDYSKYLQQSGQESNRYELSMWSKVFA 279

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL---PV 337
           P  +  M L+A S      RS    + V  GIF GF+ Y +  +   FG+  ++    P+
Sbjct: 280 PFSVAVMMLMALSFIFGPLRSVPMGVRVVTGIFFGFVFYVLDQV---FGRLSLVYGIPPM 336

Query: 338 AAALIPVILTISLSILILLQKE 359
             AL+P +L + +SI +LL++ 
Sbjct: 337 LGALLPSMLFLLISICLLLKRR 358


>gi|254242518|ref|ZP_04935840.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|126195896|gb|EAZ59959.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
          Length = 355

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 78/357 (21%), Positives = 142/357 (39%), Gaps = 52/357 (14%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLN 83
           A++  F+ +LN+I        +Y I           P     ++P   L+  +V    L 
Sbjct: 27  ALLFAFIDELNDIS------ASYGIGDALRFIFLTAPRRAYDMLPMAALIGCLVGLGTLA 80

Query: 84  RTSELVISRAIGIS----IWQLLNPFVV---GSILLGIFTVLVINPIATSGEKIGIDLIQ 136
             SEL I RA G+S    +W ++ P +V     IL+G +       IA SG  +      
Sbjct: 81  SNSELTIMRAAGVSLSRIVWAVMKPMLVLMLAGILVGEYVAPWTENIAQSGRALA----- 135

Query: 137 QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDA 196
             +  GD Q S    W +    Q   +I    + P N +    T    D++  +     A
Sbjct: 136 --QGGGDSQSSKRGLWHR----QGREYIHINAVQP-NGVLYGVTRYRFDEQRGLESASFA 188

Query: 197 DLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEII--- 253
             A    D  +L++V        P +K S  + +P      +++  Q + +    ++   
Sbjct: 189 KRARFETDHWQLEEVTTTLLH--PREKRSEVVKLPT-----ERWDAQLSPQLLNTVVMEP 241

Query: 254 KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPR 305
           + +S S      H        N R    F+  ++ PL+  A+ L+A S      RS    
Sbjct: 242 EALSISGLWQYIHYLADQGLNNNRYWLAFWTKVLQPLVTAALVLMAISFIFGPLRS---- 297

Query: 306 IIVAYGIFSGFMLYTIITIMKS-FGKSGILL---PVAAALIPVILTISLSILILLQK 358
           + +   IF+G ++  +  I +   G S ++    P+ A +IP  +  +L+ + LL++
Sbjct: 298 VTLGQRIFTGVLVGFVFRIAQDLLGPSSLVFDFPPLLAVVIPASIC-ALAGVWLLRR 353


>gi|15599022|ref|NP_252516.1| hypothetical protein PA3827 [Pseudomonas aeruginosa PAO1]
 gi|116051855|ref|YP_789302.1| hypothetical protein PA14_14510 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218889889|ref|YP_002438753.1| putative permease [Pseudomonas aeruginosa LESB58]
 gi|254236731|ref|ZP_04930054.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|296387657|ref|ZP_06877132.1| putative permease [Pseudomonas aeruginosa PAb1]
 gi|313109246|ref|ZP_07795214.1| hypothetical protein PA39016_001710055 [Pseudomonas aeruginosa
           39016]
 gi|9950002|gb|AAG07214.1|AE004800_3 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115587076|gb|ABJ13091.1| putative permease [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168662|gb|EAZ54173.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|218770112|emb|CAW25874.1| putative permease [Pseudomonas aeruginosa LESB58]
 gi|310881716|gb|EFQ40310.1| hypothetical protein PA39016_001710055 [Pseudomonas aeruginosa
           39016]
          Length = 355

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 78/357 (21%), Positives = 142/357 (39%), Gaps = 52/357 (14%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLN 83
           A++  F+ +LN+I        +Y I           P     ++P   L+  +V    L 
Sbjct: 27  ALLFAFIDELNDIS------ASYGIGDALRFIFLTAPRRAYDMLPMAALIGCLVGLGTLA 80

Query: 84  RTSELVISRAIGIS----IWQLLNPFVV---GSILLGIFTVLVINPIATSGEKIGIDLIQ 136
             SEL I RA G+S    +W ++ P +V     IL+G +       IA SG  +      
Sbjct: 81  SNSELTIMRAAGVSLSRIVWAVMKPMLVLMLAGILVGEYVAPWTENIAQSGRALA----- 135

Query: 137 QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDA 196
             +  GD Q S    W +    Q   +I    + P N +    T    D++  +     A
Sbjct: 136 --QGGGDSQSSKRGLWHR----QGREYIHINAVQP-NGVLYGVTRYRFDEQRGLESASFA 188

Query: 197 DLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEII--- 253
             A    D  +L++V        P +K S  + +P      +++  Q + +    ++   
Sbjct: 189 KRARFETDHWQLEEVTTTLLH--PREKRSEVVKLPT-----ERWDAQLSPQLLNTVVMEP 241

Query: 254 KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPR 305
           + +S S      H        N R    F+  ++ PL+  A+ L+A S      RS    
Sbjct: 242 EALSISGLWQYIHYLADQGLNNNRYWLAFWTKVLQPLVTAALVLMAISFIFGPLRS---- 297

Query: 306 IIVAYGIFSGFMLYTIITIMKS-FGKSGILL---PVAAALIPVILTISLSILILLQK 358
           + +   IF+G ++  +  I +   G S ++    P+ A +IP  +  +L+ + LL++
Sbjct: 298 VTLGQRIFTGVLVGFVFRIAQDLLGPSSLVFDFPPLLAVVIPASIC-ALAGVWLLRR 353


>gi|218438808|ref|YP_002377137.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 7424]
 gi|218171536|gb|ACK70269.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 7424]
          Length = 434

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 71/333 (21%), Positives = 140/333 (42%), Gaps = 46/333 (13%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG---- 113
           RVP      +P   L+  ++ +  L+  SEL+  R+ GIS+W+   P V+ S+++     
Sbjct: 118 RVPEFFAYALPISVLLTTLMTYGRLSSESELIALRSCGISLWRATVPAVILSVIVSGITF 177

Query: 114 IFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP-WMQISNPQQDIFIGAKKIL-P 171
           +F+  V+        +I + ++ + + N  + K    P + ++       F   K +   
Sbjct: 178 VFSEGVVPETNYRATEILVKVLHE-ERNFWQNKDIFYPNYEEVKLANGQTFRQLKTLFYA 236

Query: 172 ENHIWEDFTSITI-----DKKNKIIHRKDA------DLAIIYNDKVKL-------KKVVE 213
           E    +   S+TI     D  N+I+    A      ++   +N  V L       K+ V 
Sbjct: 237 EKFDGQKMRSLTIINWLGDHLNEIVVSDSAQWNANQNIWDFFNGTVYLIDTDKSYKEAVP 296

Query: 214 YQYGRIPIDKN----STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYR 269
           +++ + P+ K     +T    P +M+ FQ           Y+ + + S  NK+  F + R
Sbjct: 297 FKHQQFPLPKEAFEFATQGRNPYEMNLFQALQ--------YKRLLEASGDNKNVRFFDVR 348

Query: 270 AETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKS 327
              +    I  P + +   ++ A++    ++  Q     + G+  G  F  Y +     S
Sbjct: 349 IHQK----IAFPFVCLVFGIMGAAIG---AKPQQMSRGTSLGLTVGIVFSYYMLNFFTGS 401

Query: 328 FGKSGILLPVAAALIPVILTISLSILILLQKED 360
           FG  G+L P+ AA +P +  + +   IL + E+
Sbjct: 402 FGMIGLLSPMMAAWLPNLFGVGIGGWILKKLEN 434


>gi|317494175|ref|ZP_07952591.1| inner membrane protein yjgQ [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917948|gb|EFV39291.1| inner membrane protein yjgQ [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 356

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 146/366 (39%), Gaps = 17/366 (4%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +    T +  L   + L  +I   +   ++G+  +YS +   +     VP
Sbjct: 1   MLGVLDRYIGRTIFSTIMATLFMLVSLSGIIKFVDQLRKVGQ-GDYSAAGAGLYTLLSVP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+  ++    L + SELV+ +A G +  Q+ +  +  +I L I T+ + 
Sbjct: 60  KDIEVFFPMAALLGALLGLGMLAQRSELVVMQAAGYTRMQIASSVMKTAIPLVILTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE+   +   Q    G    +    W +        FI  +++  E  I +  +
Sbjct: 120 EWVAPQGEQAARNYRAQQMYGGSLLSTQTGLWAKDGTD----FIFIQRVTGEKSI-QGVS 174

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLN-------IPIK 233
             + D +  +   + A+ A     + KL +V E           S TLN        P K
Sbjct: 175 IYSFDNERHLQKLRYANSATFEGHQWKLSQVEESNLTDSKRITGSQTLNGVWKTNLTPDK 234

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
           +       +  +    Y  +K +  S +     + R +   +  I  PL +  M L+A S
Sbjct: 235 LGVVAMSPDSLSISGLYHYVKYLKQSGQ----ESSRYQLNMWSKIFAPLSVAVMMLMALS 290

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
                 RS    + V  GI  GF  Y +  I         + PV  A++P +L + +S+ 
Sbjct: 291 FIFGPLRSVPMGVRVLTGISFGFFFYVLDEIFGPLSLVYSVPPVLGAILPSLLFLLISVY 350

Query: 354 ILLQKE 359
           +LL+K 
Sbjct: 351 MLLRKS 356


>gi|260655096|ref|ZP_05860584.1| putative membrane protein [Jonquetella anthropi E3_33 E1]
 gi|260630207|gb|EEX48401.1| putative membrane protein [Jonquetella anthropi E3_33 E1]
          Length = 339

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 70/352 (19%), Positives = 147/352 (41%), Gaps = 61/352 (17%)

Query: 42  ELPNYSISRGAVLAAT------RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIG 95
           +L +  I RG  LA         +P ++   +P   L+  ++ F  ++  SE+V  +A G
Sbjct: 15  KLADLIIERGVSLAVAGRLFVYELPGVVVLTLPMSCLLGALLGFGAMSTNSEVVALKASG 74

Query: 96  ISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQI 155
           IS W++  P +  ++++ I ++++   +   G++   +++        KQK  +I     
Sbjct: 75  ISFWRMNWPVIFWAVIISILSLILNETLVPLGQRAAENVM---TFEVAKQKPVLI----- 126

Query: 156 SNPQQDIFIGA--------KKILPENHIWED----------FTSITIDKKNK----IIHR 193
              +Q++F+ A         K+ P +    +           T IT+    +    I + 
Sbjct: 127 ---KQEVFLQAPGGRVVYVGKLDPSSGSMSNVIVQELASGKLTRITVAPNGQWVSGIWYL 183

Query: 194 KDADLAIIYNDKV--KLKKVVEYQYGRIPIDKNSTTL-NIPIKMDGFQKFSEQFASRSFY 250
            D D   +Y  K    +  +  +    +PI      + N  +K D         ++   Y
Sbjct: 184 TDGD---VYEMKEPDGVAHLFHFAKQELPISLTPRQIANTSVKPD-------DLSASDLY 233

Query: 251 EIIKKMSFSNK--SNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIV 308
             I  M    K  S ++       +F+F + +P   V ++LI  S+ +   R     +  
Sbjct: 234 RYIAAMKMQGKDISALW------VKFHFKLAVPWACVILSLIGTSLGVSHQRHGNRSVGF 287

Query: 309 AYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
              I   F+ Y ++++ KS G++  L PV A  +P I+ + ++ + L+++ D
Sbjct: 288 GQSILIVFLYYVLMSVGKSLGQTNALPPVVAGWLPNIIFL-VAAVFLIRRAD 338


>gi|302188385|ref|ZP_07265058.1| permease YjgP/YjgQ [Pseudomonas syringae pv. syringae 642]
          Length = 353

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 99/229 (43%), Gaps = 19/229 (8%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLVINPIA 124
              L+  ++    L  +SEL I RA G+SI    W ++ P +V  ++ G+     + P A
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLV-LMIAGVLVGEYVAPYA 124

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T    
Sbjct: 125 ENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTRYRF 176

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
           D++  ++    A  A    D  +LK V    +     D ++  +N P++
Sbjct: 177 DEQRHMLTSSFAKEANFKTDYWELKDVATTHFN----DGSTEVVNTPVE 221


>gi|22124661|ref|NP_668084.1| hypothetical protein y0748 [Yersinia pestis KIM 10]
 gi|45440497|ref|NP_992036.1| hypothetical protein YP_0645 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51594885|ref|YP_069076.1| membrane protein, permease [Yersinia pseudotuberculosis IP 32953]
 gi|108808931|ref|YP_652847.1| hypothetical protein YPA_2940 [Yersinia pestis Antiqua]
 gi|108810814|ref|YP_646581.1| hypothetical protein YPN_0649 [Yersinia pestis Nepal516]
 gi|145600503|ref|YP_001164579.1| hypothetical protein YPDSF_3249 [Yersinia pestis Pestoides F]
 gi|153949000|ref|YP_001402495.1| permease [Yersinia pseudotuberculosis IP 31758]
 gi|153997519|ref|ZP_02022619.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162420587|ref|YP_001608340.1| hypothetical protein YpAngola_A4049 [Yersinia pestis Angola]
 gi|165925751|ref|ZP_02221583.1| putative permease [Yersinia pestis biovar Orientalis str. F1991016]
 gi|166010149|ref|ZP_02231047.1| putative permease [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166214265|ref|ZP_02240300.1| putative permease [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167399516|ref|ZP_02305040.1| putative permease [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167423672|ref|ZP_02315425.1| putative permease [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170025892|ref|YP_001722397.1| permease YjgP/YjgQ family protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186893895|ref|YP_001871007.1| permease YjgP/YjgQ family protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930455|ref|YP_002348330.1| hypothetical protein YPO3439 [Yersinia pestis CO92]
 gi|229839083|ref|ZP_04459242.1| conserved inner membrane protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229896571|ref|ZP_04511738.1| conserved inner membrane protein [Yersinia pestis Pestoides A]
 gi|229899646|ref|ZP_04514787.1| conserved inner membrane protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901017|ref|ZP_04516141.1| conserved inner membrane protein [Yersinia pestis Nepal516]
 gi|270489197|ref|ZP_06206271.1| inner membrane family protein [Yersinia pestis KIM D27]
 gi|294505143|ref|YP_003569205.1| hypothetical protein YPZ3_3034 [Yersinia pestis Z176003]
 gi|21957470|gb|AAM84335.1|AE013676_8 hypothetical protein y0748 [Yersinia pestis KIM 10]
 gi|45435354|gb|AAS60913.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51588167|emb|CAH19773.1| putative membrane protein, permease [Yersinia pseudotuberculosis IP
           32953]
 gi|108774462|gb|ABG16981.1| membrane protein [Yersinia pestis Nepal516]
 gi|108780844|gb|ABG14902.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115349066|emb|CAL22028.1| putative membrane protein [Yersinia pestis CO92]
 gi|145212199|gb|ABP41606.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149289156|gb|EDM39236.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|152960495|gb|ABS47956.1| putative permease [Yersinia pseudotuberculosis IP 31758]
 gi|162353402|gb|ABX87350.1| putative permease [Yersinia pestis Angola]
 gi|165922363|gb|EDR39540.1| putative permease [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991056|gb|EDR43357.1| putative permease [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166204497|gb|EDR48977.1| putative permease [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167052020|gb|EDR63428.1| putative permease [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057842|gb|EDR67588.1| putative permease [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752426|gb|ACA69944.1| permease YjgP/YjgQ family protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186696921|gb|ACC87550.1| permease YjgP/YjgQ family protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682356|gb|EEO78448.1| conserved inner membrane protein [Yersinia pestis Nepal516]
 gi|229687138|gb|EEO79213.1| conserved inner membrane protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695449|gb|EEO85496.1| conserved inner membrane protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229700349|gb|EEO88381.1| conserved inner membrane protein [Yersinia pestis Pestoides A]
 gi|262363204|gb|ACY59925.1| hypothetical protein YPD4_3021 [Yersinia pestis D106004]
 gi|270337701|gb|EFA48478.1| inner membrane family protein [Yersinia pestis KIM D27]
 gi|294355602|gb|ADE65943.1| hypothetical protein YPZ3_3034 [Yersinia pestis Z176003]
          Length = 358

 Score = 49.3 bits (116), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 84/382 (21%), Positives = 160/382 (41%), Gaps = 47/382 (12%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L T L  LL  + L  +I   +   ++G+  +YS +   +     +P
Sbjct: 1   MFGVLDRYIGRTILNTILMTLLMLVSLSGIIKFVDQLRKVGQ-GDYSAASAGMYTILSIP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I    P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ + 
Sbjct: 60  KDIAVFFPMAALLGALLGLGTLASRSELVVMQASGFTRMQIAASVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE+   +   Q    G    +    W +  +     FI  +++  E+ +    T
Sbjct: 120 EWVAPQGEQTARNFRTQQMYGGSLLSTQSGLWAKDGSD----FIYIQRVSGESEL----T 171

Query: 181 SITI---DKKNKIIHRKDADLAIIYNDKV--KLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
            + I   DK+++++  + A  A    D    +L +V E            + L+ P ++ 
Sbjct: 172 GVNIYHFDKEDRLLSVRYAATATYEKDNKTWRLSQVDE------------SDLSNPTQVT 219

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKS---NIFHNY------------RAETQFYFLIVI 280
           G Q  + ++ +    E +  ++    S   +  H+Y            R E   +  +  
Sbjct: 220 GSQTLTGEWKTNLTPEKLGVVAMDPDSLSISGLHDYSKYLQQSGQESNRYELSMWSKVFA 279

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL---PV 337
           P  +  M L+A S      RS    + V  GIF GF+ Y +  +   FG+  ++    P+
Sbjct: 280 PFSVAVMMLMALSFIFGPLRSVPMGVRVVTGIFFGFVFYVLDQV---FGRLSLVYGIPPM 336

Query: 338 AAALIPVILTISLSILILLQKE 359
             AL+P +L + +SI +LL++ 
Sbjct: 337 LGALLPSMLFLLISICLLLKRR 358


>gi|160872818|ref|ZP_02062950.1| permease [Rickettsiella grylli]
 gi|159121617|gb|EDP46955.1| permease [Rickettsiella grylli]
          Length = 355

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 78/360 (21%), Positives = 146/360 (40%), Gaps = 25/360 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  +  + TTL  L   +IL  +I L      +G   +Y+++         +P      
Sbjct: 6   RYLGRTIIHTTLSVLGILLILFALIQLISETRDIGT-GHYTLTSAFSYVLLTLPSQFYNF 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+ +I+    L++ SEL+I  A G+S++Q+    +  ++ +   TVL+   +A  
Sbjct: 65  FPIAILLGSILGLNVLSKHSELMILHANGVSLYQMAWSLIKATLWMVFITVLIGEGLAPH 124

Query: 127 GEKI-----------GIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHI 175
             ++           G  L  Q      +   + I    I +P     +   +   +N++
Sbjct: 125 AARLAESHKFFLTTKGQTLTTQQGSVWIRDGHNFIYIQSILDPTHLNHVNCYQFDDDNNL 184

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
            +   +  ++ K K  H  D   ++I  +KVK KK + ++           T++I IK  
Sbjct: 185 LKASFAKQVNYKAKAWHAYDIATSLITLNKVK-KKFIAHEIWPFSFSPKLLTISI-IK-- 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
                 E+ + R  +E I       K N  +       F+  IV P+ L  M  +A   S
Sbjct: 241 -----PEEMSLRQLHEYIHY----RKKNHLNTSPYSFAFWKRIVEPISLWVMMCLAIPFS 291

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
            +  R+    +    GI  GF  Y +   +  F       P  AAL+P+ + + ++IL++
Sbjct: 292 FKHLRTLATSLKTLAGITIGFSFYLLNNFLGPFAIVYQWPPFLAALLPLFIFMLIAILLM 351


>gi|145219259|ref|YP_001129968.1| permease YjgP/YjgQ family protein [Prosthecochloris vibrioformis
           DSM 265]
 gi|145205423|gb|ABP36466.1| permease YjgP/YjgQ family protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 360

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 79/368 (21%), Positives = 156/368 (42%), Gaps = 39/368 (10%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATR-VPLI 62
           IL RY F+ ++KT ++  +   + +F++ +N ++N    +    +    VL   R +P  
Sbjct: 3   ILDRYIFQQFVKTFVFTTI-TFVSLFIL-INMVENLGDFMDRKLLFTDIVLYYLRAIPDT 60

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL---LGIFTVLV 119
           I    P  +L+ +I+V   L  +SEL   R+ G+S+ QLL PF++G I+   L I     
Sbjct: 61  ILITSPVSSLLASILVAGRLAGSSELPAIRSAGVSMRQLLYPFLLGGIIISTLNIINSFW 120

Query: 120 INPIAT-SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI---------FIGAKKI 169
           + PIA         D + + + NG  + S+    + I  P   +         F GAK++
Sbjct: 121 LAPIAAVHNHAFERDHLGKSRRNGAAEGSN----LHIIEPGSRVVTIGRLNTSFTGAKEV 176

Query: 170 LPENHIWE------DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDK 223
             E           D  S+  D  NK    ++A        +       EYQ       +
Sbjct: 177 SIEEFSGTGLRGRIDAESMRYDTGNKEWTLQNAA------QRRFTPGGEEYQ------AR 224

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLM 283
            + +L + + +    + + +     F +  + ++    +      R   + +  I +P  
Sbjct: 225 PALSLPLSLTLKSLAELNLRPDEMQFIQHWQYLAEKKHAGFAGLERTMVKLHTKIAVPFA 284

Query: 284 LVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIP 343
            + + LI   +S +  R      I    +F+GF+   +   + +FG +G++ P+ AA +P
Sbjct: 285 SLIIILIGVPLSAKKKRGGLATEI-GISLFAGFLFLGLQKTIATFGYNGVVNPMLAAWLP 343

Query: 344 VILTISLS 351
            +L +++ 
Sbjct: 344 NLLFLAIG 351


>gi|330899516|gb|EGH30935.1| permease YjgP/YjgQ [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330975730|gb|EGH75796.1| permease YjgP/YjgQ [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 353

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 98/229 (42%), Gaps = 19/229 (8%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLVINPIA 124
              L+  ++    L  +SEL I RA G+SI    W ++ P +V  ++ G+     + P A
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLV-LMIAGVLVGEYVAPYA 124

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T    
Sbjct: 125 ENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTRYRF 176

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
           D +  ++    A  A    D  +LK V    +     D ++  +N P++
Sbjct: 177 DDQRHMLTSSFAKEAHFKTDYWELKDVATTHFN----DGSTEVVNTPVE 221


>gi|297620918|ref|YP_003709055.1| putative permease, YjgP/YjgQ family [Waddlia chondrophila WSU
           86-1044]
 gi|297376219|gb|ADI38049.1| putative permease, YjgP/YjgQ family [Waddlia chondrophila WSU
           86-1044]
          Length = 371

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 67/127 (52%), Gaps = 12/127 (9%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSI-SRGAVLAAT----R 58
           I+WRY    Y K     ++G  +  F+  L  + +++ E+ ++++ S    LAA     +
Sbjct: 4   IIWRYLLSQYFK-----VMGLCVAAFIAVL--LTSRLDEIAHFAVLSPTPALAAQFILLQ 56

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+  +IP   L+ +I++   L+++ EL   R+ GIS+   L P +  S+L+      
Sbjct: 57  IPYILPIVIPVSCLISSILLVQRLSKSHELTAFRSCGISLKDFLTPILFSSVLVAFINFY 116

Query: 119 VINPIAT 125
           +I+ ++T
Sbjct: 117 IISELST 123


>gi|284929475|ref|YP_003421997.1| putative permease [cyanobacterium UCYN-A]
 gi|284809919|gb|ADB95616.1| predicted permease [cyanobacterium UCYN-A]
          Length = 382

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/315 (21%), Positives = 135/315 (42%), Gaps = 38/315 (12%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVV-GSILLGIFT 116
           ++P  +    P   L+  ++ +  L+  SE++  R++G+ I++L+ P V+ G I+ G   
Sbjct: 64  KIPGFLSLAFPMAILLAALMAYSRLSSDSEIIALRSLGVGIYRLVIPVVIFGFIVTGCAF 123

Query: 117 VL--VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQI---SNPQQDIFIGAKKILP 171
           V+   I P AT    I ++     K    K+ + + P  +     N Q+   +  +    
Sbjct: 124 VVNDWIAPAATHKAAIILEEAVSQKRPDFKRHNIVYPEYKTVKGKNGQESTML-TRLFHA 182

Query: 172 ENHIWEDFTSITI-----DKKNKIIHRKDADLAI------IYNDKVKL-------KKVVE 213
           E +  E+   +TI     +  N+I+  + A   I       +N  + L       + +V 
Sbjct: 183 EEYNGEEMKGLTILDRTQEGVNQIVTSESATWNISSNTWDFFNGTIYLIAPDGSYRNIVR 242

Query: 214 YQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQ 273
           +Q+ ++ + +    L      D  Q F+E   S +  E +K + FS         +   Q
Sbjct: 243 FQHQQLALPRAPLDL-----ADRRQNFTEMTISET-REYLKAVQFSGNEKRIRKVKVRLQ 296

Query: 274 FYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFML-YTIITIMK-SFGKS 331
             +   +P + +   L+ AS+ ++   +N+     ++G+  G +  Y I+  M  S G  
Sbjct: 297 EKY--AMPFVCLIFGLVGASIGVKPQNTNRA---TSFGVCVGLIFGYYILAFMSTSLGIW 351

Query: 332 GILLPVAAALIPVIL 346
           GIL P   A +P I+
Sbjct: 352 GILTPFLGAWLPNIV 366


>gi|238927586|ref|ZP_04659346.1| permease YjgP/YjgQ family protein [Selenomonas flueggei ATCC 43531]
 gi|238884511|gb|EEQ48149.1| permease YjgP/YjgQ family protein [Selenomonas flueggei ATCC 43531]
          Length = 379

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/304 (18%), Positives = 126/304 (41%), Gaps = 25/304 (8%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P ++    P   L+ +++ F  L+ +SE+   ++ GI   ++  P ++   ++ +  VL
Sbjct: 75  LPGVVMWTFPMSMLLASLLTFGRLSSSSEITAMKSCGIGFGRIAAPAILLGFVVSVGAVL 134

Query: 119 VINPIATSGEKIGIDLIQ-QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +         ++I  + + N   +  + +   +I   Q    + A+    E     
Sbjct: 135 FNEHVVPRANTAYRNVIYYEIEGNSGMKSQEHVIIKEIEGGQIKRLVYARSYDAEQQHLT 194

Query: 178 DFTSITIDKKNKIIHRKDADLA-------IIYNDKV------KLKKVVEYQYGRIPIDKN 224
             +        K+ H ++A+ A       I++   V       L++ + ++   +P++KN
Sbjct: 195 GVSLQIFGADGKVSHVENAEYAEWTGSEWIMHQGDVYDIADEHLERRMHFETQVLPVEKN 254

Query: 225 STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
                 P ++   QK  E+   R     I  M    ++   +  + E + Y  + +P+  
Sbjct: 255 ------PRQIIREQKAPEEMTMRELRHQITLM----QTQYVNTNKLEAELYQRVSVPMAS 304

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
           +  TLI   + L+ +R N      A  +   F+ Y ++T+  +  + G+L P+ A  IP 
Sbjct: 305 LIFTLIGVPLGLQPTR-NSSSAGFAMSVIIIFIYYALMTMGNALARGGVLPPMFAVWIPN 363

Query: 345 ILTI 348
           I+ I
Sbjct: 364 IVGI 367


>gi|94495767|ref|ZP_01302347.1| permease YjgP/YjgQ [Sphingomonas sp. SKA58]
 gi|94425155|gb|EAT10176.1| permease YjgP/YjgQ [Sphingomonas sp. SKA58]
          Length = 366

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 80/382 (20%), Positives = 144/382 (37%), Gaps = 58/382 (15%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL---AATRVPLIIQ 64
           Y  + +L  T   L  AM++V +  L+ + N  G++  Y  +  A L      R P II 
Sbjct: 14  YMARLFLTRTFAVL--AMLVVVLQTLDLLGNS-GDILAYPGNSDAQLWHYVGLRAPQIIA 70

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV-----LV 119
             +PF  L+  +V+   LN+ SE++  +A G+S  Q+L P V+ ++ + I +      +V
Sbjct: 71  TFLPFSVLLGTLVMLATLNQNSEIISMKAAGLSAHQILAPLVLAALGVSIISFVFNERIV 130

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           +   A       +D      D+G K      PW++  N   +  I A +           
Sbjct: 131 VRSTAALSAWEAVDYGPVPPDSGVKSN----PWVRDGNNLVNAAIVAGR----------G 176

Query: 180 TSITIDKKNKIIHRKDADLAIIYND-KVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
           T++ + +              IYN    +L  +V+   G   +   S  L    + D  +
Sbjct: 177 TAVQLRQVE------------IYNRINNRLTTIVQAPKGHYDVASKSWVLEGARQFDVAR 224

Query: 239 KFSEQFASRSFYEIIKKMSFS-----NKSNIFHNYRA---------------ETQFYFLI 278
                  +  F   I+   F+       +  FH   A               E   +  +
Sbjct: 225 GTVSNIGTVRFGRDIRPDQFTLARVDPDALTFHELEAAIGDLRDAGRPTKELEGSLWHKL 284

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
             PL  + M ++ +  +   +RS Q  +    G+  GF  +       + G  G   PV 
Sbjct: 285 SGPLSALLMPILGSVAAFGLARSGQLFMRAVLGMALGFAYFVADNFSLAMGNLGAYPPVL 344

Query: 339 AALIPVILTISLSILILLQKED 360
           AA  P  L + +   +L + E+
Sbjct: 345 AAWAPFFLFLLVGETVLFRTEE 366


>gi|262367136|gb|ACY63693.1| membrane protein [Yersinia pestis D182038]
          Length = 358

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/382 (21%), Positives = 160/382 (41%), Gaps = 47/382 (12%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L T L  LL  + L  +I   +   ++G+  +YS +   +     +P
Sbjct: 1   MFGVLDRYIGRTILNTILMTLLMLVSLSGIIKFVDQLRKVGQ-GDYSAASAGMYTILSIP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I    P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ + 
Sbjct: 60  KDIAVFFPMAALLGALLGLGTLASRSELVVMQASGFTRMQIAASVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE+   +   Q    G    +    W +  +     FI  +++  E+ +    T
Sbjct: 120 EWVAPQGEQTARNFRTQQMYGGSLLSTQSGLWAKDGSD----FIYIQRVSGESEL----T 171

Query: 181 SITI---DKKNKIIHRKDADLAIIYNDKV--KLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
            + I   DK+++++  + A  A    D    +L +V E            + L+ P ++ 
Sbjct: 172 GVNIYHFDKEDRLLSVRYAATATYEKDNKTWRLSQVDE------------SDLSNPTQVT 219

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKS---NIFHNY------------RAETQFYFLIVI 280
           G Q  + ++ +    E +  ++    S   +  H+Y            R E   +  +  
Sbjct: 220 GSQTLTGEWKTNLTPEKLGVVAMDPDSLSISGLHDYSKYLQQSGQESNRYELSMWSKVFA 279

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL---PV 337
           P  +  M L+A S      RS    + V  GIF GF+ Y +  +   FG+  ++    P+
Sbjct: 280 PFSVAVMMLMALSFIFGPLRSVPMGVRVVTGIFFGFVFYVLDHV---FGRLSLVYGIPPM 336

Query: 338 AAALIPVILTISLSILILLQKE 359
             AL+P +L + +SI +LL++ 
Sbjct: 337 LGALLPSMLFLLISICLLLKRR 358


>gi|296114025|ref|YP_003627963.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis RH4]
 gi|295921719|gb|ADG62070.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis RH4]
 gi|326566094|gb|EGE16251.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis BC1]
 gi|326572162|gb|EGE22158.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis BC7]
 gi|326573712|gb|EGE23670.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis O35E]
          Length = 369

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 162/377 (42%), Gaps = 42/377 (11%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQI 66
           KY +++ L  + GA++ ++++ +  +   + EL N    Y+++   +    R P  + Q 
Sbjct: 8   KYVIRSALLAMAGAVVGLWLVQM--VFAYLAELDNISETYTLTDALLFILYRSPYFLVQF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISI-----WQLLNP--FVVGSILLGIFTVLV 119
           IP  TL+  ++    L   SEL++ RA G+SI     W +L    FVV S+ +  F +  
Sbjct: 66  IPTGTLLGAVIGLGLLANHSELIVMRAAGMSIYRIVSWAMLPAVIFVVISLGVNQFVLPT 125

Query: 120 INPIATS--GEKIGIDLIQ---QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
            N  A +   + I   LI     W  N D    D++    IS    +  +G  K     +
Sbjct: 126 ANQHAAAIRADTIYDKLITIDGYWSVNHDGDNQDVV---YISYADNEGGLGEVK----RY 178

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK----LKKVVEYQYGRIPIDKNSTT--- 227
             +D   IT  K    ++   +D  ++   K +    L  + E   G   + +  +    
Sbjct: 179 QLKDGQLITALKAKSGVYLPQSD-DVMNAQKARYTWQLSGIDEIGIGTSQVQQAHSEGKI 237

Query: 228 LNIPIKMDG---FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
           L +PI         K  E  +  S Y   + M+     ++ H    E  F+  ++ P  +
Sbjct: 238 LTLPIAPTDVYLLTKEPEDLSLSSLYAHRQLMAHQGTRSLRH----ELAFWQKLLSPFAV 293

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF-GKSGILLPVAAALIP 343
           +++ L+A+S      RS    + V   + +G +L++ +T +  F   +  L P+  AL+P
Sbjct: 294 LSLVLVASSFVFGSLRSQGLGLRVVLALLTG-LLFSYLTDLTGFVALATGLSPLLMALVP 352

Query: 344 VILTISLSILILLQKED 360
           ++L+    + +L +K  
Sbjct: 353 IVLSAMAGMYLLNRKSS 369


>gi|304437499|ref|ZP_07397457.1| permease YjgP/YjgQ family protein [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304369549|gb|EFM23216.1| permease YjgP/YjgQ family protein [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 376

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/311 (18%), Positives = 130/311 (41%), Gaps = 25/311 (8%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P ++    P   L+ +++ F  L+ +SE+   ++ GI   ++  P ++   L+ +  +L
Sbjct: 72  LPGVVMWTFPMSMLLASLLTFGRLSSSSEITAMKSCGIGFGRIAAPAILLGFLVSVGAIL 131

Query: 119 VINPIATSGEKIGIDLIQ-QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +         ++I  + + N   +  + +   +I   Q    + A+    E     
Sbjct: 132 FNEHVVPRANTAYRNVIYYEIEGNSGMKSQEHVIIKEIEGGQIKRLVYARSYNAEQQQLT 191

Query: 178 DFTSITIDKKNKIIHRKDADLA-------IIYNDKV------KLKKVVEYQYGRIPIDKN 224
             +        K+ H ++A+ A       I++   V       L++ + ++   +P++K+
Sbjct: 192 GVSLQIFGADGKVSHVENAEYAEWTGSEWIMHKGDVYDIADEHLERRMRFETQVLPVEKD 251

Query: 225 STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
                 P ++   QK  E+   R     I  M    ++   +  + E + Y  + +P+  
Sbjct: 252 ------PRQIIREQKSPEEMTMRELRHQIALM----QTQYVNTSKLEAELYQRVSVPMAS 301

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
           +  TLI   + L+ +R N      A  +   F+ Y ++T+  +F +  +L P+ A  IP 
Sbjct: 302 LIFTLIGVPLGLQPTR-NSSSAGFAMSVIIIFIYYALMTMGNAFARGEVLPPMLAVWIPN 360

Query: 345 ILTISLSILIL 355
           I+ I   I++L
Sbjct: 361 IVGIIAGIILL 371


>gi|294793349|ref|ZP_06758494.1| membrane protein, YjgP/YjgQ family [Veillonella sp. 6_1_27]
 gi|294455780|gb|EFG24145.1| membrane protein, YjgP/YjgQ family [Veillonella sp. 6_1_27]
          Length = 363

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 126/307 (41%), Gaps = 30/307 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+    P   L+ +++ F  L+ TSE+V+ RA G+S  +L  P  + ++++ I  V 
Sbjct: 58  LPSIVILTFPMSVLLASLMTFSRLSSTSEIVVMRAGGLSFLRLAMPVYIIALIISIGAVA 117

Query: 119 VINPIATSGEKIGIDLI-QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +      +   ++ +Q   N   Q  + I    ++  +    + AK    E     
Sbjct: 118 FNEFVVPRTNHMYQTIVREQIMKNASPQTQNHIVLKTMNGDELGTLLYAKSYDAETKQLS 177

Query: 178 DFTSITIDKKNKIIHRKDADLA------------IIYNDKV--KLKKVVEYQYGRIPIDK 223
             T     +  K+   ++AD A            IIY+      +++ ++++   +PI  
Sbjct: 178 MITVQQFGEGGKLQQVENADTAIWNGQYWVMQNGIIYDLSAGNGVERTMKFKEQSLPIK- 236

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK--KMSFSNKSNIFHNYRAETQFYFLIVIP 281
                + P  +   Q+  E+   +     I+  K +++N + +      E + Y    IP
Sbjct: 237 -----SAPKDIQQDQRKPEELTIKELRHQIRAYKAAYTNANKL------EMEMYQRFTIP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+ A + L+  RS+         +   F+ Y ++T   + GK G L  V AAL
Sbjct: 286 LASFVFALVGAPLGLQKQRSSSSIGFGISILII-FIYYGVMTFAGALGKGGALPTVLAAL 344

Query: 342 IPVILTI 348
           IP  L I
Sbjct: 345 IPDTLGI 351


>gi|289678193|ref|ZP_06499083.1| permease YjgP/YjgQ [Pseudomonas syringae pv. syringae FF5]
          Length = 321

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 125/300 (41%), Gaps = 35/300 (11%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLVINPIA 124
              L+  ++    L  +SEL I RA G+SI    W ++ P +V  ++ G+     + P A
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLV-LMIAGVLVGEYVAPYA 124

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T    
Sbjct: 125 ENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTRYRF 176

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQF 244
           D +  ++    A  A    D  +LK V    +     D ++  +N P+     +++    
Sbjct: 177 DDQRHMLTSSFAKEAHFKTDYWELKDVATTHFN----DGSTEVVNTPV-----ERWDVAL 227

Query: 245 ASRSFYEII---KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLIAAS 293
           + +    +I   + +S S   +  H        N R    F+  ++ P + VA+ L+A S
Sbjct: 228 SPQLLSTVIMPPESLSISGLWSYAHYLADQGLSNGRYWLAFWTKVLQPAVTVALVLMAIS 287


>gi|292669943|ref|ZP_06603369.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292648414|gb|EFF66386.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 366

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 139/323 (43%), Gaps = 44/323 (13%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG----- 113
           +P ++    P   L+ +++ F  L+  SE+   ++ GI   ++  P    +ILLG     
Sbjct: 62  LPGVVMWTFPMAMLLASLLTFGRLSSASEITAMKSCGIGFGRIAAP----AILLGFIVSV 117

Query: 114 --IFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP 171
             IF    + P A +  +  +   +   ++G K +  +I   +I   Q    + A+    
Sbjct: 118 GAIFFNEHVVPRANTAYR-NVIYYEIEGNSGMKSQEHVI-IKEIEEGQIRRLVYARSYDA 175

Query: 172 ENHIWEDFTSITID---KKNKIIHRKDADLA-------IIYNDKV------KLKKVVEYQ 215
           E    E  T I++       K+ H ++A+ A       I++N  V       L++ + ++
Sbjct: 176 EQ---ERLTGISLQVFGDDGKVTHVENAEYAEWTGTEWIMHNGDVYDIADEHLERRMRFE 232

Query: 216 YGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFY 275
              +P+ K+      P ++   QK  E+   R     I  M    ++   +  + E + Y
Sbjct: 233 TQVLPVQKD------PRQIIREQKVPEEMTMRELRHQIALM----QTQYVNTSKLEAELY 282

Query: 276 FLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL 335
             + +P+  +  TLI   + L+ +R N      A  +   F  Y ++T+  +F +  +L 
Sbjct: 283 QRVSVPMASLIFTLIGVPLGLQPTR-NSSSAGFAMSVIIIFFYYALMTMGNAFARGEVLP 341

Query: 336 PVAAALIPVILTISLSILILLQK 358
           P+ A  IP I+ I ++  ILL++
Sbjct: 342 PMLAVWIPNIVGI-IAGTILLRR 363


>gi|282850060|ref|ZP_06259442.1| YjgP/YjgQ family [Veillonella parvula ATCC 17745]
 gi|282580249|gb|EFB85650.1| YjgP/YjgQ family [Veillonella parvula ATCC 17745]
          Length = 363

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 126/307 (41%), Gaps = 30/307 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+    P   L+ +++ F  L+ TSE+V+ RA G+S  +L  P  + ++++ I  V 
Sbjct: 58  LPSIVILTFPMSVLLASLMTFSRLSSTSEIVVMRAGGLSFLRLAMPVYIIALIISIGAVA 117

Query: 119 VINPIATSGEKIGIDLI-QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +      +   ++ +Q   N   Q  + I    ++  +    + AK    E     
Sbjct: 118 FNEFVVPRTNHMYQTIVREQIMKNASPQTQNHIVLKTMNGDELGTLMYAKSYNAETKQLS 177

Query: 178 DFTSITIDKKNKIIHRKDADLA------------IIYNDKV--KLKKVVEYQYGRIPIDK 223
             T     +  K+   ++AD A            IIY+      +++ ++++   +PI  
Sbjct: 178 MITVQQFGEGGKLQQVENADTAIWNGQYWVMQNGIIYDLSAGNGVERTMKFKEQSLPIK- 236

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK--KMSFSNKSNIFHNYRAETQFYFLIVIP 281
                + P  +   Q+  E+   +     I+  K +++N + +      E + Y    IP
Sbjct: 237 -----SAPKDIQQDQRKPEELTIKELRHQIRAYKAAYTNANKL------EMEMYQRFTIP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+ A + L+  RS+         +   F+ Y ++T   + GK G L  V AAL
Sbjct: 286 LASFVFALVGAPLGLQKQRSSSSIGFGISILII-FIYYGVMTFAGALGKGGALPTVLAAL 344

Query: 342 IPVILTI 348
           IP  L I
Sbjct: 345 IPDTLGI 351


>gi|313895766|ref|ZP_07829321.1| permease, YjgP/YjgQ family [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975595|gb|EFR41055.1| permease, YjgP/YjgQ family [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 366

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/310 (19%), Positives = 133/310 (42%), Gaps = 37/310 (11%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFV-------VGSIL 111
           +P ++    P   L+ +++ F  L+  SE+   ++ GI+  ++  P V       VG+IL
Sbjct: 62  LPGVVMWTFPMSMLLASLLTFGKLSSASEITAMKSCGINFTRIAAPAVLLGFVVSVGAIL 121

Query: 112 LGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP 171
              + V    P A +  +  +   +   ++G K +  +I   +I++ Q    + A+    
Sbjct: 122 FNEYVV----PRANTAYR-NVIYYEIEGNSGMKSQEHVI-IKEITDGQIRRLVYARAYDA 175

Query: 172 ENHIWEDFTSITIDKKNKIIHRKDADLA-------IIYNDKV------KLKKVVEYQYGR 218
           E     + +        K+ H ++A+ A       I+++  V       +++ + ++   
Sbjct: 176 EQQRLTNVSLQVFGDDGKVSHVENAEYAEWTGKEWIMHSGDVYDIADEHMERHMRFETQV 235

Query: 219 IPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLI 278
           +P+ K+      P ++   QK  E+   R     I  M    ++   +  + E + Y  +
Sbjct: 236 LPVQKD------PRQIIREQKSPEEMTMRELRRQIALM----QTQYVNTNKLEAELYQRV 285

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
            +P+  +  TLI   + ++ +R N      A  +   F  Y ++T+  +F + G+L P+ 
Sbjct: 286 SVPMASLIFTLIGVPLGIQPTR-NSSSAGFAMSVIIIFFYYALMTMGNAFARGGVLPPML 344

Query: 339 AALIPVILTI 348
           A  IP I+ I
Sbjct: 345 AVWIPNIVGI 354


>gi|313894646|ref|ZP_07828209.1| permease, YjgP/YjgQ family [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313440836|gb|EFR59265.1| permease, YjgP/YjgQ family [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 363

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 126/307 (41%), Gaps = 30/307 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+    P   L+ +++ F  L+ TSE+V+ RA G+S  +L  P  + ++++ I  V 
Sbjct: 58  LPSIVILTFPMSVLLASLMTFSRLSSTSEIVVMRAGGLSFLRLAMPVYIIALMISIGAVA 117

Query: 119 VINPIATSGEKIGIDLI-QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +      +   ++ ++   N   Q  + I    ++  +    + AK    E     
Sbjct: 118 FNEFVVPRTNHMYQTIVREEIMKNATPQTQNHIVLKAMNGDELGTLMYAKSYNAETKQLS 177

Query: 178 DFTSITIDKKNKIIHRKDADLA------------IIYNDKV--KLKKVVEYQYGRIPIDK 223
             T     +  K+   ++AD A            IIY+      +++ ++++   +PI  
Sbjct: 178 MITVQQFGEGGKLQQVENADTAIWNGQYWVMQNGIIYDVSAGDGVERTMKFKEQSLPIK- 236

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK--KMSFSNKSNIFHNYRAETQFYFLIVIP 281
                + P  +   Q+  E+   +     IK  K +++N + +      E + Y    IP
Sbjct: 237 -----SAPKDIQQDQRKPEELTIKELRHQIKAYKAAYTNANKL------EMEMYQRFTIP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+ A + L+  RS+         +   F+ Y ++T   + GK G L  V AAL
Sbjct: 286 LASFVFALVGAPLGLQKQRSSSSIGFGISILII-FIYYGVMTFAGALGKGGALPTVLAAL 344

Query: 342 IPVILTI 348
           IP  L I
Sbjct: 345 IPDTLGI 351


>gi|320530395|ref|ZP_08031454.1| hypothetical protein HMPREF9555_01558 [Selenomonas artemidis F0399]
 gi|320137359|gb|EFW29282.1| hypothetical protein HMPREF9555_01558 [Selenomonas artemidis F0399]
          Length = 369

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/310 (19%), Positives = 133/310 (42%), Gaps = 37/310 (11%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFV-------VGSIL 111
           +P ++    P   L+ +++ F  L+  SE+   ++ GI+  ++  P V       VG+IL
Sbjct: 65  LPGVVMWTFPMSMLLASLLTFGKLSSASEITAMKSCGINFTRIAAPAVLLGFVVSVGAIL 124

Query: 112 LGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP 171
              + V    P A +  +  +   +   ++G K +  +I   +I++ Q    + A+    
Sbjct: 125 FNEYVV----PRANTAYR-NVIYYEIEGNSGMKSQEHVI-IKEITDGQIRRLVYARAYDA 178

Query: 172 ENHIWEDFTSITIDKKNKIIHRKDADLA-------IIYNDKV------KLKKVVEYQYGR 218
           E     + +        K+ H ++A+ A       I+++  V       +++ + ++   
Sbjct: 179 EQQRLTNVSLQVFGDDGKVSHVENAEYAEWTGKEWIMHSGDVYDIADEHMERHMRFETQV 238

Query: 219 IPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLI 278
           +P+ K+      P ++   QK  E+   R     I  M    ++   +  + E + Y  +
Sbjct: 239 LPVQKD------PRQIIREQKSPEEMTMRELRRQIALM----QTQYVNTNKLEAELYQRV 288

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
            +P+  +  TLI   + ++ +R N      A  +   F  Y ++T+  +F + G+L P+ 
Sbjct: 289 SVPMASLIFTLIGVPLGIQPTR-NSSSAGFAMSVIIIFFYYALMTMGNAFARGGVLPPML 347

Query: 339 AALIPVILTI 348
           A  IP I+ I
Sbjct: 348 AVWIPNIVGI 357


>gi|85374866|ref|YP_458928.1| permease [Erythrobacter litoralis HTCC2594]
 gi|84787949|gb|ABC64131.1| predicted permease [Erythrobacter litoralis HTCC2594]
          Length = 365

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/351 (20%), Positives = 135/351 (38%), Gaps = 65/351 (18%)

Query: 38  NQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
           N  GEL  Y        A  RVP ++Q+ +P+  L+  I+    LN+ SE++  +A G+S
Sbjct: 52  NGQGELLTY--------AGLRVPQLVQRFLPYSVLLATIITLIALNQNSEVIAMKAAGLS 103

Query: 98  IWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWK---------DNGDK---- 144
             Q+L P ++ + L+ + +      + T         ++ W+         D+  K    
Sbjct: 104 AHQVLAPLLLTAGLVALVSFGFNERVVTRATAT----LKAWEATEFGAVPPDSDVKANVY 159

Query: 145 --QKSDIIPWMQISNPQQDIFIGA---KKILPENHIWEDFTSIT---IDKKNKIIHRKDA 196
               ++I+    ++    DI +G     +  P   I E   +++   +D   ++ + +  
Sbjct: 160 ITDGTNILTARTVAGTGADIRLGDVTWYRRAPTGQIAEQVRAVSASFVDPGWQLENPQSF 219

Query: 197 DLAIIYNDKVKLKKVVEYQYGRIP-------IDKNSTTLNIPIKMDGFQKFSEQFASRSF 249
           D+        +   V E   G  P       ID ++    +P     F +      S   
Sbjct: 220 DITTANTTTSEAMVVGE---GLTPAQIELEAIDPDA----VP-----FWRLGSAIDS--- 264

Query: 250 YEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVA 309
           YE I + +   ++  +H              PL    M L+ A  +   +RS Q  I   
Sbjct: 265 YEAIGRRTAELRAKWWHKLSG----------PLSAFLMPLLGAVAAFGLARSGQLFIRAV 314

Query: 310 YGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
            G+  GF  + +     + G  G   P  AA  P +L + +   +L++ E+
Sbjct: 315 IGMGLGFAYFVVDNAALAMGSFGGYPPFLAAWAPFLLFLLVGETVLIRTEE 365


>gi|193215417|ref|YP_001996616.1| permease YjgP/YjgQ family protein [Chloroherpeton thalassium ATCC
           35110]
 gi|193088894|gb|ACF14169.1| permease YjgP/YjgQ family protein [Chloroherpeton thalassium ATCC
           35110]
          Length = 360

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 87/381 (22%), Positives = 155/381 (40%), Gaps = 49/381 (12%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RY F+ Y  T  + +L  + L  ++DL E  +   +  N  +   A       P II
Sbjct: 3   ILDRYIFREYFSTLGFAILAFVSLFILVDLIEKVDDFLD-KNVELKLIAQYYLYFTPEII 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP-FVVGSILLGIFTVLV--I 120
           + I+P  TL+ ++ V   L + +EL   +A GIS+++LL P F+VG+I+ GI   L   +
Sbjct: 62  KLIVPISTLLASLFVTGKLAKQTELTAMKAGGISLYRLLLPFFLVGAIIGGIDFYLSGWV 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF- 179
            P  T           ++K+  D        W   S    ++     +I+   +  +D  
Sbjct: 122 VPETT-----------KFKEQFDATYLGKTKWKSSSFSNIELLENPNRIVRIGYFNKDTR 170

Query: 180 ----TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
                S+   +K+ ++ R DA   + Y+    L + + YQ             +   K+D
Sbjct: 171 TCQNVSLQNYQKSHMLWRIDA-AKMTYD--TSLSRWIFYQAYYRDFQSGKEQFSYAAKID 227

Query: 236 GFQ------KFSEQFASRS---------FYEIIKKMSFSNKSNIFHNYRAETQFYFLIVI 280
             Q      +  E  A+           + E  ++  FSN       Y  +  F      
Sbjct: 228 TVQLVFSAKELEENNAALDQMSLDEHWKYIEARRRAGFSNVDEALVKYHIKISF------ 281

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGI--FSGFMLYTIITIMKSFGKSGILLPVA 338
           P+  + + LI   +S E  RS    I +  GI    GF+   +     + G  G + P+ 
Sbjct: 282 PIACLIVILIGVPLSAEKKRSG---IALEAGISLLIGFLYIILQKTFSTLGYKGAVDPIL 338

Query: 339 AALIPVILTISLSILILLQKE 359
           +A IP  L +++ ++ L + +
Sbjct: 339 SAWIPNFLFLTVGLVFLFKAK 359


>gi|118602882|ref|YP_904097.1| permease YjgP/YjgQ family protein [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567821|gb|ABL02626.1| permease YjgP/YjgQ family protein [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
          Length = 360

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 124/256 (48%), Gaps = 33/256 (12%)

Query: 13  YLKTTLYFLLGAMILVFV-----IDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y+  T+ F   A++LV++      +  E    +G+  NY++        + +P ++    
Sbjct: 7   YIVKTMAFYTSAVMLVWLGIYAFFNFLEEVTFIGQ-ANYTVFEVTKYVISDIPAVVYSYS 65

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
             I L+ +++   +L  TS+LV+ R+ G+SI Q+ N  VV + L+ I  V+ I  + T  
Sbjct: 66  SVIILLGSLLALGHLASTSQLVVIRSAGVSIMQISN-IVVRAALMFIAIVIFIGELVT-- 122

Query: 128 EKIGIDLIQQWKDNGDKQ----KSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
             I I+  +  +     +    K+    W++ S    ++FI  KK   +   ++D T I 
Sbjct: 123 -PITIEYAESLRAKALGENITFKNQQGFWLKDS----ELFIHVKKNF-DGKSFQDVTLIK 176

Query: 184 I---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
           +   D  + I+H   +D AI   D ++L + + YQ+G+   D N TT +     + F+K+
Sbjct: 177 LRAPDTLDSIVH---SDSAISNGDNLELSQSIHYQFGK---DGNLTTFS----ENNFEKY 226

Query: 241 SEQFA-SRSFYEIIKK 255
           S Q + ++   E +KK
Sbjct: 227 SVQVSFNKKLIENLKK 242


>gi|242240954|ref|YP_002989135.1| permease YjgP/YjgQ family protein [Dickeya dadantii Ech703]
 gi|242133011|gb|ACS87313.1| permease YjgP/YjgQ family protein [Dickeya dadantii Ech703]
          Length = 356

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 149/366 (40%), Gaps = 23/366 (6%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           +L RY  K    T +  L   + L  +I   +   ++G+  +YS+    +     VP  I
Sbjct: 4   VLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLRKVGQ-GSYSVLGAGLYTLLSVPKDI 62

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +   P   L+  ++   NL   SELV+ +A G +  Q+    +  +I L + T+ +   +
Sbjct: 63  EIFFPMAALLGALLGLGNLATRSELVVMQASGFTRLQIAGSVMKTAIPLVLLTMAIGEWL 122

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           A  GE++  +   Q    G    +    W +  N     F+  +++  EN +      + 
Sbjct: 123 APPGEQMARNYRSQMMYGGSMLSTQSGLWAKDGND----FVYIQRVQGENEL----VGVN 174

Query: 184 I---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-------GRIPIDKNSTTLNIPIK 233
           I   D ++K++  + A  A+  N   +L +V E          G   I     T   P K
Sbjct: 175 IYHFDNQSKLLSVRYAASAVYENGVWQLSQVEESDLRSNKQISGSQTISGEWKTGLTPDK 234

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
           +       +  + R  Y+ I  +  S++       R +   +  +  PL +  M L+A S
Sbjct: 235 LGVVALDPDALSIRGLYDYINYLKQSDQ----EASRYQLNMWSKLFAPLSVAVMMLMALS 290

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
                 RS    + +  GI  GF+ Y +  I         + PV  AL+P  L + +SI+
Sbjct: 291 FIFGPLRSVPAGVRIVIGISFGFLFYVLDQIFGPLSLVYRIPPVLGALLPSALFLFISIM 350

Query: 354 ILLQKE 359
           +LL++ 
Sbjct: 351 LLLKRR 356


>gi|77457218|ref|YP_346723.1| permease YjgP/YjgQ [Pseudomonas fluorescens Pf0-1]
 gi|77381221|gb|ABA72734.1| putative ABC transport system, membrane protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 353

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/305 (20%), Positives = 125/305 (40%), Gaps = 41/305 (13%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGI 114
            P  +  ++P   L+  ++   +L  +SEL + RA G+SI    W ++ P +V  +L G+
Sbjct: 56  APRRLYDMLPMAALIGCLIGLGSLASSSELTVMRAAGVSIGRIVWAVMKPMLV-LMLAGV 114

Query: 115 FTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
                + P   S  +    L Q    +GD Q +    W +    Q D FI    + P   
Sbjct: 115 LIGEYVAPATESMAQANRSLAQ---GSGDAQSAKHGMWHR----QGDEFIHINSVQPNGR 167

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
           ++   T    DK+  ++    A  A    D  +L  V   ++     ++++  +N P+  
Sbjct: 168 LY-GVTRYHFDKERHLLSSSFAKRAEFDTDHWQLTDVTTTKFH----ERSTEVVNTPV-- 220

Query: 235 DGFQKFSEQFASRSFYEII---KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLM 283
              +++    + +    ++   + +S +      H        N R    F+  ++ PL+
Sbjct: 221 ---ERWDVSLSPQLLSTVVMAPESLSITGLWGYIHYLADQGLSNGRYWLAFWVKVLQPLV 277

Query: 284 LVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFML-YTIITIMKSFGKSGILL---PVAA 339
             A+ L+A S      RS    + +   +F+G ++ +T   +    G S ++    P+ A
Sbjct: 278 TAALVLMAISFIFGPLRS----VTLGQRVFTGVLVGFTFRIVQDLLGPSSLVFGFSPLFA 333

Query: 340 ALIPV 344
            L+P 
Sbjct: 334 VLVPA 338


>gi|330950945|gb|EGH51205.1| permease YjgP/YjgQ [Pseudomonas syringae Cit 7]
          Length = 353

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 99/232 (42%), Gaps = 25/232 (10%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLV---IN 121
              L+  ++    L  +SEL I RA G+SI    W ++ P     +LL I  VLV   + 
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPM----LLLMIAGVLVGEYVA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T 
Sbjct: 122 PYAENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
              D +  ++    A  A    D  +LK V    +     D ++  +N P++
Sbjct: 174 YRFDDQRHMLTSSFAKEANFKTDYWELKDVTTTHFN----DGSTKVINTPVE 221


>gi|294795168|ref|ZP_06760302.1| putative membrane protein, YjgP/YjgQ family [Veillonella sp.
           3_1_44]
 gi|294453960|gb|EFG22335.1| putative membrane protein, YjgP/YjgQ family [Veillonella sp.
           3_1_44]
          Length = 363

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 125/307 (40%), Gaps = 30/307 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+    P   L+ +++ F  L+ TSE+V+ RA G+S  +L  P  + ++++ I  V 
Sbjct: 58  LPSIVILTFPMSVLLASLMTFSRLSSTSEIVVMRAGGLSFLRLAMPVYIIALIISIGAVA 117

Query: 119 VINPIATSGEKIGIDLI-QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +      +   ++ +Q   N   Q  + I    ++       + AK    E     
Sbjct: 118 FNEFVVPRTNNMYQTIVREQIMKNASPQTQNHIVLKTMNGNDLGTLMYAKSYNAETKKLS 177

Query: 178 DFTSITIDKKNKIIHRKDADLA------------IIYNDKV--KLKKVVEYQYGRIPIDK 223
             T     +  K+   ++AD A            IIY+      +++ ++++   +PI  
Sbjct: 178 MITVQQFGEGGKLQQVENADTAVWNGQYWVMQNGIIYDISAGDGVERTMKFKEQSLPIK- 236

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK--KMSFSNKSNIFHNYRAETQFYFLIVIP 281
                + P  +   Q+  E+   +     IK  K +++N + +      E + Y    IP
Sbjct: 237 -----SAPKDIQQDQRKPEELTIKELRHQIKAYKAAYTNANKL------EMEMYQRFTIP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+ A + L+  RS+         I   F+ Y ++T   + GK G L  V AAL
Sbjct: 286 LASFVFALVGAPLGLQKQRSSSSISFGIS-ILIIFIYYGVMTFAGALGKGGALPTVFAAL 344

Query: 342 IPVILTI 348
           IP  L I
Sbjct: 345 IPDTLGI 351


>gi|159028498|emb|CAO87305.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 389

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/328 (21%), Positives = 144/328 (43%), Gaps = 39/328 (11%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P  I    P   L+  ++ +  L   SEL+  ++IGIS+++L+ P +V S+++   T 
Sbjct: 72  KMPEFIVLAFPMSILLAALMAYSRLASDSELIAFKSIGISVYRLIIPAIVLSLIVTGLTY 131

Query: 118 LVINPIATSGE-KIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKIL-----P 171
           +  + +A +   +    + +  + N      D I + +    +      A+ +L      
Sbjct: 132 IFNDYVAPAASYEANATMTKALRPNRKSFIEDNIIYPEYGKVRPPDGGEAQTVLRRLFYA 191

Query: 172 ENHIWEDFTSITIDKK-----NKIIHRKDADLAI------IYNDKVKL-------KKVVE 213
           E    ++   +TI  +     N+II  + A   I       YN  + L       + +V 
Sbjct: 192 ERFNGQEMLGLTILDRTQPEVNQIITSETASWNIEKNIWDFYNGTIYLIDPNGSYRNIVR 251

Query: 214 YQYGRIPIDKNSTTLNIPIK-MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAET 272
           +Q+ ++ + +  T L++  +  DG +    Q  +R + EI++      K+      + + 
Sbjct: 252 FQHQQLALPR--TPLDLAFRGRDGSEMTLRQ--AREYLEILQLSGNPTKTR-----KLQV 302

Query: 273 QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKSFGK 330
           Q    I +P + +   +I A++ L    SN+     ++GI     F  Y +  +  S G 
Sbjct: 303 QIEQKISLPFVCLVFGMIGAALGLRPQNSNKA---TSFGICIVLIFSYYLLSFVTSSLGI 359

Query: 331 SGILLPVAAALIPVILTISLSILILLQK 358
            G+L P+ AA +P IL ++   ++LLQ 
Sbjct: 360 GGVLTPLMAAWLPNILGLTAGGILLLQS 387


>gi|238019692|ref|ZP_04600118.1| hypothetical protein VEIDISOL_01566 [Veillonella dispar ATCC 17748]
 gi|237863733|gb|EEP65023.1| hypothetical protein VEIDISOL_01566 [Veillonella dispar ATCC 17748]
          Length = 363

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 125/307 (40%), Gaps = 30/307 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+    P   L+ +++ F  L+ TSE+V+ RA G+S  +L  P  + ++++ I  V 
Sbjct: 58  LPSIVILTFPMSVLLASLMTFSRLSSTSEIVVMRAGGLSFLRLAMPVYIIALIISIGAVA 117

Query: 119 VINPIATSGEKIGIDLI-QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +      +   ++ +Q   N   Q  + I    ++       + AK    E     
Sbjct: 118 FNEFVVPRTNNMYQTIVREQIMKNASPQTQNHIVLKTMNGNDLGTLMYAKSYNAETKKLS 177

Query: 178 DFTSITIDKKNKIIHRKDADLA------------IIYNDKV--KLKKVVEYQYGRIPIDK 223
             T     +  K+   ++AD A            IIY+      +++ ++++   +PI  
Sbjct: 178 MITVQQFGEGGKLQQVENADTAVWNGQYWVMQNGIIYDISAGDGVERTMKFKEQSLPIK- 236

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK--KMSFSNKSNIFHNYRAETQFYFLIVIP 281
                + P  +   Q+  E+   +     IK  K +++N + +      E + Y    IP
Sbjct: 237 -----SAPKDIQQDQRKPEELTIKELRHQIKAYKAAYTNANKL------EMEMYQRFTIP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+ A + L+  RS+         +   F+ Y ++T   + GK G L  V AAL
Sbjct: 286 LASFVFALVGAPLGLQKQRSSSSIGFGISILII-FIYYGVMTFAGALGKGGALPTVFAAL 344

Query: 342 IPVILTI 348
           IP  L I
Sbjct: 345 IPDTLGI 351


>gi|269797613|ref|YP_003311513.1| permease YjgP/YjgQ family protein [Veillonella parvula DSM 2008]
 gi|269094242|gb|ACZ24233.1| permease YjgP/YjgQ family protein [Veillonella parvula DSM 2008]
          Length = 363

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 126/307 (41%), Gaps = 30/307 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+    P   L+ +++ F  L+ TSE+V+ RA G+S  +L  P  + ++++ I  V 
Sbjct: 58  LPSIVILTFPMSVLLASLMTFSRLSSTSEIVVMRAGGLSFLRLAMPVYIIALIISIGAVA 117

Query: 119 VINPIATSGEKIGIDLI-QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +      +   ++ +Q   N   Q  + I    ++  +    + AK    E     
Sbjct: 118 FNEFVVPRTNHMYQTIVREQIMKNASPQTQNHIVLKTMNGDELGTLMYAKSYDAETKQLS 177

Query: 178 DFTSITIDKKNKIIHRKDADLA------------IIYNDKV--KLKKVVEYQYGRIPIDK 223
             T     +  K+   ++AD A            IIY+      +++ ++++   +PI  
Sbjct: 178 MITVQQFGEGGKLQQVENADTAIWNGQYWVMQNGIIYDLSAGNGVERTMKFKEQSLPIK- 236

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK--KMSFSNKSNIFHNYRAETQFYFLIVIP 281
                + P  +   Q+  E+   +     I+  K +++N + +      E + Y    IP
Sbjct: 237 -----SAPKDIQQDQRKPEELTIKELRHQIRAYKAAYTNANKL------EMEMYQRFTIP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+ A + L+  RS+         +   F+ Y ++T   + GK G L  + AAL
Sbjct: 286 LASFVFALVGAPLGLQKQRSSSSIGFGISILII-FIYYGVMTFAGALGKGGALPTLLAAL 344

Query: 342 IPVILTI 348
           IP  L I
Sbjct: 345 IPDTLGI 351


>gi|307129164|ref|YP_003881180.1| hypothetical protein Dda3937_01300 [Dickeya dadantii 3937]
 gi|306526693|gb|ADM96623.1| conserved inner membrane protein [Dickeya dadantii 3937]
          Length = 356

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 78/363 (21%), Positives = 145/363 (39%), Gaps = 17/363 (4%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           +L RY  K    T +  L   + L  +I   +   ++G+   YS+    +     VP  I
Sbjct: 4   VLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLRKVGQ-GGYSVMGAGLYTLLSVPKDI 62

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ +   +
Sbjct: 63  EIFFPMAALLGALLGLGTLATRSELVVMQASGFTRLQIAAAVMKTAIPLVLLTMAIGEWM 122

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           A +GE++  +   Q    G    +    W +  N     F+  +++  EN +        
Sbjct: 123 APAGEQMARNYRSQMMYGGSMLSTQGGLWAKDGND----FVYIQRVAGENEL-AGVNIYH 177

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-------GRIPIDKNSTTLNIPIKMDG 236
            DK++K++  + A  A+  N   KL +V E          G   +     T   P K+  
Sbjct: 178 FDKQSKLLSIRYAASALYENGTWKLSQVEESDLRDSKQIGGSQTVSGEWKTNLTPDKLGV 237

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
                +  + R  ++ I  +  S +       R +   +  +  PL +  M L+A S   
Sbjct: 238 VALDPDALSIRGLFDYINYLHQSGQ----EASRYQLNMWSKLFAPLSVAVMMLMALSFIF 293

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
              RS    + +  GI  GF+ Y +  I         + PV  A +P  L + +SI++LL
Sbjct: 294 GPLRSVPAGVRIVIGISFGFLFYVLDQIFGPLSLVYHIPPVLGASLPSALFLFISIMLLL 353

Query: 357 QKE 359
           ++ 
Sbjct: 354 KRR 356


>gi|294102483|ref|YP_003554341.1| permease YjgP/YjgQ family protein [Aminobacterium colombiense DSM
           12261]
 gi|293617463|gb|ADE57617.1| permease YjgP/YjgQ family protein [Aminobacterium colombiense DSM
           12261]
          Length = 365

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 165/368 (44%), Gaps = 45/368 (12%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELP-NYSISRGAVLAA--TRV 59
           GIL R+ +K    +   F+ G M    V    ++  Q+  +     IS G VL      +
Sbjct: 5   GILDRFIWKEMAGS---FVFGVMAFTMVFVAGDLLFQIASMIIEKGISIGVVLRLFIYSL 61

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P +I   +P   L+  ++ F  L+  SE+V  +A GIS  ++L P +VGS+L+G+ + L+
Sbjct: 62  PEVIILTLPMACLLSALLTFGKLSTNSEIVALKASGISFQRILKPVIVGSLLVGL-SALI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPE----- 172
           +N           + + +++   +K     + +     SN Q +  I  +K+ P      
Sbjct: 121 LNETVVPFSNRAAENLMRFEVMREKPSVLKEQVFLRDESNGQLNRVIYIEKLQPRKGTMT 180

Query: 173 NHIWEDFTS-----ITIDKKNKIIHRK----DADLAIIYN-DKVKLKKVVEYQYGRIPID 222
           N + ++F       IT+ K       K    D ++  + N  KV+L     +++ R   D
Sbjct: 181 NVLVQEFEKGKLKRITVGKTGLWKDGKWWIDDGEVFQVTNGGKVELL----FRFERQQFD 236

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSF--SNKSNIFHNYRAETQFYFLIVI 280
            N +   +       ++ S + +  S  E++ ++    +   N+   +     F+    +
Sbjct: 237 LNLSPQQV-------EQASRKPSEMSALELMAQIRLLQAQGGNLAPLW---VLFHLRFAV 286

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYG--IFSGFMLYTIITIMKSFGKSGILLPVA 338
           P   V + ++ AS+ +   RS++    V +G  +   F+ Y ++++ K+FG++  + P+ 
Sbjct: 287 PWASVVLAILGASLGV---RSHRTGSGVGFGLSVMIVFVYYVVMSLCKAFGETEHMPPLL 343

Query: 339 AALIPVIL 346
           AA +P +L
Sbjct: 344 AAWVPNVL 351


>gi|301060831|ref|ZP_07201645.1| permease, YjgP/YjgQ family [delta proteobacterium NaphS2]
 gi|300445080|gb|EFK09031.1| permease, YjgP/YjgQ family [delta proteobacterium NaphS2]
          Length = 383

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 82/382 (21%), Positives = 165/382 (43%), Gaps = 51/382 (13%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATR------ 58
           L+RY F+    T   FL    + +F++    +  +M  +    ++RG  L+         
Sbjct: 3   LYRYIFREIWPT---FLASLFVFIFIM----MAARMLSITELIVTRGVHLSQVAGMVLFL 55

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+   +P +TL+  +V F  L+  SE++  ++ GIS++Q+L P +  S+   +  V 
Sbjct: 56  IPDILTFALPAVTLMSVVVAFLRLSADSEIIAMKSSGISLYQMLPPVIFFSLAACLACVA 115

Query: 119 VINPIATSGEKIGIDLI----QQWKDNGDKQKSDIIPWMQI-------SNPQQ---DIFI 164
           +    A  G +   DL+    +   D G K++    P+  +       S  ++   D+F+
Sbjct: 116 ISTFAAPWGNRSFKDLLFKIAETKADLGIKERIFCEPFENLVFYVNSFSREERMLKDVFV 175

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN 224
             ++        ++ T+  +  + +II R       +   K  +  V +   G   I  N
Sbjct: 176 VDRRD-------QEMTNTIVSDEAQIIPRPAERTITLLFLKGTIFMVEKNFEGSRTIKFN 228

Query: 225 STTLNIPIKMDGFQKFSEQFASR-------SFYEIIKKMSFSNKSNIFHNYRAETQFYFL 277
           +  LNI     G +      ASR       S  ++I K+  +  ++  ++ R   +    
Sbjct: 229 TYALNI-----GLKDVLADLASRKKAPHELSVNQLISKLKSTPNTDKEYS-RIMRELLEK 282

Query: 278 IVIPLMLVAMTLIAASVSLEF-SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLP 336
           + IPL +  M +I   +  +   R     + V+  +F+  + Y  + I++S   +G L P
Sbjct: 283 LSIPLAVFFMGIIGVPLGAQIRGRGRSAGVGVSLVVFA--LYYLFLMIIRSIASTGALSP 340

Query: 337 VAAALIPVILTISLSILILLQK 358
             A  IP +  I +S++ LL++
Sbjct: 341 AFAVWIPDLFLI-VSVVYLLRR 361


>gi|332307891|ref|YP_004435742.1| permease YjgP/YjgQ family protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175220|gb|AEE24474.1| permease YjgP/YjgQ family protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 353

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 79/358 (22%), Positives = 150/358 (41%), Gaps = 23/358 (6%)

Query: 8   YFFKYYLKTTLYFLLGAMI-LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           ++    L +T    LG ++ L  +I   E    +G   +Y ++  AV     +P  ++Q 
Sbjct: 7   WYIARTLLSTTAMSLGVLVGLSALIKFIEQMKSVGR-GSYDMTVAAVYVFLSLPRELEQF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P  TL+  ++    L   SELV+ ++ G S W ++   +  +IL+ +F +++   +A  
Sbjct: 66  FPMATLIGGLIGMGILASNSELVVMQSAGQSRWNIIISAMKSAILMVLFVMVIGEWVAPI 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E    ++  Q    G    SD + W +      D F+   +++ +N++  D +    D 
Sbjct: 126 SETKAKEIRTQAISGGSLFSSDRLVWAK----DGDNFVSIGEVVDKNNL-RDVSIYEFD- 179

Query: 187 KNKIIHRK--DADLAIIYNDKVKLKKV--VEYQYGRIPIDKN-----STTLNIPIKMDGF 237
            N +  RK   A+ A   +D  +L  V   E+   RI ++       S++L  P K+   
Sbjct: 180 -NDLYLRKITTAEAANYQSDSWELSHVQSTEFSDNRIHVEDAADGAWSSSLT-PDKLGVV 237

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
               E  + R   + +  +   N S     YR     +  ++ P+ +  M L+A S    
Sbjct: 238 TVKPEALSIRGLIDYVNYL--ENNSQNSERYR--LALWRKVLQPISVGVMLLMALSFIFG 293

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
             RS      V  G+ +GF  +    +  S      + P   A++P I+   +SI +L
Sbjct: 294 PLRSVTMGARVIMGVLTGFGFFVSNEVFGSLSTVYHIPPFIGAILPSIVFTGISIHLL 351


>gi|330962174|gb|EGH62434.1| hypothetical protein PMA4326_26817 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 353

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 82/369 (22%), Positives = 151/369 (40%), Gaps = 49/369 (13%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y++           P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLPDALSYVMMTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLV---IN 121
              L+  ++   +L  +SEL I RA G+SI    W ++ P     +LL I  VLV   + 
Sbjct: 66  MAALIGCLIGLGSLASSSELTIMRAAGVSIGRIVWAVMKPM----LLLMIAGVLVGEYVA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q     GD Q +    W +    Q + FI    + P N +    T 
Sbjct: 122 PYAENKAQAARSLAQ---GLGDAQSAKHGLWHR----QGEEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              D +  ++    A  A    D  +LK V    +     D  +  +N P      +++ 
Sbjct: 174 YRFDDQRHMLTSSFAKEAHFKTDYWELKDVTTTHFN----DGRTEVINTPD-----ERWD 224

Query: 242 EQFASRSFYEII---KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLI 290
              + +    +I   + +S S   +  H        N R    F+  ++ P + VA+ L+
Sbjct: 225 VSLSPQLLSTVIMPPESLSISGLWSYAHYLADQGLSNGRYWLAFWTKVLQPAVTVALVLM 284

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFML-YTIITIMKSFGKSGILL---PVAAALIPVIL 346
           A S      RS    + +   +F+G ++ +T   I    G S +L    P+ A L+P  +
Sbjct: 285 AISFIFGPLRS----VTLGQRVFTGVVVGFTFRIIQDLLGPSSLLFGFPPLLAVLLPAGV 340

Query: 347 TISLSILIL 355
                +L+L
Sbjct: 341 CALAGVLLL 349


>gi|301059203|ref|ZP_07200141.1| permease, YjgP/YjgQ family [delta proteobacterium NaphS2]
 gi|300446693|gb|EFK10520.1| permease, YjgP/YjgQ family [delta proteobacterium NaphS2]
          Length = 358

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 149/361 (41%), Gaps = 49/361 (13%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPL 61
           +L RY  K + K  +   L  + L  +ID     + + +       +  ++A  A ++P 
Sbjct: 3   VLTRYLLKEFFKLLIVCQLVFIALYLMIDF---ASGIDDFIKAGAPKSVMIAYFAFKIPA 59

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI---FTVL 118
           I  Q++P   L   I++F  + R +E+V  +A G++ WQ+  P V+ +  L +   F   
Sbjct: 60  IAGQMLPPAVLTTVIILFSLMKRNNEVVALKASGVNTWQVAQPLVLLAAFLSVVLFFFSE 119

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
            I P A+S     I  I+  K++  +       W +  N    I    K+      +  D
Sbjct: 120 TIVPYASSRCN-EIWRIEVKKEHPGRFHGQNHVWYKGKNCIYFI----KQFDSRKMMMVD 174

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVV-------------EYQYGRIPIDKNS 225
            T    D K KI  R D   AI   +  +++  +             ++ +  + +D+N 
Sbjct: 175 PTFYFFDDKFKIARRIDGRRAIWKENGWQVQNGIVQNREKDGGYDLQKFDHLEVKLDENP 234

Query: 226 TTL---NIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL---IV 279
                 N+  +  G+++  ++FA R   E                Y A   F  L   I 
Sbjct: 235 KDFIRENVEPEEMGYRQL-KRFAQRLKLE---------------GYDANRYFVELNIKIA 278

Query: 280 IPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
            P +++ MTL+   ++L       P + V+ GI   F+   I+ + ++ G +GIL P+ +
Sbjct: 279 FPFIVLIMTLMGIPIALWKKGMGTP-VAVSIGIALCFVYLLILGLARTLGFAGILPPLFS 337

Query: 340 A 340
           A
Sbjct: 338 A 338


>gi|66044344|ref|YP_234185.1| permease YjgP/YjgQ [Pseudomonas syringae pv. syringae B728a]
 gi|63255051|gb|AAY36147.1| permease YjgP/YjgQ [Pseudomonas syringae pv. syringae B728a]
 gi|330969233|gb|EGH69299.1| permease YjgP/YjgQ [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 353

 Score = 46.6 bits (109), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 96/229 (41%), Gaps = 19/229 (8%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLVINPIA 124
              L+  ++    L  +SEL I RA G+SI    W ++ P +V  ++ G+     + P A
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLV-LMIAGVLVGEYVAPYA 124

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
            +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T    
Sbjct: 125 ENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTRYRF 176

Query: 185 DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
           D +  +     A  A    D  +LK V    +     D  +  +N P++
Sbjct: 177 DDQRHMQTSSFAKEANFKTDYWELKDVTTTHFN----DGRTEVINTPVE 221


>gi|74316600|ref|YP_314340.1| hypothetical protein Tbd_0582 [Thiobacillus denitrificans ATCC
           25259]
 gi|74056095|gb|AAZ96535.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 356

 Score = 46.2 bits (108), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 60/317 (18%), Positives = 126/317 (39%), Gaps = 38/317 (11%)

Query: 35  EIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRA 93
           ++  ++G L   Y   +  ++    VP  + +I+P   L+  +     L   SE  + R 
Sbjct: 31  DVVQELGNLRAGYGFGQATIVVLLNVPGHLYEILPVAALIGTLFALARLVGNSEYAVMRV 90

Query: 94  IGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWM 153
            G+S W++   F       G+  V +   +   GE      +  W D    Q+  +    
Sbjct: 91  SGLSNWRVAAYF-------GVIGVWLALLVLLLGE-----YVAPWSDQA-AQRYKLSATR 137

Query: 154 QISNPQ---------QDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYND 204
            +   Q            FI  ++++P+N +         D++ ++   + A++A    D
Sbjct: 138 SVVAQQFRSGLWVKDGSTFINVREVMPDNTL-RGIEIYGFDQEGRLDWIRAAEIATWRGD 196

Query: 205 KV-KLKKVVEYQYGRIPIDKNST------TLNIPIKMDGFQKFSEQFASRSFYEIIKKMS 257
           K  +L+ VVE ++    I    +      ++  P  +       E+ ++R+ +  I  + 
Sbjct: 197 KTWQLQTVVETRFSADGIRAQRSANLAWRSVLTPEILSVLLVAPEKMSARALWRYIAHL- 255

Query: 258 FSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFM 317
              K+N     R E   +   + P ++  M LIA   +++  R+    + V +GI +G  
Sbjct: 256 ---KANGQKASRYELALWSKFISPFVIPIMMLIAMPFAIQSPRARGTSVKVFFGILAGLG 312

Query: 318 LYTIITIMKSFGKSGIL 334
            + +  +   FG  G+L
Sbjct: 313 FHLLSRL---FGHLGLL 326


>gi|293610040|ref|ZP_06692341.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827272|gb|EFF85636.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124205|gb|ADY83728.1| hypothetical protein BDGL_003142 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 356

 Score = 46.2 bits (108), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 60/108 (55%), Gaps = 2/108 (1%)

Query: 11  KYYLKTTLYFLLGAMILVFVID-LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           KY  KTT   + G  +++ ++  L     ++GEL P+Y+  +  V      P  + +I+P
Sbjct: 9   KYVTKTTALAMFGTTVVLSILQVLFTYLGELGELKPDYNAWQALVYVLWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
              L+  ++   +L  +SEL++ R++G+S+W+++   +  ++LL I +
Sbjct: 69  ISALIGAVIGLGSLATSSELIVMRSVGVSLWRIVGWVMRSALLLIILS 116


>gi|166367866|ref|YP_001660139.1| hypothetical protein MAE_51250 [Microcystis aeruginosa NIES-843]
 gi|166090239|dbj|BAG04947.1| hypothetical protein MAE_51250 [Microcystis aeruginosa NIES-843]
          Length = 389

 Score = 46.2 bits (108), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 145/328 (44%), Gaps = 39/328 (11%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P  I    P   L+  ++ +  L   SEL+  ++IGIS+++L+ P +V S+++   T 
Sbjct: 72  KMPEFIVLAFPMSILLAALMAYSRLASDSELIALKSIGISVYRLIIPAIVLSLIVTGLTY 131

Query: 118 LVINPIATSGE-KIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKIL-----P 171
           +  + +A +   +    + +  + N      D I + +    +Q      + +L      
Sbjct: 132 VFNDYVAPAASYEANATMTKALRPNRKSFIEDNIIYPEYGKVRQPDGGEPQTVLRRLFYA 191

Query: 172 ENHIWEDFTSITIDKK-----NKIIHRKDADLAI------IYNDKVKL-------KKVVE 213
           E    ++   +TI  +     N+II  + A   I       YN  + L       + +V 
Sbjct: 192 ERFNGQEMLGLTILDRTQPEVNQIITSESASWNIEKNIWDFYNGTIYLIDPKGSYRNIVR 251

Query: 214 YQYGRIPIDKNSTTLNIPIKM-DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAET 272
           +Q+ ++ + +  T L++  +  DG +    Q  +R + EI++     N + I    + + 
Sbjct: 252 FQHQQLALPR--TPLDLAFRARDGSEMTLRQ--AREYLEILQLSG--NPTKI---RKLQV 302

Query: 273 QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKSFGK 330
           Q    I +P + +   +I A++ L    SN+     ++GI     F  Y +  +  S G 
Sbjct: 303 QIEQKISLPFVCLVFGMIGAALGLRPQNSNKA---TSFGICIVLIFSYYLLSFVTSSLGI 359

Query: 331 SGILLPVAAALIPVILTISLSILILLQK 358
            G+L P+ AA +P IL ++   ++LLQ 
Sbjct: 360 GGVLTPLMAAWLPNILGLTAGGILLLQS 387


>gi|297569344|ref|YP_003690688.1| permease YjgP/YjgQ family protein [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925259|gb|ADH86069.1| permease YjgP/YjgQ family protein [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 361

 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 66/364 (18%), Positives = 149/364 (40%), Gaps = 21/364 (5%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY F  + +     L G + +  +ID  E  +   +     I         ++PLI +Q+
Sbjct: 7   RYLFWQFTRNLALVLGGLVAIYLLIDFFERVDSFLD-AGLGIGTAITYLLLKIPLIFEQL 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV----LVINP 122
           IP   L+  I+    LNR +EL+  ++ G+S+ +++ P ++ ++      +     ++ P
Sbjct: 66  IPVCLLLAGIITLGVLNRHNELMALKSGGLSVRRIIRPLLLAALFFSGLALAAGQWLLPP 125

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
                 ++  + ++Q    G ++   I          + I+  A+   P + +  DF+  
Sbjct: 126 TLAETNRLWYEEVRQQTPEGIERNGRI-----YYRGAKGIYSFAQPDDPASGL-PDFSFT 179

Query: 183 TIDKKNKI-------IHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
             +++ ++       I   +A    + + ++K+    + QY R  I  N  T+ +P + +
Sbjct: 180 AWNEEYQLARLLTAAIAHWEAGRWTLLDGQLKV-LTADDQY-RTTI-FNEMTIELPERPE 236

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
            F       A R   E++ +      S   +  R E Q     +   + + +  I   ++
Sbjct: 237 DFFLPPYALAERPLSELLARALAPEDSPRRYEARLELQQKISYIFLGLPLLLVGIPLLLA 296

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +   R     + V       F ++ + +I ++   +G L P  AA +  +L  SL    +
Sbjct: 297 MHRGRGRDLALAVPASCIMAFAVWGLWSICQALASAGHLSPALAAWLVHLLAGSLGFYFI 356

Query: 356 LQKE 359
           L+++
Sbjct: 357 LRQD 360


>gi|281357796|ref|ZP_06244282.1| permease YjgP/YjgQ family protein [Victivallis vadensis ATCC
           BAA-548]
 gi|281315743|gb|EFA99770.1| permease YjgP/YjgQ family protein [Victivallis vadensis ATCC
           BAA-548]
          Length = 371

 Score = 45.8 bits (107), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 79/172 (45%), Gaps = 35/172 (20%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFV------------ 106
           +P+I+   +P+  +V  ++VF  L+  SE+   RA G+SI Q+++P +            
Sbjct: 56  LPIILTFTVPWAVMVAVMLVFGRLSADSEITAMRACGVSILQIVSPILIITFFLMLFCLY 115

Query: 107 ----VGSILLG-----IFTVLVINPIA--TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQI 155
               VG  LLG     + T  +  P+A    G++I  +    + D  DK+  D I  +QI
Sbjct: 116 LQVEVGPPLLGKSRTLMQTAAINQPLAIFEPGKQIEFENTIIYID--DKEGEDGIKGVQI 173

Query: 156 ---SNPQ---QDIFIGAKKILPENH----IWEDFTSITIDKKNKIIHRKDAD 197
              S+PQ   QDI     K+L +      I   F  + +DKK     ++D D
Sbjct: 174 YTLSDPQTVAQDISAERGKLLVDKEKQLLIVRLFDCLVVDKKGAAEQQQDGD 225


>gi|86608831|ref|YP_477593.1| YjgP/YjgQ family protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557373|gb|ABD02330.1| putative membrane protein, YjgP/YjgQ family [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 370

 Score = 45.8 bits (107), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 71/353 (20%), Positives = 145/353 (41%), Gaps = 28/353 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQM--GELPNYSISRGAVLAATRVPL 61
           +L RY F   L   L  + G  +L+ V  L  +  ++  G +P  ++ R  VL    +P 
Sbjct: 10  LLERYLFGEMLTPVLAGVAGGTLLLLVGRLFTLAERLVEGSVPPLTVLRLLVL---DLPE 66

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
           ++   +P       ++    L+  SE+   RA GI   ++  P ++  + + +    + N
Sbjct: 67  MVVLGMPIAAFFATMLTLGKLSGNSEITAMRAAGIPFSRIFRPLLLVGLAMSLSAFFISN 126

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
            +     K  I  I Q       Q +  + +      + +++   +++ P  +  +D T 
Sbjct: 127 -VLLPASKQQIRQIDQ--QALLAQATTPVQYDVFFKTEDNLWFFIRQVDPRLNTMQDVTI 183

Query: 182 ITIDK----KNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT-----LNIPI 232
           + +D     K +++    A  A+    +  L +   + YG   +     T     L +  
Sbjct: 184 LRVDPLPGGKYQLVEVTLAAQAVWNGLEWSLSEGATHLYGPTGLSIAEQTFHRKPLQVSQ 243

Query: 233 KMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRA-ETQFYFLIVIPLMLVAMTLIA 291
            +    +     +  S  E+ +++S   +SN+  N +A  T+F+    +PL     +  A
Sbjct: 244 DLAALMQPPVPPSELSLPELAERISRLARSNL--NTQALRTEFHMRFSLPLA----SFFA 297

Query: 292 ASVSLEFSRSNQPRII----VAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
             +SL    +   R+     V +GI   F  Y ++++ +S G+ G L P AAA
Sbjct: 298 VLISLPLGSTTARRVGRYGGVVFGILLVFGYYVVLSVSRSLGEVGALPPWAAA 350


>gi|220932597|ref|YP_002509505.1| permease YjgP/YjgQ family protein [Halothermothrix orenii H 168]
 gi|219993907|gb|ACL70510.1| permease YjgP/YjgQ family protein [Halothermothrix orenii H 168]
          Length = 1040

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 135/310 (43%), Gaps = 17/310 (5%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P II Q  P   L   +     LNR +E    R  GIS+++L+ P ++  I++   T 
Sbjct: 62  QLPEIIVQTFPIAILFATMSGMGRLNRENEFTALRMGGISLYRLILPLLILGIVISGMTY 121

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           L+   I    +    ++I+  K    +   DI   +    P   +F    +   E++I +
Sbjct: 122 LLNEEIVPWTKHRAQNIIR--KSVLKEVPPDIKENVFFKGPDGRLFY-VGRFDKEDNIMK 178

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY---GRIPIDKNSTTLNIPIKM 234
                T    N       A+L  +Y +K  LKK   ++Y   G + ++     + I I  
Sbjct: 179 KIVVYTFKGDNGYPLIVTANLGEVYKEKWVLKKGFIHRYNGEGHLTMETRFDVMEIKINT 238

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQ-----FYFLIVIPLMLVAMTL 289
           +    F++Q       + + +     + ++F N   +       ++  + +PL  +   L
Sbjct: 239 EVHNFFADQKTP----DEMSREELKKEIDLFQNSGIDVHSLLVDYHLKLSMPLAALIFIL 294

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           I   +SL    S    II  + I   F+ Y ++++ +SFG++G L PV AA +P I+   
Sbjct: 295 IGTPLSLTSKDSRSFSII--FTIVVVFLYYFVMSLSRSFGRNGRLDPVLAAWLPNIIFSI 352

Query: 350 LSILILLQKE 359
           + I +L+ +E
Sbjct: 353 IGITLLIWRE 362


>gi|154707760|ref|YP_001424260.1| hypothetical membrane spanning protein [Coxiella burnetii Dugway
           5J108-111]
 gi|154357046|gb|ABS78508.1| hypothetical membrane spanning protein [Coxiella burnetii Dugway
           5J108-111]
          Length = 355

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 82/359 (22%), Positives = 142/359 (39%), Gaps = 52/359 (14%)

Query: 21  LLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVF 79
           LLG  M + F+  L++I      L +Y + +  +   T++P  + Q+ P    +  ++  
Sbjct: 23  LLGIEMFMEFIGQLSQI-----GLVHYGLGQAFLYVLTQLPSDLYQLFPMAGFLGCLIGL 77

Query: 80  FNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI---FTVLVINP-IATSGEKIGIDLI 135
             L  +SEL++ R  G+SI  +    V  ++L+ +   F   VI P I  SGE+  +  +
Sbjct: 78  GRLASSSELMVMRTAGVSIAGVTWAVVKAALLMMVAMTFIGEVIAPQIEASGEETKLTAL 137

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKI----- 190
              K  G K   D+  W+     Q  I IG                 ++D KNKI     
Sbjct: 138 S--KAVGYKALGDV--WLH--GAQSFIHIG-----------------SVDAKNKISEVSQ 174

Query: 191 --IHRKDADLAIIYNDKVKLKKV--VEYQYGRIPIDKNSTT--------LNIPIKMDGFQ 238
             I+ K   L+ +Y  K +  K   + Y   +     N TT        L I    D  Q
Sbjct: 175 FFINNKHQLLSAVYAPKGEYVKGHWILYNVKQTQFTPNRTTEKKIAKFPLTIVFNPDHLQ 234

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +  +    +S   +   + +  ++ +    R    F+   + PL  V M  +        
Sbjct: 235 QGRKMVDRQSIVGLYHTIRYRQQAGL-QTSRYVFAFWQRFIQPLTTVVMICLGVPFIFGS 293

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
            R     + +  GI  GF  Y +      F     + P+ AAL+P +L  ++  +ILL+
Sbjct: 294 LRQASMGLRILTGIVIGFAFYMLNQFFGPFAMVYQIPPIFAALMPTVL-FAVGCVILLR 351


>gi|260551089|ref|ZP_05825293.1| permease YjgP/YjgQ family protein [Acinetobacter sp. RUH2624]
 gi|260405856|gb|EEW99344.1| permease YjgP/YjgQ family protein [Acinetobacter sp. RUH2624]
          Length = 356

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 56/104 (53%), Gaps = 2/104 (1%)

Query: 11  KYYLKTTLYFLLGAMILVFVID-LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           KY  KTT   + G  I++ V+  L     ++GEL P+Y+  +  +      P  + +I+P
Sbjct: 9   KYVTKTTALAMFGTTIVLSVLQVLFTYLGELGELKPDYNAWQAFIYVLWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
              L+  ++    L   SEL++ R++GIS+W+++   +  ++LL
Sbjct: 69  ISALIGAVIGLGALASNSELIVMRSVGISLWRIVGWVMRSALLL 112


>gi|262373935|ref|ZP_06067212.1| permease YjgP/YjgQ family protein [Acinetobacter junii SH205]
 gi|262310946|gb|EEY92033.1| permease YjgP/YjgQ family protein [Acinetobacter junii SH205]
          Length = 356

 Score = 45.4 bits (106), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 58/104 (55%), Gaps = 2/104 (1%)

Query: 11  KYYLKTTLYFLLGA-MILVFVIDLNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           K+  KTT+  +LG  ++L F+  L     ++G L PNY+  +  +      P  + +I+P
Sbjct: 9   KHVTKTTVLAMLGTTLVLSFLQVLFTYLGELGSLKPNYNAWQAFLYVMWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
              L+ +++    L   SEL++ R++GIS+W+++   +  ++LL
Sbjct: 69  VAALIGSVLGLGALASNSELIVMRSVGISLWRIVGWVMRSALLL 112


>gi|332299879|ref|YP_004441800.1| permease YjgP/YjgQ family protein [Porphyromonas asaccharolytica
           DSM 20707]
 gi|332176942|gb|AEE12632.1| permease YjgP/YjgQ family protein [Porphyromonas asaccharolytica
           DSM 20707]
          Length = 361

 Score = 45.4 bits (106), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 75/359 (20%), Positives = 155/359 (43%), Gaps = 25/359 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL---AATRVPLII 63
           RY F  +L T  YF    +IL   I   ++  ++ +L    +   A++    A  VP   
Sbjct: 11  RYIFTQFLAT--YFFSIVLILAVAIAF-DVTEKLDKLLQPEVPLRAIIWDYYANFVPYYA 67

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
               P    +  I V   L   SE++   + G+S  +LL P+++G+ ++ I T L+ + +
Sbjct: 68  NLFSPLFVFIAVIYVTSRLAENSEIIAILSCGVSFRRLLKPYMLGAAVIAILTFLLSSFV 127

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
              G +I ID   ++  +     ++ I  MQ++ P+  +F+       E+ +   F+   
Sbjct: 128 IPPGNRIRIDFQNRYIKDKRITYANAIQ-MQVA-PETFMFMSYYN--DESKVGYTFSMDR 183

Query: 184 IDKKNKIIHRKDADLAIIYN--DKVKLKKVVEYQYGRIP---IDKNSTTLNIPIKMDGF- 237
            + K+ +  R  A+ +I+Y+     +L+      +G      +  N     IPI    F 
Sbjct: 184 FEGKD-LKSRMMAN-SIVYDTLHNWQLQDYTITYFGERQDSLLRGNQLDTIIPITPKDFL 241

Query: 238 --QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +   E  ++   Y  I++      +   +      +   + +IP   + +TL+  S+S
Sbjct: 242 VTEGDVEMLSTPQLYRSIQQQRMRGAATQLYAIELHKR---IAMIPASFI-LTLMGVSLS 297

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
               R     + +A G+   F+    +T+  SF  +G + P+ AA +P ++ + +S ++
Sbjct: 298 AR-KRKGGMGLALAVGLSLSFLYILFMTVTSSFAVTGAMSPMVAAWLPNLVYLGISFVL 355


>gi|169634641|ref|YP_001708377.1| hypothetical protein ABSDF3306 [Acinetobacter baumannii SDF]
 gi|169153433|emb|CAP02575.1| conserved hypothetical protein; putative membrane protein
           [Acinetobacter baumannii]
          Length = 356

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 56/104 (53%), Gaps = 2/104 (1%)

Query: 11  KYYLKTTLYFLLGAMILVFVID-LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           KY  KTT   + G  I++ V+  L     ++GEL P+Y+  +  +      P  + +I+P
Sbjct: 9   KYVTKTTALAMFGTTIVLSVLQILFTYLGELGELKPDYNAWQAFIYVLWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
              L+  ++    L   SEL++ R++GIS+W+++   +  ++LL
Sbjct: 69  ISALIGAVIGLGALASNSELIVMRSVGISLWRIVGWVMRSALLL 112


>gi|169797502|ref|YP_001715295.1| hypothetical protein ABAYE3538 [Acinetobacter baumannii AYE]
 gi|184156574|ref|YP_001844913.1| permease [Acinetobacter baumannii ACICU]
 gi|213155684|ref|YP_002317729.1| permease YjgP/YjgQ family protein [Acinetobacter baumannii AB0057]
 gi|215484938|ref|YP_002327177.1| hypothetical protein ABBFA_003301 [Acinetobacter baumannii
           AB307-0294]
 gi|239502070|ref|ZP_04661380.1| hypothetical protein AbauAB_07127 [Acinetobacter baumannii AB900]
 gi|260556394|ref|ZP_05828613.1| permease YjgP/YjgQ family protein [Acinetobacter baumannii ATCC
           19606]
 gi|301346543|ref|ZP_07227284.1| hypothetical protein AbauAB0_09866 [Acinetobacter baumannii AB056]
 gi|301512955|ref|ZP_07238192.1| hypothetical protein AbauAB05_15269 [Acinetobacter baumannii AB058]
 gi|301594833|ref|ZP_07239841.1| hypothetical protein AbauAB059_03452 [Acinetobacter baumannii
           AB059]
 gi|332851502|ref|ZP_08433499.1| permease, YjgP/YjgQ family [Acinetobacter baumannii 6013150]
 gi|332866798|ref|ZP_08437202.1| permease, YjgP/YjgQ family [Acinetobacter baumannii 6013113]
 gi|332874942|ref|ZP_08442793.1| permease, YjgP/YjgQ family [Acinetobacter baumannii 6014059]
 gi|169150429|emb|CAM88326.1| conserved hypothetical protein; putative membrane protein
           [Acinetobacter baumannii AYE]
 gi|183208168|gb|ACC55566.1| predicted permease [Acinetobacter baumannii ACICU]
 gi|193076100|gb|ABO10704.2| putative membrane protein [Acinetobacter baumannii ATCC 17978]
 gi|213054844|gb|ACJ39746.1| permease YjgP/YjgQ family protein [Acinetobacter baumannii AB0057]
 gi|213988459|gb|ACJ58758.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|260410449|gb|EEX03748.1| permease YjgP/YjgQ family protein [Acinetobacter baumannii ATCC
           19606]
 gi|322506461|gb|ADX01915.1| permease [Acinetobacter baumannii 1656-2]
 gi|323516340|gb|ADX90721.1| permease [Acinetobacter baumannii TCDC-AB0715]
 gi|332729955|gb|EGJ61286.1| permease, YjgP/YjgQ family [Acinetobacter baumannii 6013150]
 gi|332734406|gb|EGJ65526.1| permease, YjgP/YjgQ family [Acinetobacter baumannii 6013113]
 gi|332736885|gb|EGJ67861.1| permease, YjgP/YjgQ family [Acinetobacter baumannii 6014059]
          Length = 356

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 56/104 (53%), Gaps = 2/104 (1%)

Query: 11  KYYLKTTLYFLLGAMILVFVID-LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           KY  KTT   + G  I++ V+  L     ++GEL P+Y+  +  +      P  + +I+P
Sbjct: 9   KYVTKTTALAMFGTTIVLSVLQILFTYLGELGELKPDYNAWQAFIYVLWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
              L+  ++    L   SEL++ R++GIS+W+++   +  ++LL
Sbjct: 69  ISALIGAVIGLGALASNSELIVMRSVGISLWRIVGWVMRSALLL 112


>gi|254446878|ref|ZP_05060353.1| putative permease, YjgP/YjgQ family [Verrucomicrobiae bacterium
           DG1235]
 gi|198256303|gb|EDY80612.1| putative permease, YjgP/YjgQ family [Verrucomicrobiae bacterium
           DG1235]
          Length = 370

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 160/387 (41%), Gaps = 65/387 (16%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQ 64
           RY F  +LK     +L +M  + +  L EIQ+   +L +Y  + G +L   A   P  + 
Sbjct: 7   RYVFTEWLKA-FALVLSSMFGLLI--LFEIQDSFTDLVSYDATGGQILFYYAILAPSFLT 63

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL-GIFTVLVINPI 123
             +P   LV  +     L+R +E V  RA G+S++++     + S+L+ G    L  + I
Sbjct: 64  VTLPASILVSILYALGQLHRANEFVALRAAGMSVFRVTRSIWLASLLISGGLWYLNSSLI 123

Query: 124 ATSGEKIGIDLIQQWKDNG-----DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
             S E+    LI   + +      D  +  ++  +   N +            EN +W  
Sbjct: 124 PWSVEQSN-QLITTLRQDSEAKILDSDEIGVVEGLAFDNRR------------ENRMW-- 168

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
           F +   + K++        ++I+  ++ ++++V+  +YG    D    TL      DG +
Sbjct: 169 FINRYSEYKSQAFG---ISVSIMDEERREVRRVMA-RYGYFDEDLGYWTL-----FDGRE 219

Query: 239 KFSEQFASRS----------------------FYEIIKKMSFSNKSNIFHNYRAETQ--- 273
           + ++    R                       F +  K +SF     I  ++  E     
Sbjct: 220 RLNDPDTGRERWPPFERLDAKDLTDDPTLMLLFGKRPKDLSFFQLRRITDSFTQEDNPNV 279

Query: 274 -FYFLIVIPLML-VAMTLIAASVSLEFSRSN---QPRIIVAYGIFSGFMLYTIITIMKSF 328
             Y + +  LM   A  LI A +++ F+ S     P + V   I   F+ Y   +++ +F
Sbjct: 280 LAYEVRLQALMASAASCLIVAGIAIPFAVSGVRTNPAVGVTKSIGLFFVFYIFTSVLNAF 339

Query: 329 GKSGILLPVAAALIPVILTISLSILIL 355
           G+ G L P  AA IP++  I L+ +++
Sbjct: 340 GREGALSPEMAAWIPMVAMILLAYVLM 366


>gi|227824355|ref|ZP_03989187.1| permease [Acidaminococcus sp. D21]
 gi|226904854|gb|EEH90772.1| permease [Acidaminococcus sp. D21]
          Length = 362

 Score = 45.1 bits (105), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 61/319 (19%), Positives = 127/319 (39%), Gaps = 33/319 (10%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P +I    P   L+ +++    L+  SE+   R+ G+S  ++  P +    ++ +F+V+
Sbjct: 58  MPEVINYTFPMSMLLASLLTMGQLSGNSEITAMRSGGMSFRRIAMPILAAGFVVSLFSVV 117

Query: 119 ----VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
               V+ P     E+I   + Q+ K+N   +  D I    IS  Q      A+    +  
Sbjct: 118 WAEKVVPPAKAEYERI---IQQEIKNNTKPRTQDHILLKNISKGQLTRLTYARTFDEKAG 174

Query: 175 IWEDFTSITIDKKNKI-IHR-------------KDADLAIIYNDKVKLKKVVEYQYGRIP 220
           + +D T    DK   + I R             +   +  I N++  L + + +    +P
Sbjct: 175 VMKDITIEDWDKGRVVRIQRTPEAKWQNGTWIMEKGTITEITNEE-GLTRTMTFDKQVLP 233

Query: 221 IDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVI 280
           I +   T+ +  K        E    + +  I+++        +        + Y    +
Sbjct: 234 ITETPKTITLDQKDPDEMTIGEL---KMYIGILERQYQPTSKYVM-------EIYSRFTV 283

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           PL      LI   + ++  R+    + + + +   F+ Y+I+T M   G+ G++ P  AA
Sbjct: 284 PLASFFFALIGVPLGVQSQRAGT-SMGLGFSVVIIFIYYSIMTFMTGLGQGGVIPPFIAA 342

Query: 341 LIPVILTISLSILILLQKE 359
            +P  L       ++ QK+
Sbjct: 343 AVPNFLCGCAGAYLIWQKD 361


>gi|226951740|ref|ZP_03822204.1| permease YjgP/YjgQ-like protein [Acinetobacter sp. ATCC 27244]
 gi|294648982|ref|ZP_06726430.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837530|gb|EEH69913.1| permease YjgP/YjgQ-like protein [Acinetobacter sp. ATCC 27244]
 gi|292825117|gb|EFF83872.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 356

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 58/104 (55%), Gaps = 2/104 (1%)

Query: 11  KYYLKTTLYFLLGA-MILVFVIDLNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           K+  KTT+  +LG  ++L F+  L     ++G L PNY+  +  +      P  + +I+P
Sbjct: 9   KHVTKTTVLAMLGTTLVLSFLQVLFTYLGELGSLKPNYNAWQAFLYVLWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
              L+ +++    L   SEL++ R++GIS+W+++   +  ++LL
Sbjct: 69  VAALIGSVLGLGALASNSELIVMRSVGISLWRIVGWVMRSALLL 112


>gi|313887034|ref|ZP_07820734.1| permease, YjgP/YjgQ family [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923560|gb|EFR34369.1| permease, YjgP/YjgQ family [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 361

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 75/359 (20%), Positives = 154/359 (42%), Gaps = 25/359 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL---AATRVPLII 63
           RY F  +L T  YF    +IL   I   ++  ++ +L    +   A++    A  VP   
Sbjct: 11  RYIFTQFLAT--YFFSIVLILAVAIAF-DVTEKLDKLLQPEVPLRAIIWDYYANFVPYYA 67

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
               P    +  I V   L   SE++   + G+S  +LL P+++G+ ++ I T L+ + +
Sbjct: 68  NLFSPLFVFIAVIYVTSRLAENSEIIAILSCGVSFRRLLKPYMLGAAVIAILTFLLSSFV 127

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
              G +I ID   ++  +     ++ I  MQ++ P+  +F+       E+ +   F+   
Sbjct: 128 IPPGNRIRIDFQNRYIKDKRITYANAIQ-MQVA-PETFMFMSYYN--DESKVGYTFSMDR 183

Query: 184 IDKKNKIIHRKDADLAIIYN--DKVKLKKVVEYQYGRIP---IDKNSTTLNIPIKMDGF- 237
            + K+ +  R  A+ +I+Y+     +L+      +G      +  N     IPI    F 
Sbjct: 184 FEGKD-LKSRMMAN-SIVYDTLHNWQLQDYTITYFGERQDSLLRGNQLDTIIPITPKDFL 241

Query: 238 --QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +   E   +   Y  I++      +   +      +   + +IP   + +TL+  S+S
Sbjct: 242 VTEGDVEMLTTPQLYRSIQQQRMRGAATQLYAIELHKR---IAMIPASFI-LTLMGVSLS 297

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
               R     + +A G+   F+    +T+  SF  +G + P+ AA +P ++ + +S ++
Sbjct: 298 AR-KRKGGMGLALAVGLSLSFLYILFMTVTSSFAVTGAMSPMVAAWLPNLVYLGISFVL 355


>gi|299771879|ref|YP_003733905.1| hypothetical protein AOLE_18250 [Acinetobacter sp. DR1]
 gi|298701967|gb|ADI92532.1| hypothetical protein AOLE_18250 [Acinetobacter sp. DR1]
          Length = 356

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 59/108 (54%), Gaps = 2/108 (1%)

Query: 11  KYYLKTTLYFLLGAMILVFVID-LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           KY  KTT   + G  +++ ++  L     ++GEL P+Y+  +  +      P  + +I+P
Sbjct: 9   KYVTKTTALAMFGTTVVLSILQILFTYLGELGELKPDYNAWQALIYVLWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
              L+  ++   +L  +SEL++ R+ GIS+W+++   +  ++LL I +
Sbjct: 69  ISALIGAVIGLGSLATSSELIVMRSAGISLWRIVGWVMRSALLLIILS 116


>gi|326559486|gb|EGE09909.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis 7169]
 gi|326568201|gb|EGE18283.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis BC8]
          Length = 369

 Score = 45.1 bits (105), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 161/376 (42%), Gaps = 42/376 (11%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQI 66
           KY +++ L  + GA++ ++++ +  +   + EL N    Y+++   +    R P  + Q 
Sbjct: 8   KYVIRSALLAMAGAVVGLWLVQM--VFAYLAELDNISETYTLTDALLFILYRSPYFLVQF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISI-----WQLLNPFVVGSILLGI--FTVLV 119
           IP  TL+  ++    L   SEL++ RA G+SI     W +L   +  +I LG+  F +  
Sbjct: 66  IPTGTLLGAVIGLGLLANHSELIVMRAAGMSIYRIVSWAMLPAVIFVAISLGVNQFVLPT 125

Query: 120 INPIATS--GEKIGIDLIQ---QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
            N  A +   + I   LI     W  N D    D++    IS    +  +G  K     +
Sbjct: 126 ANQHAAAIRADTIYDKLITIDGYWSVNHDGDNQDVV---YISYADNEGGLGEVK----RY 178

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK----LKKVVEYQYGRIPIDKNSTT--- 227
             +D   I   K    ++   +D  ++   K +    L  + E   G   + +  +    
Sbjct: 179 QLKDGQLIAALKAKSGVYLPQSD-DVMNAQKARYTWQLSGIDEIGIGTSQVQQAHSEGKI 237

Query: 228 LNIPIKMDG---FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
           L +PI         K  E  +  S Y   + M+     ++ H    E  F+  ++ P  +
Sbjct: 238 LTLPIAPTDVYLLTKEPEDLSLSSLYAHRQLMAHQGTRSLRH----ELAFWQKLLSPFAV 293

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF-GKSGILLPVAAALIP 343
           +++ L+A+S      RS    + V   + +G +L++ +T +  F   +  L P+  AL+P
Sbjct: 294 LSLVLVASSFVFGSLRSQGLALRVVLALLTG-LLFSYLTDLTGFVALATGLSPLLMALVP 352

Query: 344 VILTISLSILILLQKE 359
           ++L+    + +L +K 
Sbjct: 353 IVLSAMAGMYLLNRKS 368


>gi|262280664|ref|ZP_06058447.1| permease YjgP/YjgQ family protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257564|gb|EEY76299.1| permease YjgP/YjgQ family protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 356

 Score = 45.1 bits (105), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 59/108 (54%), Gaps = 2/108 (1%)

Query: 11  KYYLKTTLYFLLGAMILVFVID-LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIP 68
           KY  KTT   + G  +++ ++  L     ++GEL P+Y+  +  +      P  + +I+P
Sbjct: 9   KYVTKTTALAMFGTTVVLSILQVLFTYLGELGELKPDYNAWQALIYVLWGAPRYLYEILP 68

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
              L+  ++   +L  +SEL++ R+ GIS+W+++   +  ++LL I +
Sbjct: 69  ISALIGAVIGLGSLATSSELIVMRSAGISLWRIVGWVMRSALLLIILS 116


>gi|326567797|gb|EGE17901.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis 12P80B1]
          Length = 369

 Score = 44.7 bits (104), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 161/376 (42%), Gaps = 42/376 (11%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQI 66
           KY +++ L  + GA++ ++++ +  +   + EL N    Y+++   +    R P  + Q 
Sbjct: 8   KYVIRSALLAMAGAVVGLWLVQM--VFAYLAELDNISETYTLTDALLFILYRSPYFLVQF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISI-----WQLLNPFVVGSILLGI--FTVLV 119
           IP  TL+  ++    L   SEL++ RA G+SI     W +L   +  +I LG+  F +  
Sbjct: 66  IPTGTLLGAVIGLGLLANHSELIVMRAAGMSIYRIVSWAMLPAVIFVAISLGVNQFVLPT 125

Query: 120 INPIATS--GEKIGIDLIQ---QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
            N  A +   + I   LI     W  N D    D++    IS    +  +G  K     +
Sbjct: 126 ANQHAATIRADTIYDKLITIDGYWSVNHDGDNQDVV---YISYADNEGGLGEVK----RY 178

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK----LKKVVEYQYGRIPIDKNSTT--- 227
             +D   I   K    ++   +D  ++   K +    L  + E   G   + +  +    
Sbjct: 179 QLKDGQLIAALKAKSGVYLPQSD-DVMNAQKARYTWQLSGIDEIGIGTSQVQQAHSEGKI 237

Query: 228 LNIPIKMDG---FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
           L +PI         K  E  +  S Y   + M+     ++ H    E  F+  ++ P  +
Sbjct: 238 LTLPIAPTDVYLLTKEPEDLSLSSLYAHRQLMAHQGTRSLRH----ELAFWQKLLSPFAV 293

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF-GKSGILLPVAAALIP 343
           +++ L+A+S      RS    + V   + +G +L++ +T +  F   +  L P+  AL+P
Sbjct: 294 LSLVLVASSFVFGSLRSQGLALRVVLALLTG-LLFSYLTDLTGFVALATGLSPLLMALVP 352

Query: 344 VILTISLSILILLQKE 359
           ++L+    + +L +K 
Sbjct: 353 IVLSAMAGMYLLNRKS 368


>gi|94266928|ref|ZP_01290581.1| permease YjgP/YjgQ [delta proteobacterium MLMS-1]
 gi|93452380|gb|EAT02999.1| permease YjgP/YjgQ [delta proteobacterium MLMS-1]
          Length = 359

 Score = 44.7 bits (104), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 70/139 (50%), Gaps = 10/139 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSI---LLGI 114
           ++PLII+Q++P   L+  I+    LNR  EL+  +A G+S  +++ P ++ +    LLG+
Sbjct: 56  KIPLIIEQLLPVALLLAGIITLGLLNRRHELMALQAAGLSTRRIIRPLLLAAFACTLLGM 115

Query: 115 FTV-LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
            +   ++ P  +   ++    ++Q ++ G +++  I         Q+ I+        EN
Sbjct: 116 ASSQWLLPPTMSELNRLWHQEVRQQENRGIERQGRI-----YYRGQEGIYSFRPAADSEN 170

Query: 174 HIWEDFTSITIDKKNKIIH 192
            +  DF+ +T D+  ++  
Sbjct: 171 RL-ADFSYLTWDRDYRLAQ 188


>gi|148265755|ref|YP_001232461.1| permease YjgP/YjgQ family protein [Geobacter uraniireducens Rf4]
 gi|146399255|gb|ABQ27888.1| permease YjgP/YjgQ family protein [Geobacter uraniireducens Rf4]
          Length = 359

 Score = 44.7 bits (104), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 134/349 (38%), Gaps = 24/349 (6%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVF-VIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
           I  RY    Y K  L   LGA I ++ V+D  E   +     N      A+   TRVP I
Sbjct: 3   IFSRYIATAYAKM-LGLCLGAFIAIYLVVDFLEKIGRFAR-ANAEWKFIALFFLTRVPEI 60

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV--- 119
           I Q      L+  ++    L+  SEL   R  G+S+ ++  P    +  + + T+ V   
Sbjct: 61  ICQTASMAVLMATLLTLGMLSLNSELTAMRGCGLSLARITAPIFAIAFAVSLSTLFVSEF 120

Query: 120 INP-IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           + P   T G+ I   LI +      K  S       I +  ++  + A+   P     + 
Sbjct: 121 VMPRCNTQGQYIREVLIDK------KSPSTFFRQQNIWHKDENYILKARLFDPATGNLKG 174

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVV--EYQYGRIPIDKNSTTLNIPIKMDG 236
            T      + +   R +A    +  +    + VV  E   G I   K+   L + + +  
Sbjct: 175 ITLWKTGTEMEPQQRIEATQGELRGNDWLFRDVVIREMAGGNIISTKSFPALLVKLNLKA 234

Query: 237 FQ-----KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
                  KFS+    R       K+    +   +   R   Q +  I +    V M  I 
Sbjct: 235 ADLKVVGKFSDNMGIRELISYCDKL----RKGGYDPTRFLAQMHSRISLSFAPVIMAFIG 290

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
              ++   RS+   + +   +  GF  + I +++ SFG++G+L P+ +A
Sbjct: 291 IPFAMRGGRSSGIALGIGTSLGIGFAYFIINSVILSFGQAGVLPPLVSA 339


>gi|94263394|ref|ZP_01287208.1| permease YjgP/YjgQ [delta proteobacterium MLMS-1]
 gi|93456230|gb|EAT06364.1| permease YjgP/YjgQ [delta proteobacterium MLMS-1]
          Length = 359

 Score = 44.7 bits (104), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 70/139 (50%), Gaps = 10/139 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSI---LLGI 114
           ++PLII+Q++P   L+  I+    LNR  EL+  +A G+S  +++ P ++ +    LLG+
Sbjct: 56  KIPLIIEQLLPVALLLAGIITLGLLNRRHELMALQAAGLSTRRIIRPLLLAAFACTLLGM 115

Query: 115 FTV-LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
            +   ++ P  +   ++    ++Q ++ G +++  I         Q+ I+        EN
Sbjct: 116 ASSQWLLPPTMSELNRLWHQEVRQQENRGIERQGRI-----YYRGQEGIYSFRPAADSEN 170

Query: 174 HIWEDFTSITIDKKNKIIH 192
            +  DF+ +T D+  ++  
Sbjct: 171 RL-ADFSYLTWDRDYRLAQ 188


>gi|220932585|ref|YP_002509493.1| permease YjgP/YjgQ family protein [Halothermothrix orenii H 168]
 gi|219993895|gb|ACL70498.1| permease YjgP/YjgQ family protein [Halothermothrix orenii H 168]
          Length = 365

 Score = 44.7 bits (104), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 63/297 (21%), Positives = 125/297 (42%), Gaps = 22/297 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P II    P  TL+  ++ F  L+   E+   RA G+S+++++ P ++  +++ + T+
Sbjct: 57  KLPPIIVLTFPMATLMGTLMSFGRLSGDGEITAFRAGGVSVYKIVIPSLLVGLIMSVTTI 116

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSD-----IIPW-MQISNPQ----QDIFIGAK 167
           +V   +      +   ++ + K NG K  +      + P   +   P        F G  
Sbjct: 117 MVNEMVVPRANYLYDQIVWEIK-NGRKMPATQYDLTLTPLDRKYRRPDYILYTHRFNGET 175

Query: 168 KILPENHI--WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDK-N 224
            I+ + ++  +E    +T+ K  K + + D      YN  +   K  E    R+P  K N
Sbjct: 176 GIMNDVYLQDYEKGVPVTLIKARKAVWQGDK--WHFYNGNIYYFKEGE----RVPALKFN 229

Query: 225 STTLNIPIKM-DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLM 283
              +  PI       K ++     SF E+ + + F  +      +    +++  I IP  
Sbjct: 230 EYVIKQPIYTPRRIGKMNKDIEDMSFKELGEYIQFLEEQGK-DTFEERVKYHQKIAIPFA 288

Query: 284 LVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
                L+AA + ++  RS      +   I   F+ YTI+T+  + G+ G + P   A
Sbjct: 289 SFIFALLAAPLGIKPRRSGGTATGMGLSIIVIFIYYTIMTLGSALGERGTISPFFGA 345


>gi|68250306|ref|YP_249418.1| permease [Haemophilus influenzae 86-028NP]
 gi|145633638|ref|ZP_01789365.1| predicted permease [Haemophilus influenzae 3655]
 gi|148825754|ref|YP_001290507.1| leucyl aminopeptidase [Haemophilus influenzae PittEE]
 gi|229847324|ref|ZP_04467426.1| leucyl aminopeptidase [Haemophilus influenzae 7P49H1]
 gi|68058505|gb|AAX88758.1| predicted permease [Haemophilus influenzae 86-028NP]
 gi|144985515|gb|EDJ92331.1| predicted permease [Haemophilus influenzae 3655]
 gi|148715914|gb|ABQ98124.1| leucyl aminopeptidase [Haemophilus influenzae PittEE]
 gi|229809749|gb|EEP45473.1| leucyl aminopeptidase [Haemophilus influenzae 7P49H1]
          Length = 358

 Score = 44.7 bits (104), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 81/362 (22%), Positives = 150/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L T    L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGTIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTIPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  +     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTIMKDEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|192358887|ref|YP_001981939.1| putative permease, YjgP/YjgQ family [Cellvibrio japonicus Ueda107]
 gi|190685052|gb|ACE82730.1| putative permease, YjgP/YjgQ family [Cellvibrio japonicus Ueda107]
          Length = 352

 Score = 44.7 bits (104), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 82/371 (22%), Positives = 161/371 (43%), Gaps = 57/371 (15%)

Query: 13  YLKTTLYFLLGAMILVFVIDLNEI---QNQMGELPNYSISRGA-VLAATRVPLIIQQIIP 68
           Y+  T++  +   +LVF I L+ I    +Q+G++     SR A +  +  VP  + ++IP
Sbjct: 7   YISRTVFSAIALTLLVF-ISLDFIFSFIDQLGKIRGGYTSREAFIYMSLTVPRRLYELIP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVIN 121
           +  L+ ++V    L  +SEL + RA G+S+    W  L P   F+V +++LG +      
Sbjct: 66  YSCLIGSLVGLGLLANSSELTVIRAAGVSVKRIAWMALRPAFVFIVAAVILGEY------ 119

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
            +A   E++  +     +DN  +  +++  W    N + + ++  + +LP   I+   T 
Sbjct: 120 -VAPYTEQMADNRRLLVRDNWVRTTTNM--W----NREGNEYMHVQAVLPSGVIY-GLTR 171

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKV-KLKKVVEYQYGRIPIDKN---STTLNIPIKMDGF 237
              D++ +++       AI   +   + + V   + G   +  +   S     P+K +  
Sbjct: 172 YQFDEQRRLVAASYTKQAIYQEEGYWQEEDVAVTRIGEQGVSNDLLPSRRWETPLKPNLL 231

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQ---------FYFLIVIPLMLVAMT 288
                           + MS SN  N + NY  E           F+   + PL  +++ 
Sbjct: 232 NILVMD---------PEDMSISNL-NYYSNYLKEQNLRPGNYALAFWQKTLQPLATMSLV 281

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIM-KSFGKSGILL---PVAAALIPV 344
           LIA S      RS    + +   IF+G +      ++ K  G + ++    PV A LIP+
Sbjct: 282 LIAISFIFGPLRS----VTMGQRIFTGIVFGVGFQLLQKLMGPASMVFGFAPVFAVLIPI 337

Query: 345 ILTISLSILIL 355
           ++ I + + +L
Sbjct: 338 VICILVGVFLL 348


>gi|145635440|ref|ZP_01791141.1| predicted permease [Haemophilus influenzae PittAA]
 gi|145641037|ref|ZP_01796618.1| predicted permease [Haemophilus influenzae R3021]
 gi|145267314|gb|EDK07317.1| predicted permease [Haemophilus influenzae PittAA]
 gi|145274198|gb|EDK14063.1| predicted permease [Haemophilus influenzae 22.4-21]
          Length = 358

 Score = 44.7 bits (104), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 81/362 (22%), Positives = 150/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L T    L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGTIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTMPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  +     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKDEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|153209377|ref|ZP_01947372.1| putative permease [Coxiella burnetii 'MSU Goat Q177']
 gi|165919052|ref|ZP_02219138.1| putative permease [Coxiella burnetii RSA 334]
 gi|212218294|ref|YP_002305081.1| hypothetical membrane spanning protein [Coxiella burnetii
           CbuK_Q154]
 gi|120575377|gb|EAX32001.1| putative permease [Coxiella burnetii 'MSU Goat Q177']
 gi|165917247|gb|EDR35851.1| putative permease [Coxiella burnetii RSA 334]
 gi|212012556|gb|ACJ19936.1| hypothetical membrane spanning protein [Coxiella burnetii
           CbuK_Q154]
          Length = 355

 Score = 44.7 bits (104), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 80/359 (22%), Positives = 142/359 (39%), Gaps = 52/359 (14%)

Query: 21  LLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVF 79
           LLG  M + F+  L++I +      +Y + +  +   T++P  + Q+ P    +  ++  
Sbjct: 23  LLGIEMFMEFIGQLSQIGS-----VHYGLGQAFLYVLTQLPSDLYQLFPMAGFLGCLIGL 77

Query: 80  FNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI---FTVLVINP-IATSGEKIGIDLI 135
             L  +SEL++ R  G+SI  +    V  ++L+ +   F   VI P +  SGE+  +  +
Sbjct: 78  GRLASSSELMVMRTAGVSIAGVTWAVVKAALLMMVAMTFIGEVIAPQLGASGEETKLTAL 137

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKI----- 190
              K  G K   D+  W+     Q  I IG                 ++D KNKI     
Sbjct: 138 S--KAVGYKALGDV--WLH--GAQSFIHIG-----------------SVDAKNKISEVSQ 174

Query: 191 --IHRKDADLAIIYNDKVKLKKV--VEYQYGRIPIDKNSTT--------LNIPIKMDGFQ 238
             I+ K   L+ +Y  K +  K   + Y   +     N TT        L I    D  Q
Sbjct: 175 FFINNKHQLLSAVYAPKGEYVKGHWILYNVKQTQFTPNRTTEKKIAKFPLTIVFNPDHLQ 234

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +  +    +S   +   + +  ++ +    R    F+   + PL  V M  +        
Sbjct: 235 QGRKMVDRQSIVGLYHTIRYRQQAGL-QTSRYVFAFWQRFIQPLTTVVMICLGVPFIFGS 293

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
            R     + +  GI  GF  Y +      F     + P+ AAL+P +L  ++  +ILL+
Sbjct: 294 LRQASMGLRILTGIVIGFAFYMLNQFFGPFAMVYQIPPIFAALMPTVL-FAVGCVILLR 351


>gi|330873093|gb|EGH07242.1| hypothetical protein PSYMP_02386 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963183|gb|EGH63443.1| hypothetical protein PSYAC_00745 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 353

 Score = 44.3 bits (103), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 79/358 (22%), Positives = 147/358 (41%), Gaps = 53/358 (14%)

Query: 26  ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNR 84
           I++ ++ L    ++MG++ + Y++           P  +   +P   L+  ++    L  
Sbjct: 22  IILGLVSLFAFIDEMGDINDTYTLLDALSYVMMTAPRRVYDTLPMAALIGCLIGLGTLAS 81

Query: 85  TSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQ 137
           +SEL I RA G+SI    W ++ P    +V  +L+G +    + P A +  +    L Q 
Sbjct: 82  SSELTIMRAAGVSIGRIVWAVMKPMLLLMVAGVLVGEY----VAPYAENQAQAARSLAQ- 136

Query: 138 WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDAD 197
              +GD Q +    W +    Q D FI    + P N +    T    D +  ++    A 
Sbjct: 137 --GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTRYRFDDQRHMLTSSFAK 189

Query: 198 LAIIYNDKVKLKKV--VEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEII-- 253
            A    D  +LK V    ++ GR  +      +N P      +++    + +    +I  
Sbjct: 190 EAHFKTDYWELKDVSTTHFKEGRTEV------VNAPD-----ERWDVSLSPQLLSTVIMP 238

Query: 254 -KKMSFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
            + +S S   +  H        N R    F+  ++ P + VA+ L+A S      RS   
Sbjct: 239 PESLSISGLWSYAHYLADQGLSNGRYWLAFWTKVLQPAVTVALVLMAISFIFGPLRS--- 295

Query: 305 RIIVAYGIFSGFML-YTIITIMKSFGKSGILL---PVAAALIPVILTISLSILILLQK 358
            + +   +F+G ++ +T   I    G S +L    P+ A LIP     + + L LL++
Sbjct: 296 -VTLGQRVFTGVVVGFTFRIIQDLLGPSSLLFGFPPLLAVLIPAA-ACAFAGLYLLRR 351


>gi|313200016|ref|YP_004038674.1| permease [Methylovorus sp. MP688]
 gi|312439332|gb|ADQ83438.1| permease YjgP/YjgQ family protein [Methylovorus sp. MP688]
          Length = 356

 Score = 44.3 bits (103), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 78/376 (20%), Positives = 152/376 (40%), Gaps = 44/376 (11%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           +L RY  +  + + +  ++  + +    DL +    +G+   Y +++  V      P  +
Sbjct: 3   LLNRYLTQEIVSSIMLIMVALLAMFSFFDLIQELESIGK-GTYGLNKVLVFVLLSAPGHV 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   LV  +     L+R SEL+I R  GISI  +    +   ++  + T  V   +
Sbjct: 62  YEVVPVAVLVGTMYALGQLSRHSELIILRVSGISIATIARSLLKVGLIFAVITFFVGEFV 121

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HIWE- 177
               EK    L  Q  D+   Q      W++        F+  ++++P++     HI+E 
Sbjct: 122 TPYSEKTAQRLRIQATDSVVAQDFRSGLWVKDGRS----FVNVEEVMPDSGLMNIHIYEF 177

Query: 178 ----------DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT 227
                     D  +   D +N   H KD       +  VK +   + Q+          +
Sbjct: 178 DDSFHLRTISDAKTGRFDGEN--WHLKDVQQTHFLDKTVKSEFFPQAQW---------QS 226

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
           L  P  ++      E+ ++ + Y  I  +S +NK       R E   +  +V PL  + M
Sbjct: 227 LIRPELLNVLLVVPEKMSAWNLYFYIHHLS-ANKQK---TSRHEIALWSKMVYPLASLVM 282

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIM-KSFGKSGIL---LPVAAALIP 343
            ++A    L F    Q     +  IF+G ML  +  ++ + F   G+L    P+ +A++P
Sbjct: 283 VVLA----LPFGFLQQRSGGASAKIFAGIMLGIVYQVLNRVFVHLGLLNDWSPLMSAVVP 338

Query: 344 VILTISLSILILLQKE 359
            +L +   + +L   E
Sbjct: 339 TLLFLLAGLTMLFMAE 354


>gi|29654138|ref|NP_819830.1| putative permease [Coxiella burnetii RSA 493]
 gi|161831591|ref|YP_001596891.1| putative permease [Coxiella burnetii RSA 331]
 gi|29541404|gb|AAO90344.1| hypothetical membrane spanning protein [Coxiella burnetii RSA 493]
 gi|161763458|gb|ABX79100.1| putative permease [Coxiella burnetii RSA 331]
          Length = 355

 Score = 44.3 bits (103), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 76/341 (22%), Positives = 135/341 (39%), Gaps = 47/341 (13%)

Query: 38  NQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
           +Q+G + +Y + +  +   T++P  + Q+ P    +  ++    L  +SEL++ R  G+S
Sbjct: 37  SQIGSV-HYGLGQAFLYVLTQLPSDLYQLFPMAGFLGCLIGLGRLASSSELMVMRTAGVS 95

Query: 98  IWQLLNPFVVGSILLGI---FTVLVINP-IATSGEKIGIDLIQQWKDNGDKQKSDIIPWM 153
           I  +    V  ++L+ +   F   VI P +  SGE+    L +  K  G K   D+  W+
Sbjct: 96  IAGVTWAVVKAALLMMVVMTFIGEVIAPQLEASGEE--TKLTELSKAVGYKALGDV--WL 151

Query: 154 QISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKI-------IHRKDADLAIIYNDKV 206
                Q  I IG                 ++D KNKI       I+ K   L+ +Y  K 
Sbjct: 152 H--GAQSFIHIG-----------------SVDAKNKISEVSQFFINNKHQLLSAVYAPKG 192

Query: 207 KLKKV--VEYQYGRIPIDKNSTT--------LNIPIKMDGFQKFSEQFASRSFYEIIKKM 256
           +  K   + Y   +     N TT        L I    D  Q+  +    +S   +   +
Sbjct: 193 EYVKGHWILYNVKQTQFTPNRTTEKKIAKFPLTIVFNPDHLQQGRKMVDRQSIVGLYHTI 252

Query: 257 SFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGF 316
            +  ++ +    R    F+   + PL  V M  +         R     + +  GI  GF
Sbjct: 253 RYHQQAGL-QTSRYVFAFWQRFIQPLTTVVMICLGVPFIFGSLRQASMGLRILTGIVIGF 311

Query: 317 MLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
             Y +      F     + P+ AAL+P +L  ++  +ILL+
Sbjct: 312 AFYMLNQFFGPFAMVYQIPPIFAALMPTVL-FAVGCVILLR 351


>gi|85709345|ref|ZP_01040410.1| predicted permease [Erythrobacter sp. NAP1]
 gi|85688055|gb|EAQ28059.1| predicted permease [Erythrobacter sp. NAP1]
          Length = 365

 Score = 44.3 bits (103), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 59/319 (18%), Positives = 128/319 (40%), Gaps = 27/319 (8%)

Query: 55  AATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI 114
           A+ R+P +I + +P+  L+  ++    LN+ SE+V  +A G+S  Q+L P ++ + ++ +
Sbjct: 61  ASLRIPQLIARFLPYSVLLATLITLVTLNQNSEVVAMKAAGLSAHQVLAPLLLTAAVVAL 120

Query: 115 FTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI-GAKKILPEN 173
            +      + T         ++ W      +  +  P  + S  + ++++     IL  +
Sbjct: 121 ISFAFNERVVTRANST----LKAW------EAVEYGPIPEQSGVRANVYLTDGDNILTAS 170

Query: 174 HIWEDFTSITIDK-------KNKIIHRK-DADLAIIYNDKVKLKKVVEYQYGRI---PID 222
            +      I +D           II  +  A  A       +L+    +  G     PID
Sbjct: 171 SLIGSGEDIELDNVTWYSRAPGGIISEQIKATGATYAAPGWRLENPKRFDVGSATTEPID 230

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKM-SFSNKSNIFHNYRAETQFYFLIVIP 281
                  +  +    Q       ++SF+E+ + + ++          RA  +++  +  P
Sbjct: 231 DVVVGEGLTPEQIDLQSVDPD--AQSFWELSETIDAYEAAGRRTSEMRA--KWWHRLSGP 286

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L  + M L+ +  +   +RS Q  +    G+  GF  + +     + G  G   P  AA 
Sbjct: 287 LSALLMPLLGSVAAFGLARSGQLFVRAVIGMALGFAYFVVDNAALAMGSFGGYPPFLAAW 346

Query: 342 IPVILTISLSILILLQKED 360
            P  L + +   +L++ E+
Sbjct: 347 APFFLFLLVGETVLIRTEE 365


>gi|229588598|ref|YP_002870717.1| putative ABC transporter membrane protein [Pseudomonas fluorescens
           SBW25]
 gi|229360464|emb|CAY47321.1| putative ABC transport system, membrane protein [Pseudomonas
           fluorescens SBW25]
          Length = 359

 Score = 44.3 bits (103), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 21/185 (11%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVV---G 108
           A   P  +  ++P   L+  ++   +L  +SEL I RA G+SI    W ++ P ++    
Sbjct: 53  ALTAPRRLYDMMPMAALIGCLIGLGSLASSSELTIMRAAGVSIGRIVWAVMKPMLLLMAC 112

Query: 109 SILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKK 168
           S+L+G +    + P A +  +    L Q    +GD Q S    W +    Q + FI    
Sbjct: 113 SVLIGEY----VAPPAETTAQANRALAQ---GSGDAQSSKHGLWHR----QGEEFIHINA 161

Query: 169 ILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT- 227
           + P   +    T  T DK+  ++    A  A    +K +L  V    +  I    N+ T 
Sbjct: 162 VQPGGLL-IGVTRYTFDKERHLLESSFAKRAQYSGEKWQLSDVTTTYFRNIGQGTNARTE 220

Query: 228 -LNIP 231
            +N+P
Sbjct: 221 VINVP 225


>gi|85060085|ref|YP_455787.1| putative transport protein [Sodalis glossinidius str. 'morsitans']
 gi|84780605|dbj|BAE75382.1| putative transport protein [Sodalis glossinidius str. 'morsitans']
          Length = 356

 Score = 44.3 bits (103), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 80/364 (21%), Positives = 143/364 (39%), Gaps = 17/364 (4%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  K    T +  L   + L  +I   E   ++G+   YS     +     +P
Sbjct: 1   MFGVLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVEQLRKVGQ-GGYSALGAGLFTLLSIP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+  ++   +L   SELV+ +A G S  Q+    +  +I L + T+ + 
Sbjct: 60  KDIEIFFPMSALLGALLGLGSLATRSELVVMQASGFSRMQVAGSVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A +GE++  +   Q    G    +    W +  N     FI  ++++  + +     
Sbjct: 120 EWVAPAGEQMAYNYRTQMIYGGSMLSTQNGLWAKDGND----FIFIERVVGSDEL-AGVN 174

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-------GRIPIDKNSTTLNIPIK 233
               DK +++   + A  A   N   KL +V E          GR  ++    T   P K
Sbjct: 175 IYHFDKADRLQSLRYAATATFSNGSWKLSQVDESDLTNDKQITGRQTLNGEWKTNLTPDK 234

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
           +          +    Y  +  +  S +     + R +   +  I  P  +  M L+A S
Sbjct: 235 LGVVALEPNSLSISGLYNYVNYLKQSGQ----ESNRYQLNMWSKIFSPFSVAVMMLMALS 290

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
                 RS    + V  GI  GF+ Y +  I         + PV  AL+P +  + +SI+
Sbjct: 291 FIFGPLRSVPMGVRVVIGISFGFLFYVLDQIFGPLSLVYNMPPVFGALLPSMAFLIISIV 350

Query: 354 ILLQ 357
           +LL+
Sbjct: 351 MLLR 354


>gi|303258295|ref|ZP_07344302.1| permease YjgP/YjgQ [Burkholderiales bacterium 1_1_47]
 gi|302859048|gb|EFL82132.1| permease YjgP/YjgQ [Burkholderiales bacterium 1_1_47]
          Length = 378

 Score = 44.3 bits (103), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 71/358 (19%), Positives = 137/358 (38%), Gaps = 63/358 (17%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           I+ R  F   +K++L+ LL  + L    DL      +G   +YS+ +  +L A  +P   
Sbjct: 3   IVSRMIFAQIMKSSLFVLLTLVALFAFFDLIGQSGNIGT--SYSMGQAFLLTALILPTRC 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   ++ +I     L  TS+  + R  GI  W+     ++  I+L I   L+ N +
Sbjct: 61  YEVLPIAVMLGSIFTLSRLASTSQFTVLRVSGIGPWRFCGMLLMPGIVLVICAYLLGNLV 120

Query: 124 ATSGEKIGIDL---IQQWKDNGDKQKSDIIPWM------QISNPQQDIFIGAKKILPENH 174
           A   +++  +    I      G +  S I  W+      +   P++  F+  +++ P   
Sbjct: 121 APPAQRLAKEFKLDISGSAFTGKELDSGI--WVRDVQRNEAGEPKKISFVNVQRLRPGEA 178

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGRIPIDKNSTTLNIPI 232
            + D+     D+ + +     A     Y+++    L  VVE     +P +          
Sbjct: 179 AY-DWVVYVFDRPDHLTSIVTAKSG-TYSEQEGWVLHDVVEETVPTLPKESR-------- 228

Query: 233 KMDGFQKFSEQFASRSFYEIIKKMSFSNK--SNIF---------------HNY------- 268
                    EQ  +R   +++K M +      NIF               H Y       
Sbjct: 229 ---------EQTQARVERKVMKSMVWGKSLDGNIFGLLMIKPEDMSLQELHYYIEYLKEN 279

Query: 269 -----RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTI 321
                R +T F+     PL ++ M L++   + + +R+    I +  GI  G   Y +
Sbjct: 280 GQTYKRFDTAFWSKAFYPLAILVMLLLSMPFAYQNARAGGMAIKIFCGIMIGIFYYAL 337


>gi|21674368|ref|NP_662433.1| hypothetical protein CT1549 [Chlorobium tepidum TLS]
 gi|21647546|gb|AAM72775.1| membrane protein, putative [Chlorobium tepidum TLS]
          Length = 384

 Score = 44.3 bits (103), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 84/371 (22%), Positives = 162/371 (43%), Gaps = 42/371 (11%)

Query: 1   MPG-----ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL- 54
           +PG     I+ RY  + +L T   F L +   +F++ +N ++N +    +  IS G +L 
Sbjct: 21  LPGFGNFTIIDRYIARQFL-TIFLFALASFAALFIL-INLVEN-LDRFLDRHISFGRILI 77

Query: 55  -AATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG 113
              + +P       P   L+ ++ V   L+  SEL   ++ G+S+ +L+ PF++ ++ + 
Sbjct: 78  YYLSGLPDTFLLTSPLSVLLASLFVTGKLSMQSELPALKSAGMSLSRLMKPFLLVTMAIA 137

Query: 114 IFTVLVINPIATS----GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKI 169
               +    IA +     +      +++ +DNG++        + I      I   A KI
Sbjct: 138 ALNTINSCFIAPAMYDWSKGFEKRYLKKQQDNGEEP-------LHIRESNNRILTVA-KI 189

Query: 170 LPENHIWEDFTSITIDKKN--KIIHRKDAD-LAII--------YNDKVK-LKKVVEYQYG 217
            P+    +  T+++++  N  +I+ R DAD L II        YN K +   K  E    
Sbjct: 190 GPDK---KSATTVSLETFNGSQIVSRIDADSLRIITRHKYWIFYNTKQRTFSKGAETLVT 246

Query: 218 RIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL 277
           R   D    TL + +  + F+         +  + I  +    +S +    RA  + +  
Sbjct: 247 RAGAD----TLKLSLAPNTFKMIDTDPDEMNIVQHIDFIWQKARSGLPGLERATVKLHTK 302

Query: 278 IVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPV 337
           + +PL  + + LI   +S +  RS    + ++  +  G +   ++  + S G  G+L PV
Sbjct: 303 LALPLASMIIVLIGVPLSSKKKRSGLA-VEISISLLIGLLYLGMLKTIGSLGYDGLLNPV 361

Query: 338 AAALIPVILTI 348
            AA +P IL I
Sbjct: 362 LAAWLPDILFI 372


>gi|303230241|ref|ZP_07317009.1| permease, YjgP/YjgQ family [Veillonella atypica ACS-134-V-Col7a]
 gi|303231004|ref|ZP_07317747.1| permease, YjgP/YjgQ family [Veillonella atypica ACS-049-V-Sch6]
 gi|302514386|gb|EFL56385.1| permease, YjgP/YjgQ family [Veillonella atypica ACS-049-V-Sch6]
 gi|302515167|gb|EFL57141.1| permease, YjgP/YjgQ family [Veillonella atypica ACS-134-V-Col7a]
          Length = 363

 Score = 44.3 bits (103), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 127/307 (41%), Gaps = 30/307 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P II    P   L+ +++ F  L+ TSE+V+ RA G+S  +L  P  + ++L+ I  V 
Sbjct: 58  MPSIILLTFPMSVLLGSLMAFSRLSSTSEIVVMRAGGLSFLRLAMPVYILALLISIGAVA 117

Query: 119 VINPIATSGEKIGIDLI-QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +      +   ++ ++   N   Q  + I    ++       + AK    E+    
Sbjct: 118 FNEFVVPRTNNMYQTIVREEIMKNASPQTQNHIVLKSMNGDNLSTLMYAKHYDSESKKLS 177

Query: 178 DFTSITIDKKNKIIHRKDADLA------------IIYNDKV--KLKKVVEYQYGRIPIDK 223
             T    + K ++   ++A+ A            IIY+      +++ ++++   +PI  
Sbjct: 178 MITVQQFNDKGELQQVENAENAEWNGQVWVMHSGIIYDVSAGEGVERTMKFKEQVLPIKS 237

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIK--KMSFSNKSNIFHNYRAETQFYFLIVIP 281
           +      P ++   Q+  E+   +     IK  K +++N + +      E + Y    IP
Sbjct: 238 S------PNEVQQDQRKPEELTIKELRHQIKAYKAAYTNSNKL------EMEMYQRFTIP 285

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+ A + L+  RS+         +   F+ Y ++T   + GK G L    AA+
Sbjct: 286 LASFVFALVGAPLGLQKQRSSSSIGFGISILII-FIYYGVMTFAGALGKGGALPTWMAAM 344

Query: 342 IPVILTI 348
           IP  L I
Sbjct: 345 IPDTLGI 351


>gi|119503286|ref|ZP_01625370.1| hypothetical protein MGP2080_11498 [marine gamma proteobacterium
           HTCC2080]
 gi|119460932|gb|EAW42023.1| hypothetical protein MGP2080_11498 [marine gamma proteobacterium
           HTCC2080]
          Length = 353

 Score = 44.3 bits (103), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 86/205 (41%), Gaps = 7/205 (3%)

Query: 9   FFKYYLKTTLYFLLGAMILVFVID-LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQI 66
           F +Y     L   +G + ++  +D L+ + +++ +L P+Y  +   +  A  +P  + + 
Sbjct: 4   FDRYLAGNVLGATVGVLAVLVGLDALSSVIDELDDLSPDYGFTDALIYVAFTLPRRLHEY 63

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +PF  L+  +V    L  TSEL + RA G S+ QL    +  ++LL +   LV   ++  
Sbjct: 64  VPFAALIGALVGLGRLAATSELTVVRAAGRSLPQLALGTLRPALLLAVLGFLVGEFVSPV 123

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+  +      K      +S       + N   D FI    +     I      +T D+
Sbjct: 124 AEQFAVSH----KALAQGSQSSFTGRGGVWNRDGDTFIHVSAV-ERGGIIHGVQLLTFDE 178

Query: 187 KNKIIHRKDADLAIIYNDKVKLKKV 211
           + ++     A+       +  L+KV
Sbjct: 179 ERRLTRSLRAERGTYQGGQWLLEKV 203


>gi|302342717|ref|YP_003807246.1| permease YjgP/YjgQ family protein [Desulfarculus baarsii DSM 2075]
 gi|301639330|gb|ADK84652.1| permease YjgP/YjgQ family protein [Desulfarculus baarsii DSM 2075]
          Length = 359

 Score = 44.3 bits (103), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 121/301 (40%), Gaps = 29/301 (9%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           +VP II  + P   L+  I+    +++  E +  ++ G+S+ +   P V+ ++ + + T 
Sbjct: 56  QVPEIISLLSPLAVLLGTIIALGLMSKRGETIAIKSSGVSVMRFTLPIVLLALTITLSTA 115

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKIL------P 171
           L IN +A  G K   + I  W    +K+ S         + ++  F G   I       P
Sbjct: 116 L-INEMALPGTKARTNHI--WNVMVEKRPSSAY------SHEKFWFKGNGSIYHIGLFDP 166

Query: 172 ENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDK------VKLKKVVEYQYGRIPIDKNS 225
              +  +      D    +  R DA  A     K      +  +++ +  Y  +  D+  
Sbjct: 167 LGQVLSNVVYYRFDDHFNLAERIDARRATYIGGKWLFFLGLHQQRLPQGGYSAVVFDELE 226

Query: 226 TTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
              N+P + + F + S+        E+   +   +    +   R +   +  I  P + V
Sbjct: 227 K--NLPERPEDFSRLSKPSEEMGLAELSDHVGKVDAEG-YDTRRYQVDMHCKISYPFICV 283

Query: 286 AMTLIAASVSL--EFSRSNQPRIIVAYGIFSGFMLYTIITIMKS-FGKSGILLPVAAALI 342
            M LI   ++L  E  R+  P I+V  G+    + +      +S FG  G+L P+ AA +
Sbjct: 284 IMALIGIPLALFRERGRALAPGIVV--GMLVALVYWISFGYARSIFGYGGVLPPMMAAWL 341

Query: 343 P 343
           P
Sbjct: 342 P 342


>gi|170079022|ref|YP_001735660.1| permease, YjgP/YjgQ family protein [Synechococcus sp. PCC 7002]
 gi|169886691|gb|ACB00405.1| permease, YjgP/YjgQ family protein [Synechococcus sp. PCC 7002]
          Length = 373

 Score = 44.3 bits (103), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 143/324 (44%), Gaps = 37/324 (11%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
           A ++P  I   +P   L+  ++V+  L+  SE++  R++GIS+++L+ P ++ SIL    
Sbjct: 62  ALKMPEFIGFALPMAVLLATLIVYSRLSGDSEIIALRSLGISVYRLVLPALIFSILATAI 121

Query: 116 TVLVIN---PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
           T +  +   P+A +     ++     K    + +  I P     N  + +F  A+    +
Sbjct: 122 TFVFKDQVIPLANAQATQTLEQAFLQKQAPFRDEKIIYPEYGEDNVLKRLFYAAEF---D 178

Query: 173 NHIWEDFTSITIDKKNKIIHR---KDA---DLA---------IIY--NDKVKLKKVVEYQ 215
               +D T   ID+ N  +++    DA   DLA         IIY  +     + V+ + 
Sbjct: 179 GQQMKDLT--IIDRSNGSLNQIVTADAAGWDLARNQWNFQNGIIYFIDIDGSYRNVLRF- 235

Query: 216 YGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFY 275
                 D++   L+  +++D      E  +     + ++ ++     +     +   +F 
Sbjct: 236 ------DRHQIQLSNELRVDEELPKHEDMSLAQLQQYMQTVAADPDRDEAWLRKLRVRFQ 289

Query: 276 FLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKSFGKSGI 333
             I  P + +A+ ++ A++ L   R         +G+  G  F  Y +  ++ S G +G 
Sbjct: 290 EKISFPFICLALGVVGAAIGL---RPQSAGKATGFGLCVGLIFGYYFLAFMISSVGVAGY 346

Query: 334 LLPVAAALIPVILTISLSILILLQ 357
           L P+ AA +P ++ ++++  ++LQ
Sbjct: 347 LHPILAAWLPNLIVMAIASGLVLQ 370


>gi|194337384|ref|YP_002019178.1| permease YjgP/YjgQ family protein [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309861|gb|ACF44561.1| permease YjgP/YjgQ family protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 359

 Score = 43.9 bits (102), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 137/315 (43%), Gaps = 37/315 (11%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P I+  + P   L+ +I+V   L+ + EL   R+ G+S+ QLL PF+ G +L+ +F +L
Sbjct: 57  IPSILLVVSPVSALLSSILVAGKLSFSGELPAIRSAGVSMRQLLTPFITGGVLILLFNLL 116

Query: 119 VINPIATS--GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
               I+ S   EK   +     ++    Q++  I  ++  N    I      + P+    
Sbjct: 117 NAGWISPSTFAEKNHFEQRYLKRNPAQPQENRNIHILEPGNRMLSI----GTLDPDQ--- 169

Query: 177 EDFTSITIDK--KNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
            + ++++I++    ++  R DAD ++ YN K   + ++     R    K+ T    P+  
Sbjct: 170 AEISAVSIEEFSGARLKSRTDAD-SMRYNQKTG-EWILLNAAKRSFTGKDETFHLTPV-- 225

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQ---------------FYFLIV 279
                     + RS  E+  +    ++ N+  +YR  T+               F+  I 
Sbjct: 226 ---TSVKLALSPRSLSELNLQ---PDEMNLIRHYRYLTEKEGAGFAGLERSTVKFHNKIA 279

Query: 280 IPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           +P   + + LI   +S +  R      I +  +F+GF+   +   +   G  G++ P+ A
Sbjct: 280 LPFASLIIILIGVPLSAKKKRGGLASEI-SITLFAGFLFMGVQKTIAIAGYQGMINPMLA 338

Query: 340 ALIPVILTISLSILI 354
           A +P IL + +   I
Sbjct: 339 AWLPNILFLGIGYAI 353


>gi|218246939|ref|YP_002372310.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 8801]
 gi|257060003|ref|YP_003137891.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 8802]
 gi|218167417|gb|ACK66154.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 8801]
 gi|256590169|gb|ACV01056.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 8802]
          Length = 393

 Score = 43.9 bits (102), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 66/314 (21%), Positives = 136/314 (43%), Gaps = 37/314 (11%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P  I    P   L+  ++ +  L+  SEL+  R++GISI++L+ P ++ S+L+     
Sbjct: 74  KMPGFIVLAFPMAMLLAALMAYSRLSSDSELIAMRSLGISIYRLVIPAILFSLLVTGLAF 133

Query: 118 LV---INPIATSGEKIGID-LIQQWKDNGDKQKSDIIPWMQISNPQ--QDIFIGAKKILP 171
           +V   I P AT    + ++  + + + +  +Q++ I P  +I   +  ++  + ++    
Sbjct: 134 IVNDWIAPAATHEAAVTLEKAVSKERPSFAEQRNIIYPEYRIIQQEDGKETTVLSRLFYA 193

Query: 172 ENHIWEDFTSITI-----DKKNKIIHRKDADLAIIYND-------------KVKLKKVVE 213
           EN   E+   +TI     +  N+I+  + A   +  N                  + +V 
Sbjct: 194 ENFNGEEMEELTILDRSQEDVNQIVTSQSATWNVAQNTWDFFNGTIYIIAPDGSYRNIVR 253

Query: 214 YQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQ 273
           +Q+ ++ + +    L++  +   F + S   A    Y  + K+S  NK  +    + E +
Sbjct: 254 FQHQQLKLPR--APLDLANRRQNFTEMS--IAQTKEYLEVMKLS-GNKERV---RKVEVR 305

Query: 274 FYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKSFGKS 331
                 +P + +   L+ A++ +   R        ++GI  G  F  Y +  +  S G  
Sbjct: 306 IQEKYALPFVCLVFGLVGAAMGV---RPQNTSRATSFGICVGLIFSYYLLSFVTSSLGIW 362

Query: 332 GILLPVAAALIPVI 345
           GIL P  AA  P I
Sbjct: 363 GILTPFLAAWAPNI 376


>gi|118594057|ref|ZP_01551404.1| hypothetical protein MB2181_00275 [Methylophilales bacterium
           HTCC2181]
 gi|118439835|gb|EAV46462.1| hypothetical protein MB2181_00275 [Methylophilales bacterium
           HTCC2181]
          Length = 344

 Score = 43.9 bits (102), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 69/337 (20%), Positives = 136/337 (40%), Gaps = 33/337 (9%)

Query: 39  QMGELP--NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGI 96
           ++G+L    Y IS         +P  I + +P   L+ ++     L+  SEL + RA G 
Sbjct: 23  EIGDLGKGGYGISHAMTFVILSIPGHIYETVPLAVLIGSMYTIGQLSYNSELNVIRASGF 82

Query: 97  SIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQIS 156
           SI ++    ++      IFT+L+ + IA + EK    +     ++   Q+     W++  
Sbjct: 83  SIKKIATSLMITGGFFAIFTLLIGDLIAPNSEKNAQQMKIGLTNSVVGQEFSSGFWIKDG 142

Query: 157 NPQQDIFIGAKKILPEN-----HIWE---DFTSITIDKKNKIIHR------KDADLAIIY 202
                 F+  + +LP+      +I+E    F   TI    K  +       ++    I+Y
Sbjct: 143 GN----FVNIENVLPDATLERINIYEFDSQFNLRTIVNAEKGAYEEGEWRLENITQTILY 198

Query: 203 NDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKS 262
            + VK K         IP+    + +  P  M+      E+ +S + Y+ I  +  +N+ 
Sbjct: 199 ENSVKKKS--------IPMGSWKSLMR-PEMMNALIISPEKMSSFNLYKFISYLKINNQK 249

Query: 263 NIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
           +     + E   +  I+ PLM + M + A        RS      +  GI  G       
Sbjct: 250 ST----KYEVALWEKIIHPLMPLVMIIFAVPFGFLQERSGGKFFKMFIGIIIGIAYQITN 305

Query: 323 TIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           T+++         P  ++L+P ++ + L + ++ + E
Sbjct: 306 TLIRHLSLLNDWQPFISSLVPTLIFLCLGLYLIKRFE 342


>gi|331001131|ref|ZP_08324762.1| permease, YjgP/YjgQ family [Parasutterella excrementihominis YIT
           11859]
 gi|329569436|gb|EGG51214.1| permease, YjgP/YjgQ family [Parasutterella excrementihominis YIT
           11859]
          Length = 378

 Score = 43.9 bits (102), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 71/358 (19%), Positives = 137/358 (38%), Gaps = 63/358 (17%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           I+ R  F   +K++L+ LL  + L    DL      +G   +YS+ +  +L A  +P   
Sbjct: 3   IVSRMIFAQIMKSSLFVLLTLVALFAFFDLIGQSGNIGT--SYSMGQAFLLTALILPTRC 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   ++ +I     L  TS+  + R  GI  W+     ++  I+L I   L+ N +
Sbjct: 61  YEVLPIAVMLGSIFTLSRLASTSQFTVLRVSGIGPWRFCGMLLMPGIVLVICAYLLGNLV 120

Query: 124 ATSGEKIGIDL---IQQWKDNGDKQKSDIIPWM------QISNPQQDIFIGAKKILPENH 174
           A   +++  +    I      G +  S I  W+      +   P++  F+  +++ P   
Sbjct: 121 APPAQRLAKEFKLDISGSAFTGKELDSGI--WVRDVQRNEAGEPKKISFVNVQRLRPGEA 178

Query: 175 IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGRIPIDKNSTTLNIPI 232
            + D+     D+ + +     A     Y+++    L  VVE     +P +          
Sbjct: 179 AY-DWVIYVFDRPDHLTSIVTAKSG-TYSEQEGWVLHDVVEETVPTLPKESR-------- 228

Query: 233 KMDGFQKFSEQFASRSFYEIIKKMSFSNK--SNIF---------------HNY------- 268
                    EQ  +R   +++K M +      NIF               H Y       
Sbjct: 229 ---------EQTQARVERKVMKSMVWGKSLDGNIFGLLMIKPEDMSLQELHYYIEYLKEN 279

Query: 269 -----RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTI 321
                R +T F+     PL ++ M L++   + + +R+    I +  GI  G   Y +
Sbjct: 280 GQTYKRFDTAFWSKAFYPLAILVMLLLSMPFAYQNARAGGMAIKIFCGIMIGIFYYAL 337


>gi|110637606|ref|YP_677813.1| permease [Cytophaga hutchinsonii ATCC 33406]
 gi|110280287|gb|ABG58473.1| conserved hypothetical protein; possible permease [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 359

 Score = 43.9 bits (102), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 75/367 (20%), Positives = 144/367 (39%), Gaps = 40/367 (10%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAA---TRVPLIIQ 64
           Y  K +L T  + +L  M+++ VID+ E   +M +   + +S   +L       +P +  
Sbjct: 7   YIIKKFLVTYFFVVLMFMLVITVIDITE---KMEDFMKHKLSIWFILVEYYFAFIPYMAN 63

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
            + P    +  I V  NL   +E++   + G+S+ +++ P+++GSIL+      +   + 
Sbjct: 64  LLSPITIFIATIFVTANLAARTEIIAMLSSGMSLTRIMYPYLIGSILIAFMVFYMSGWLI 123

Query: 125 TSGEKIGIDLIQQ-------WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
             G K  +D  ++       ++      K+    ++ I +   +I +G +          
Sbjct: 124 PHGNKKRVDFEKKYIKSTFFYEGRNVHMKTAPTTYVYIESYNSEINVGYQ---------- 173

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNS---------TTL 228
            FT  TI     +   K A +   +ND  K  ++ EY   R   D            T L
Sbjct: 174 -FTLETIIDNRLVSKLKAARMN--WNDSTKKWRMEEYFIRRFTEDGKEEVFKGRGLDTAL 230

Query: 229 NI-PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
            I P   +      E +        I  +      NI      + Q Y     P  ++ +
Sbjct: 231 TITPKDFEDTYMLFETYDMGELNNQIALLEARGSENISTYITEKYQRY---TYPFSVIIL 287

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
           TLI    S   SR     + +A+G    F+    +   +S    G + P+ A+ IP I+ 
Sbjct: 288 TLIGVIASSRKSREGAG-LTIAFGFLLAFVYIIFMITSRSLANVGGIGPLFASWIPNIVF 346

Query: 348 ISLSILI 354
           I + +++
Sbjct: 347 IVIGLIM 353


>gi|307155108|ref|YP_003890492.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 7822]
 gi|306985336|gb|ADN17217.1| permease YjgP/YjgQ family protein [Cyanothece sp. PCC 7822]
          Length = 405

 Score = 43.9 bits (102), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 70/333 (21%), Positives = 134/333 (40%), Gaps = 48/333 (14%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG---- 113
           RVP      +P   L+  ++ +  L+  SEL+  R+ GIS+W+   P V+ S+++     
Sbjct: 89  RVPEFFSYALPISVLLTTLMTYGRLSSESELIALRSCGISLWRATIPAVMLSLIVTGLTF 148

Query: 114 IFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDII--PWMQISNPQQDIFIGAKKIL- 170
           IF   V+         I + ++ +  +    Q  DI    + QI  P        K +  
Sbjct: 149 IFNECVVPETNYRATGILVKVLHE--ERHFWQNKDIFYPNYEQIKLPNGQTLRQLKSLFY 206

Query: 171 PENHIWEDFTSITI-----DKKNKII------HRKDADLAIIYNDKVKL-------KKVV 212
            E    +   S+TI     ++ N+I+         D ++   ++  V L       K+ V
Sbjct: 207 AEKFDGQKMQSLTIINWLGERLNEIVVSDTAQWNSDQNIWDFFDGTVYLIDGNAAYKEAV 266

Query: 213 EYQYGRIPIDKN----STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNY 268
            +++ + P+ K     ++    P +M+ FQ           Y+ + + S   K+  F   
Sbjct: 267 TFKHQQFPLPKEAFEFASQGRSPYEMNLFQAVQ--------YKNLLQESGDTKNVRFFEV 318

Query: 269 RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMK 326
           R + +    I  P + +   ++ A++    ++  Q     + G+  G  F  Y +     
Sbjct: 319 RIQQK----IAFPFICLVFGVMGAAIG---AKPQQMSRGTSLGLTVGIVFAYYMVNFFTG 371

Query: 327 SFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           SFG  G+L P  AA +P    + +   IL + E
Sbjct: 372 SFGMIGLLSPSMAAWLPNFFGVGIGGWILKKLE 404


>gi|77361338|ref|YP_340913.1| hypothetical protein PSHAa2422 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876249|emb|CAI87471.1| putative membrane protein [Pseudoalteromonas haloplanktis TAC125]
          Length = 370

 Score = 43.9 bits (102), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 63/330 (19%), Positives = 136/330 (41%), Gaps = 36/330 (10%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPL 61
           +++RY     LK+ +   L  M +     L  I   +G+    SI    VL+  A ++P 
Sbjct: 2   LIFRYLTAEVLKSQVAVFLTLMTIFLSQKLVSI---LGDASEGSIPAKLVLSMIALKLPQ 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
           +   I+P    +  I+ +  +   SE+ + +A G+S W ++   ++ S+ L I    +  
Sbjct: 59  LASLILPLSIFLGIILAYSRIYADSEMTVLKACGVSEWYVVRVTLISSVGLAILAAALTM 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI-----GAKKI------- 169
            +A    +    L +Q K +          + Q  N +  +FI     G K++       
Sbjct: 119 HVAPWASEQEYQLKEQAKADAGLSALRAGRFQQTGNEKAVVFIHNIENGGKELNKVFVAQ 178

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLN 229
           LP++   ++   +   ++  +I  ++ +  ++ +D             R   D  +  LN
Sbjct: 179 LPDSEK-DNLARLVYAEQGVVIEAQNGEQQLVLSDG-----------KRYETDGLTPALN 226

Query: 230 IPIKMDGFQKFSEQFASRSFYEIIKKMSF--SNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
               +  F  +S Q   +      +K+    +N+    +   A  Q+ + I IPL +  +
Sbjct: 227 ----LTEFDGYSVQIREQEIEHQRRKLEAIPTNQLLALNTPEATAQWQWRIAIPLSIPLL 282

Query: 288 TLIAASVSLEFSRSNQ-PRIIVAYGIFSGF 316
           TL+A  +S+   R  +  +++ A  ++ G+
Sbjct: 283 TLLAVPLSVVNPRQGKFAKLVPAISLYLGY 312


>gi|312959169|ref|ZP_07773688.1| membrane protein [Pseudomonas fluorescens WH6]
 gi|311286939|gb|EFQ65501.1| membrane protein [Pseudomonas fluorescens WH6]
          Length = 359

 Score = 43.9 bits (102), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 72/324 (22%), Positives = 134/324 (41%), Gaps = 48/324 (14%)

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSILL 112
           P  + +++P   L+  ++   +L   SEL I RA G+SI    W ++ P    +V S+L+
Sbjct: 57  PRRLYEMMPMAALIGCLIGLGSLASNSELTIMRAAGVSIGRIVWAVMKPMLLLMVCSVLI 116

Query: 113 GIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
           G +    + P A +  +    L Q    +GD Q +    W +    Q D FI    + P 
Sbjct: 117 GEY----VAPPAEATAQANRALAQ---GSGDAQSAKHGLWHR----QGDEFIHINAVQPG 165

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT--LNI 230
             +    T    DK+  ++    A  A   N+K +L  +    +  +     ++T  +N+
Sbjct: 166 GLL-IGVTRYRFDKERHMLSSSFAKSAQYSNEKWQLTDITTTYFRNVGQGTQASTEVINV 224

Query: 231 PIKMDGFQKFSEQFASRSFYEIIKKMSFSN--------KSNIFHNYRAETQFYFLIVIPL 282
           P +  G     E     +   I + +  S         K    +N R    F+  ++ P+
Sbjct: 225 PSEEWGISLKPELL--NTVVMIPESLPISGLWSYIHYLKDQGLNNGRYWLAFWVKVLQPV 282

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKS--------FGKSGIL 334
           +  A+ L+A S      RS    + +   +F+G ++  I  I ++        FG S   
Sbjct: 283 VTAALVLMAISFVFGPLRS----VTLGQRVFTGVLVGFIFQIAQNLLGPLSLVFGFS--- 335

Query: 335 LPVAAALIPVILTISLSILILLQK 358
            P+ A L+P  +  +L+   LL++
Sbjct: 336 -PLFAVLVPTTIC-ALAGFWLLRR 357


>gi|302037952|ref|YP_003798274.1| putative YjgP/YjgQ family permease [Candidatus Nitrospira defluvii]
 gi|300606016|emb|CBK42349.1| putative Permease, YjgP/YjgQ family [Candidatus Nitrospira
           defluvii]
          Length = 363

 Score = 43.5 bits (101), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 72/377 (19%), Positives = 150/377 (39%), Gaps = 42/377 (11%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPL 61
           IL+RY  + Y+K       G M +  VID  E   ++     Y      VLA    ++P 
Sbjct: 3   ILFRYMLREYVKIFGMCFAGLMTIYLVIDFFE---KVRRFLRYDAHALDVLAYFVLKMPA 59

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
           I  QI P   L+  ++    L+R+ E+   R+ GIS++ + +PF    + LG  TVL + 
Sbjct: 60  ISYQIAPLAVLMATLLTIGLLSRSHEITAMRSCGISLYWITSPF----LFLG--TVLALV 113

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKIL------PENHI 175
             A S   I + L +  +    + +   +P + +   Q  + +G + ++      P   +
Sbjct: 114 LFAFSSTVIPLALAKAEQIKTTRIEKRAVP-VSVKAAQPWVSLGGQTLMNIDTIDPGGAV 172

Query: 176 WEDFTSITIDKKNKIIHRKDADLAI------IYNDKVKLK-------KVVEYQYGRIPID 222
                   +    ++    +A  A+      +  D ++          V  +Q   +P+ 
Sbjct: 173 LRKIRLYRLSPTFELEQIAEAQRAVYSPQGWVLEDGIRRSFRQDGTVSVNSFQTEPLPLA 232

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPL 282
           +        +++D     SE          + ++       I    R  T +Y  I  P 
Sbjct: 233 QIPDDFTTWLELD-----SETMTLPEIRAYVDRLHLGG--TILP--RLLTDYYGRIAFPC 283

Query: 283 MLVAMTLIAASVSLEFS--RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           +   M ++  ++SL  +  R +   + +   +  GF  ++  ++  + G+ G L P+ A 
Sbjct: 284 VTFIMVVVGIALSLRRTGVRGSGMAMGIGQAMAVGFFYWSTHSVAIALGRGGALAPMLAG 343

Query: 341 LIPVILTISLSILILLQ 357
            +  ++ ++    +LL+
Sbjct: 344 WMANLVFLTFGFYLLLK 360


>gi|148265754|ref|YP_001232460.1| permease YjgP/YjgQ family protein [Geobacter uraniireducens Rf4]
 gi|146399254|gb|ABQ27887.1| permease YjgP/YjgQ family protein [Geobacter uraniireducens Rf4]
          Length = 389

 Score = 43.5 bits (101), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 79/373 (21%), Positives = 151/373 (40%), Gaps = 53/373 (14%)

Query: 14  LKTTLY----------FLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATR----- 58
           +K TLY          FLLG     FV+    +  ++  L    +++G  LA        
Sbjct: 1   MKKTLYLYIFKEIPPPFLLGVATFTFVL----LMGRLLRLAEMVVTKGVPLADVLRMVFY 56

Query: 59  -VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP---FVVGSILLGI 114
            +P  +   IP   L+  ++ F  L+  SE+   +A G+S++ LL P   F + + L G 
Sbjct: 57  LLPSFLLVTIPMAFLLAILLAFGRLSGDSEITAMKASGVSLYGLLPPVFCFALIAYLAGA 116

Query: 115 FTVLVINPIA-TSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQI----SNPQQDIFIG-- 165
           F  +   P   TS +K+ +++++     G K+K  +D  P + I     N Q+    G  
Sbjct: 117 FITVYAVPWGNTSFKKLLVEVVEARASLGIKEKIFNDDFPGLVIYTDRYNQQKQTMSGIL 176

Query: 166 ---AKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPID 222
               +  L  + I+     I  D   K I  +  + +I         ++VE++   + I+
Sbjct: 177 IQDERDPLEPSTIYARSGVINSDPATKSIRLRLDNGSIHRTQGKTGYRLVEFRNYDLNIN 236

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSN-KSNIFHNYRAETQFYFLIVIP 281
            N             Q  ++     S  E+   ++     + +  + R E    F   +P
Sbjct: 237 LNQAA----------QTVNKNELDMSLAELRANLASGRFDAKMMRDMRLEYHRRF--SLP 284

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFML--YTIITIMKSFGKSGILLPVAA 339
              +   L+   + ++  RS +      + +  G +L  Y +++  K+ G+  +L P+ A
Sbjct: 285 FACLIFALVGMPLGIQNQRSGKA---AGFTMSIGLLLAYYIVLSAGKALGERELLSPLLA 341

Query: 340 ALIPVILTISLSI 352
              P +L +SL I
Sbjct: 342 VWAPNLLFVSLGI 354


>gi|28868484|ref|NP_791103.1| hypothetical protein PSPTO_1273 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213968382|ref|ZP_03396526.1| membrane protein [Pseudomonas syringae pv. tomato T1]
 gi|301384648|ref|ZP_07233066.1| hypothetical protein PsyrptM_18507 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058899|ref|ZP_07250440.1| hypothetical protein PsyrptK_02847 [Pseudomonas syringae pv. tomato
           K40]
 gi|302133012|ref|ZP_07259002.1| hypothetical protein PsyrptN_16559 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28851722|gb|AAO54798.1| membrane protein, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927020|gb|EEB60571.1| membrane protein [Pseudomonas syringae pv. tomato T1]
 gi|331015231|gb|EGH95287.1| hypothetical protein PLA106_04712 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 353

 Score = 43.5 bits (101), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 131/324 (40%), Gaps = 52/324 (16%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSIL 111
            P  +   +P   L+  ++    L  +SEL I RA G+SI    W ++ P    +V  +L
Sbjct: 56  APRRVYDTLPMAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWSVMKPMLLLMVAGVL 115

Query: 112 LGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP 171
           +G +    + P A +  +    L Q    +GD Q +    W +    Q D FI    + P
Sbjct: 116 VGEY----VAPYAENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP 164

Query: 172 ENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKV--VEYQYGRIPIDKNSTTLN 229
            N +    T    D +  ++    A  A    D  +LK V    ++ GR  +      +N
Sbjct: 165 -NGLMLGVTRYRFDDQRHMLTSSFAKEAHFKTDYWELKDVSTTHFKEGRTEV------VN 217

Query: 230 IPIKMDGFQKFSEQFASRSFYEII---KKMSFSNKSNIFH--------NYRAETQFYFLI 278
            P      +++    + +    +I   + +S S   +  H        N R    F+  +
Sbjct: 218 APD-----ERWDVSLSPQLLSTVIMPPESLSISGLWSYAHYLADQGLSNGRYWLAFWTKV 272

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFML-YTIITIMKSFGKSGILL-- 335
           + P + VA+ L+A S      RS    + +   +F+G ++ +T   I    G S +L   
Sbjct: 273 LQPAVTVALVLMAISFIFGPLRS----VTLGQRVFTGVVVGFTFRIIQDLLGPSSLLFGF 328

Query: 336 -PVAAALIPVILTISLSILILLQK 358
            P+ A LIP     + + L LL++
Sbjct: 329 PPLLAVLIPAA-ACAFAGLYLLRR 351


>gi|302342716|ref|YP_003807245.1| permease YjgP/YjgQ family protein [Desulfarculus baarsii DSM 2075]
 gi|301639329|gb|ADK84651.1| permease YjgP/YjgQ family protein [Desulfarculus baarsii DSM 2075]
          Length = 397

 Score = 43.5 bits (101), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 79/380 (20%), Positives = 149/380 (39%), Gaps = 55/380 (14%)

Query: 2   PGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT---- 57
           P I+ RY  +  +     F +   +  F++ + +I     EL +  +SRG  L       
Sbjct: 4   PRIIHRYLLREMIGP---FFISLGVFTFMLLIAKIM----ELTDLVVSRGVGLDVVGRLL 56

Query: 58  --RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
              +P      IP  TL+  ++ F  ++   E+V  +A G+S +  L P  V    L I 
Sbjct: 57  LYTLPYFFVFTIPMATLLGVLLAFLRMSGDMEVVALKAAGVSPYAFLPPVAV----LAIC 112

Query: 116 TVLVINPIATSG--------EKIGIDLIQQWKDNGDKQK--SDIIPWMQI---SNPQQ-- 160
             LV + +A  G        E +   + +   D   K++   D  P M I     P Q  
Sbjct: 113 AWLVTSALAFWGLPWGNHRFENLVFQVAKAQTDLALKERVFMDTFPGMVIYISRLPGQGQ 172

Query: 161 --DIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADL------AIIYNDKVKLKKVV 212
             D+FI  ++    +H         + K+ KI    +  L        I++    L+   
Sbjct: 173 MTDLFIVDEREKGRHHT-------IVAKRGKIFPANNDRLILRLYDGTIHSVGQNLRSAQ 225

Query: 213 EYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAET 272
              +    I  +++TL+        Q+ ++      F E++ +M      ++ H Y  E 
Sbjct: 226 TAAFVTYDIAVDASTLSA-----AHQRTTKHEKEMYFGELLAEMDKLPADSMQH-YLIEM 279

Query: 273 QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSG 332
           + +    +P   + M LI   + +         + +A  +F G+  Y +++   SFGK+G
Sbjct: 280 EMHKKFSVPFACLVMALIGLPLGMHSRGGRSWGVAIALVVFLGY--YLMLSAAWSFGKTG 337

Query: 333 ILLPVAAALIPVILTISLSI 352
              P+     P +L  +L++
Sbjct: 338 DYPPIVGMWAPNLLLGALAV 357


>gi|254460553|ref|ZP_05073969.1| permease YjgP/YjgQ family protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206677142|gb|EDZ41629.1| permease YjgP/YjgQ family protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 381

 Score = 43.5 bits (101), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 67/137 (48%), Gaps = 12/137 (8%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
           A  +P +I+ ++P      ++ V   L   SELV+ +A G S W+L  P V+   ++G F
Sbjct: 58  ALSLPNVIRMVLPMSAFAASVYVTNRLASESELVVMQATGYSPWRLARPVVMFGFIVGTF 117

Query: 116 -TVLVINPIATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
             VL    + +S E++      ++++N       S ++   +  NP + +    ++I PE
Sbjct: 118 MMVLTQYLVPSSLEQL------RFRENEITGSLSSQLLREGEFMNPTKGVTFYIREITPE 171

Query: 173 NHIWEDFTSITIDKKNK 189
             + + F S   D++N+
Sbjct: 172 GVLKDVFLS---DRRNE 185


>gi|261364966|ref|ZP_05977849.1| permease, YjgP/YjgQ family [Neisseria mucosa ATCC 25996]
 gi|288566764|gb|EFC88324.1| permease, YjgP/YjgQ family [Neisseria mucosa ATCC 25996]
          Length = 356

 Score = 43.5 bits (101), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 95/212 (44%), Gaps = 35/212 (16%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAA---TRVPLII 63
           RY  +      +Y LL  + L       EI N++G+L   S + GA +A     ++P   
Sbjct: 6   RYIIRQMAVMAVYALLAFLALY---SFFEIINEVGDLGKGSYN-GATMAQYVLMQMPARA 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   L+  +V    L   SEL + +A G+S  +LL       ++L  F ++     
Sbjct: 62  YELMPLAVLIGGLVSLSQLAAGSELTVIKASGMSTKKLL-------LVLSQFGLIFALAT 114

Query: 124 ATSGEKIGIDLIQQWKD------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN---- 173
           A  GE I   L Q+ ++      NG     +   W++    +++  I  +++LP++    
Sbjct: 115 AALGEWIAPVLSQKAENIKSTAINGKISTGNTGLWLK----EKNSIINVREMLPDHTLLG 170

Query: 174 -HIWEDFTSITIDKKNKIIHRKDADLAIIYND 204
             IWE       + KN++    +A+ A++ ND
Sbjct: 171 IKIWER------NDKNELTQATEAESAVLNND 196


>gi|301170458|emb|CBW30065.1| conserved inner membrane protein [Haemophilus influenzae 10810]
          Length = 358

 Score = 43.5 bits (101), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 149/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTIPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  +     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKEEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|86605800|ref|YP_474563.1| YjgP/YjgQ family protein [Synechococcus sp. JA-3-3Ab]
 gi|86554342|gb|ABC99300.1| putative membrane protein, YjgP/YjgQ family [Synechococcus sp.
           JA-3-3Ab]
          Length = 376

 Score = 43.5 bits (101), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 68/357 (19%), Positives = 146/357 (40%), Gaps = 30/357 (8%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQM--GELPNYSISRGAVLAATRVPL 61
           +L RY F   L   L  + G  +L+    L  +  ++  G +P  ++ R  +L    +P 
Sbjct: 10  LLERYLFGQMLTPVLAGIAGGTLLLLAGRLFTLAERLVEGSVPPLTVLRLLIL---DLPE 66

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
           ++   +P       ++    L+  SE+   RA GI   ++  P ++  +L+ +    + N
Sbjct: 67  MVLLGMPIAAFFATMLTLGKLSGNSEITAMRAAGIPFTRIFRPLLLVGLLMSLSAFWISN 126

Query: 122 PIATSGEKIGIDLIQQW---KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
            +  + ++    + QQ    +     Q        ++   + +++   +++ P  +  +D
Sbjct: 127 VLLPASKREIRQIDQQALLARATTPVQYDVFFRTARVGGTEDNLWFFIRQVDPRLNTMQD 186

Query: 179 FTSITIDK----KNKIIHRKDADLAIIYNDKVKLKKVVEYQYG-------RIPIDKNSTT 227
            T + +D     K ++     A  A+       L + V ++YG         P D+    
Sbjct: 187 VTILQVDPLPGGKYQLAEVTLAAQAVWNGLDWTLSEGVTHRYGPDGLSLAEEPFDRKP-- 244

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
           L +   +    +        S  E+ +++S   +SN+ +     T+F+    +PL     
Sbjct: 245 LEVSQDLAALMQPPVPPNELSLPELAERISRLARSNL-NTQPLRTEFHMRFSLPLA---- 299

Query: 288 TLIAASVSLEFSRSNQPRII----VAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           +  A  +SL    +   R+     V +GI   F  Y ++++ +S G++G L P AAA
Sbjct: 300 SFFAVLISLPLGSTTARRVGRYGGVVFGILLVFAYYVVLSVSRSLGEAGALPPWAAA 356


>gi|330938933|gb|EGH42432.1| permease YjgP/YjgQ [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 302

 Score = 43.1 bits (100), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 98/232 (42%), Gaps = 25/232 (10%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ +    ++M ++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSMFAFIDEMRDISDTYTLTDALSFVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLV---IN 121
              L+  ++    L  +SEL I RA G+SI    W ++ P     +LL I  VLV   + 
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPM----LLLMIAGVLVGEYVA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q    +GD Q +    W +    Q D FI    + P N +    T 
Sbjct: 122 PYAENQAQAARSLAQ---GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
              D +  ++    A  A    D  +LK V    +     D ++  +N P++
Sbjct: 174 YHFDDQRHMLTSSFAKEANFKTDYWELKDVTTTHFN----DGSTEVVNTPVE 221


>gi|253997572|ref|YP_003049636.1| permease [Methylotenera mobilis JLW8]
 gi|253984251|gb|ACT49109.1| permease YjgP/YjgQ family protein [Methylotenera mobilis JLW8]
          Length = 356

 Score = 43.1 bits (100), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 79/363 (21%), Positives = 147/363 (40%), Gaps = 44/363 (12%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           I+ RY FK      L   L  + +    DL +    +G   +Y +S+  +  A   P  +
Sbjct: 3   IITRYLFKEITVNVLLITLALIAMFSFFDLIQELESLGH-GSYGLSKILLFVALSAPGHV 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   LV  +     L R SEL++ R  GIS++ L    +   +L  + T L+   I
Sbjct: 62  YEVMPVAVLVGCMYSLGQLARYSELIVLRVSGISLYSLAATLIKIGMLFTVITFLIGELI 121

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HIWED 178
               EK+   +  +  D+   Q      W++  +     F+  +++L +      HI+E 
Sbjct: 122 TPLSEKMAQRIRIKATDSVIVQDFKSGLWVKDGHS----FVNVEEVLADTTLLNIHIYE- 176

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST-----------T 227
                 D K  +     A   +  +++  LK V +       +DK+S            +
Sbjct: 177 -----FDDKFNLRTVSHAHKGLYEDEQWHLKSVSQTH-----LDKDSNHVEHLDKATWRS 226

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
           L  P  ++      E+ ++ + Y  I  ++ +NK       R +   +  +V PL  + M
Sbjct: 227 LIRPELLNVLLVLPEKMSAWNLYAYIDHLA-ANKQK---TTRYKMALWAKLVYPLASLVM 282

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII-TIMKSFGKSGIL---LPVAAALIP 343
            ++A    L F+   Q     +  IF G ML  +  T+ ++F   G+L    P  +A+ P
Sbjct: 283 VILA----LPFAFIQQRATGASTKIFIGIMLGILYQTLNQTFVHLGLLNDWAPAFSAITP 338

Query: 344 VIL 346
             L
Sbjct: 339 TAL 341


>gi|228471152|ref|ZP_04055971.1| permease, YjgP/YjgQ family [Porphyromonas uenonis 60-3]
 gi|228307092|gb|EEK16166.1| permease, YjgP/YjgQ family [Porphyromonas uenonis 60-3]
          Length = 361

 Score = 43.1 bits (100), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 76/359 (21%), Positives = 152/359 (42%), Gaps = 25/359 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL---AATRVPLII 63
           RY F  +L T  YF    +IL   I   ++  ++  L    +   A++    A  VP   
Sbjct: 11  RYIFIQFLAT--YFFSIVLILAVAIAF-DVTEKLDRLLQPDVPLRAIIWDYYANFVPYYA 67

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
               P    +  I V   L   SE++   + G+S  +LL P+++G+ ++ I T L+ + +
Sbjct: 68  NLFSPLFVFIAVIYVTSRLAENSEIIAILSCGMSFRRLLKPYMLGAAVIAILTFLLSSFV 127

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
              G ++ ID   ++  +     ++ I  MQ++ P+  +F+       E+ +   F+   
Sbjct: 128 IPPGNRVRIDFQNRYIKDKRITYANAIQ-MQVA-PETFMFMSYYN--DESKVGYTFSMDR 183

Query: 184 IDKKNKIIHRKDADLAIIYND--KVKLKKVVEYQYGR---IPIDKNSTTLNIPIKMDGF- 237
            + K+ +  R  A+ +IIY+     +L+      +G         N     IPI    F 
Sbjct: 184 FEGKD-LKSRVMAN-SIIYDTLYNWQLQDYTITYFGERQDTLFRGNQLDTIIPITPRDFL 241

Query: 238 --QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +   E   +   Y  I++      +   +      +   + +IP   + +TL+  S+S
Sbjct: 242 VTEGDVEMLTTPELYHSIQQQRMRGAATQLYAIELHKR---IAMIPASFI-LTLMGVSLS 297

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
               R     + +A G+   F+    +T+  SF  +G + PV AA +P ++ + +S ++
Sbjct: 298 AR-KRKGGMGLALAVGLSLSFIYILFMTVTASFAVTGAMAPVVAAWLPNLVYLGISFVL 355


>gi|325578599|ref|ZP_08148699.1| YjgP/YjgQ family membrane protein [Haemophilus parainfluenzae ATCC
           33392]
 gi|301156461|emb|CBW15932.1| conserved inner membrane protein [Haemophilus parainfluenzae T3T1]
 gi|325159835|gb|EGC71965.1| YjgP/YjgQ family membrane protein [Haemophilus parainfluenzae ATCC
           33392]
          Length = 359

 Score = 43.1 bits (100), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 74/356 (20%), Positives = 145/356 (40%), Gaps = 29/356 (8%)

Query: 17  TLYFLLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVN 75
           TL+ L+G + I+ FV     +        +Y I +        +P  ++   P   L+  
Sbjct: 21  TLFTLVGLSAIIKFVEQFRSVGK-----GSYDIWQAVAYTGLTIPKDVETFFPMAALLGA 75

Query: 76  IVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLI 135
           ++   NL   SELV+ ++ G S +++    +  ++ L +FT+++        E+   D+ 
Sbjct: 76  LIALGNLASRSELVVMQSAGFSRFKIGLAVMKTALPLVLFTMIIGEWGIPQTEQFARDMR 135

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKD 195
            +    G         W +  N     F+  ++I  +  + ED    T D++  + H K 
Sbjct: 136 TRALSGGSMLSVKNGVWAKDGNN----FVYVRRITDDAQL-EDIYIYTFDEQRNLTHLKH 190

Query: 196 ADLA--IIYNDKVKLKKVVEYQYGRIPI------DKNSTTLNIPIKMDGFQKFSEQFASR 247
           A+ A     N++ +L++V      +  I       ++  T   P K+          +  
Sbjct: 191 ANQAQYSAENNQWQLRQVNNSAVSKEQITTTNRLTEDWATSLTPDKLGAVSLRPTSLSIS 250

Query: 248 SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRII 307
             YE I  +  + +     + R E  ++  I  PL +  M ++A S      RS      
Sbjct: 251 GLYEYIAFLKQTGQ----DSRRFELTYWRKIFQPLSVGVMMMLALSFIFGSLRSVTAGAR 306

Query: 308 VAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQKED 360
           +  GI  GF+ Y +  I   FG+  ++    A   AL+P +L +++   +L +K D
Sbjct: 307 IVTGICFGFLFYVVNEI---FGQMSVVFNAPAFLGALMPSLLFMAIIWWLLARKRD 359


>gi|255320990|ref|ZP_05362163.1| permease YjgP/YjgQ family protein [Acinetobacter radioresistens
           SK82]
 gi|262379920|ref|ZP_06073075.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255301954|gb|EET81198.1| permease YjgP/YjgQ family protein [Acinetobacter radioresistens
           SK82]
 gi|262298114|gb|EEY86028.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 356

 Score = 43.1 bits (100), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 6/110 (5%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQI 66
           K+  KTT   +LGA +++ ++ +  +   +GEL N    Y+  +  +      P  I +I
Sbjct: 9   KHVTKTTALAMLGATVVLSILQV--LFTYLGELGNLKEGYNAWQALLYVLWSAPRYIYEI 66

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
           +P   L+  ++    L   SEL+I RA GIS+W+++   +  ++LL I +
Sbjct: 67  LPISALIGAVLGLGTLASNSELIIMRAAGISLWRIVGWVMRSALLLVILS 116


>gi|253997950|ref|YP_003050013.1| permease [Methylovorus sp. SIP3-4]
 gi|253984629|gb|ACT49486.1| permease YjgP/YjgQ family protein [Methylovorus sp. SIP3-4]
          Length = 356

 Score = 43.1 bits (100), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 79/377 (20%), Positives = 152/377 (40%), Gaps = 46/377 (12%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           +L RY  +  + + +  ++  + +    DL +    +G+   Y +++  +      P  +
Sbjct: 3   LLNRYLTQEIVSSIMLIMVALLAMFSFFDLIQELESIGK-GTYGLNKVLMFVLLSAPGHV 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   LV  +     L+R SEL+I R  GISI  +    +   ++  + T  V   +
Sbjct: 62  YEVVPVAVLVGTMYALGQLSRHSELIILRVSGISIATIARSLLKVGLIFAVITFFVGEFV 121

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN-----HIWE- 177
               EK    L  Q  D+   Q      W++        F+  ++++P++     HI+E 
Sbjct: 122 TPYSEKTAQRLRIQATDSVVAQDFRSGLWVKDGRS----FVNVEEVMPDSELMNIHIYEF 177

Query: 178 ----------DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-GRIPIDKNST 226
                     D  +   D +N   H KD       +  VK +   + Q+   I  +  + 
Sbjct: 178 DDTFHLRTISDAKTGRFDGEN--WHLKDVQQTHFLDKTVKSEFFPQAQWQSLIRPELLNV 235

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L +P KM  +          + Y  I  +S +NK       R E   +  +V PL  + 
Sbjct: 236 LLVVPEKMSAW----------NLYFYIHHLS-ANKQK---TSRHEIALWSKMVYPLASLV 281

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIM-KSFGKSGIL---LPVAAALI 342
           M ++A    L F    Q     +  IF+G ML  +  ++ + F   G+L    P+ +A++
Sbjct: 282 MVVLA----LPFGFLQQRSGGASAKIFAGIMLGIVYQVLNRVFVHLGLLNDWSPLMSAVV 337

Query: 343 PVILTISLSILILLQKE 359
           P +L +   + +L   E
Sbjct: 338 PTLLFLLAGLTMLFMAE 354


>gi|121611823|ref|YP_999630.1| permease [Verminephrobacter eiseniae EF01-2]
 gi|121556463|gb|ABM60612.1| permease YjgP/YjgQ family protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 369

 Score = 43.1 bits (100), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 58/341 (17%), Positives = 126/341 (36%), Gaps = 44/341 (12%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y +S   +  A  +P  + +++P   L+  I V   L ++SE  I R  G+  W+ L  
Sbjct: 46  GYHLSHALLFVALGIPSHLYELLPITVLIGTIFVMARLAQSSEFTIMRTSGMGPWRALRT 105

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDN----------GDKQKSDIIPWMQ 154
            +     LG F VL+   +         D +  W D           G         W++
Sbjct: 106 LLT----LGGFFVLLTFAVG--------DYLAPWTDRTAQRIKAHALGGLTSGATGAWLK 153

Query: 155 ISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKV-KLKKVVE 213
               +    +  + + P   +  D      D + +++ +  A +     D   +L +V  
Sbjct: 154 ERQDRHSFAVNVRALTPNGGM-RDVRIFEFDDQGRLVTQTRATVGRFATDGAWELAQVRR 212

Query: 214 YQYGRIPIDKNST-------TLNIPIKMDGFQKFS-----EQFASRSFYEIIKKMSFSNK 261
            ++ R     ++         L  P ++      +     ++ A+   ++ I+ ++ + +
Sbjct: 213 SRFARGDGQDDARVEHLDAPALRWPTRISADMVAASLLKPDRMATLDLFQFIRHLNANGQ 272

Query: 262 SNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTI 321
           S      R   +F+  +  PL  + M ++A   +    RS      V  G+ +G   + +
Sbjct: 273 S----TQRYAIEFWRKLFYPLSCLVMVVLALPFAYLHLRSGGTAGYVFGGVMAGISFFLL 328

Query: 322 ITIMKSFGK----SGILLPVAAALIPVILTISLSILILLQK 358
             +    G     S  L   A  LI  +L+++    ++L++
Sbjct: 329 NNVFGYAGNLQNWSPWLTAAAPGLIYSLLSLAAFGWLVLRR 369


>gi|121997476|ref|YP_001002263.1| permease [Halorhodospira halophila SL1]
 gi|121588881|gb|ABM61461.1| permease YjgP/YjgQ family protein [Halorhodospira halophila SL1]
          Length = 350

 Score = 43.1 bits (100), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 55/303 (18%), Positives = 124/303 (40%), Gaps = 22/303 (7%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
            P +  +  PF TL+  ++    L    EL   RA G+S+ Q+    +VG ++L +    
Sbjct: 54  APALAYEAFPFATLIGALMGLGGLAARQELTAMRAAGVSVVQIAGAVLVGGVILALLATA 113

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           V   +    E+    +    + +  +   D   W +        F+ A++    +H+   
Sbjct: 114 VGELVVPPAERQAAAVRGLSEADELRTGPDGALWARDGRD----FLRAERPRSASHL--- 166

Query: 179 FTSITIDK--KNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDK---NSTTLNIPIK 233
             S+T+ +  + ++  R DAD A   + + +L+ VV+  Y    +++    +      + 
Sbjct: 167 -ESVTLYRFVEGQLTERIDADGAHYEDGQWRLEGVVKTVYADHRLERRELEAWAWQGALS 225

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHN-YRAETQFYFLIVIPLMLVAMTLIAA 292
            D         ++    E+   + + + + +    YR     +  +  PL  +AM L+  
Sbjct: 226 PDVLAVVVADPSTLPVPELWTYIQYLDANELDSGPYR--LALWEKVATPLATLAMLLVTI 283

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL---PVAAALIPVILTIS 349
            +     RS+     +  G+  G   +    + ++ G++G++    P  +AL+PV+   +
Sbjct: 284 PLVFTAVRSSGAGQRIVIGVLVGVAFF---LLNRALGQAGVVYGVPPSLSALLPVVAFAA 340

Query: 350 LSI 352
           L +
Sbjct: 341 LGL 343


>gi|212212730|ref|YP_002303666.1| hypothetical membrane spanning protein [Coxiella burnetii
           CbuG_Q212]
 gi|212011140|gb|ACJ18521.1| hypothetical membrane spanning protein [Coxiella burnetii
           CbuG_Q212]
          Length = 355

 Score = 43.1 bits (100), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 85/363 (23%), Positives = 145/363 (39%), Gaps = 60/363 (16%)

Query: 21  LLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVF 79
           LLG  M + F+  L++I +      +Y + +  +   T++P  + Q+ P    +  ++  
Sbjct: 23  LLGIEMFMEFIGQLSQIGS-----VHYGLGQAFLYVLTQLPSDLYQLFPMAGFLGCLIGL 77

Query: 80  FNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI---FTVLVINP-IATSGEKIGIDLI 135
             L  +SEL++ R  G+SI  +    V  ++L+ +   F   VI P +  SGE+  +  +
Sbjct: 78  GRLASSSELMVMRTAGVSIAGVTWAVVKAALLMMVVMTFIGEVIAPQLEASGEETKLTAL 137

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKI----- 190
              K  G K   D+  W+     Q  I IG                 ++D KNKI     
Sbjct: 138 S--KAVGYKALGDV--WLH--GAQSFIHIG-----------------SVDAKNKISEVSQ 174

Query: 191 --IHRKDADLAIIYNDKVKLKKV--VEYQYGRIPIDKNSTT--------LNIPIKMDGFQ 238
             I+ K   L+ +Y  K +  K   + Y   +     N TT        L I    D  Q
Sbjct: 175 FFINNKHQLLSAVYAPKGEYVKGHWILYNVKQTQFTPNRTTEKKIAKFPLTIVFNPDHLQ 234

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +  +    +S   +   + +  ++ +    R    F+   + PL  V M  I   V   F
Sbjct: 235 QGRKMVDRQSIVGLYHTIRYRQQAGL-QTSRYVFAFWQRFIQPLTTVVM--ICLGVPFIF 291

Query: 299 SRSNQP----RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
               Q     RI+   GI  GF  Y +      F     + P+ AAL+P +L  ++  +I
Sbjct: 292 GSLRQASMGWRILT--GIVIGFAFYMLNQFFGPFAMVYQIPPIFAALMPTVL-FAVGCVI 348

Query: 355 LLQ 357
           LL+
Sbjct: 349 LLR 351


>gi|330811513|ref|YP_004355975.1| permease [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
 gi|327379621|gb|AEA70971.1| Putative permease [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 353

 Score = 42.7 bits (99), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 73/354 (20%), Positives = 142/354 (40%), Gaps = 48/354 (13%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLN 83
           A +  F+ +++++ +       Y+++  A       P  +  ++P   L+  ++   +L 
Sbjct: 27  ATLFAFIDEMSDVSD------TYTLTDVASYVLLTAPRRLYDMLPMAALIGCLIGLGSLA 80

Query: 84  RTSELVISRAIGISI----WQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWK 139
             SEL I RA G+SI    W ++ P +V  +L+G+     I P   +  +    L Q   
Sbjct: 81  SNSELTIMRAAGVSIGRIVWAVMKPMLV-LMLVGVLIGEYIAPATENTAQANRSLAQ--- 136

Query: 140 DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLA 199
             GD Q +    W +    Q D FI    + P N I    T    D +  ++    A  A
Sbjct: 137 GGGDAQSAKHGLWHR----QGDEFIHINSVQP-NGILYGVTRYRFDDQRHMLSSSFAKRA 191

Query: 200 IIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEII---KKM 256
               D  +L  V    +     DK +  +  P      +++    + +    ++   + +
Sbjct: 192 NFAEDHWQLSDVTTTLFH----DKRTEVVAAPQ-----ERWDVSISPQLLSTVVMAPESL 242

Query: 257 SFSNKSNIFH--------NYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIV 308
           S +      H        N R    F+  ++ PL+  A+ L+A S      RS    + +
Sbjct: 243 SITGLWGYIHYLADQGLNNGRYWLAFWVKVLQPLVTAALVLMAISFIFGPLRS----VTL 298

Query: 309 AYGIFSGFML-YTIITIMKSFGKSGILL---PVAAALIPVILTISLSILILLQK 358
              +F+G ++ +T        G S ++    P+ A L+P  +  +L+ L LL++
Sbjct: 299 GQRVFTGVLVGFTFRIAQDLLGPSSLVFGFSPLFAVLVPAGIC-ALAGLWLLRR 351


>gi|145631589|ref|ZP_01787355.1| predicted permease [Haemophilus influenzae R3021]
 gi|144982789|gb|EDJ90315.1| predicted permease [Haemophilus influenzae R3021]
          Length = 358

 Score = 42.7 bits (99), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 79/362 (21%), Positives = 149/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTMPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELV+ ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVVMQSAGFSRFKIGMAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  +     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKDEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|260582801|ref|ZP_05850587.1| permease [Haemophilus influenzae NT127]
 gi|260094127|gb|EEW78029.1| permease [Haemophilus influenzae NT127]
          Length = 358

 Score = 42.7 bits (99), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 149/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTIPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  +     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTIMKDEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|309972901|gb|ADO96102.1| Lipopolysaccharide export permease, LptG [Haemophilus influenzae
           R2846]
          Length = 358

 Score = 42.7 bits (99), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 150/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTMPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +   +G         W +  +     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSSGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKDEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|257487385|ref|ZP_05641426.1| hypothetical protein PsyrptA_29198 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 205

 Score = 42.7 bits (99), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVIN 121
              L+  ++    L  +SEL I RA G+SI    W ++ P    +V  +L+G +    + 
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLLLMVAGVLVGEY----VA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q    +GD Q +    W    + Q D FI    + P N +    T 
Sbjct: 122 PYAENQAQAARSLAQ---GSGDAQSARHGLW----HRQGDEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKV 211
              D +  ++    A  A    D  +LK V
Sbjct: 174 YRFDDQRHMLTSSFAKEANFKTDYWELKDV 203


>gi|327398670|ref|YP_004339539.1| permease YjgP/YjgQ family protein [Hippea maritima DSM 10411]
 gi|327181299|gb|AEA33480.1| permease YjgP/YjgQ family protein [Hippea maritima DSM 10411]
          Length = 348

 Score = 42.7 bits (99), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 79/367 (21%), Positives = 169/367 (46%), Gaps = 53/367 (14%)

Query: 12  YYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPLIIQQIIPF 69
           ++LKT  +  L   +L+FV  L++  + + ++    +S   +++      P II   +PF
Sbjct: 11  FFLKT-FFISLAFFVLLFV--LSDFFSNLSDIVGNGVSIKYIISYYVYYTPFIIYFSLPF 67

Query: 70  ITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV----LVINPIAT 125
           I  + ++V    L+  +E+++ R+ G+SI+++  P +  SI++ +       L++N    
Sbjct: 68  IFALSSLVSLGYLSSKNEIIVMRSSGLSIFKIAKPVLFFSIIVAVLMFASKELIVN---- 123

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
                G++     K    K K   + W ++ N    +FI    +   N++  + T+  +D
Sbjct: 124 ----YGLEKASFVKHYYFKNKQFKLGWTKVGN----MFIKVNGLNVTNNMAYNVTAYRVD 175

Query: 186 KKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG--FQKFSEQ 243
           K     +R +   AII   +VK K        +  I  +  + N+P    G  F+ F  +
Sbjct: 176 KD---FNRVE---AIITAKRVKFKP-------KEIIFIDGCSFNMPNFSQGRCFKDFKIK 222

Query: 244 FASRSFYEIIKKMSF---SNKSNIF-HNYRAETQFYFLIVI-----PLMLVAMTLIAASV 294
             ++SFY +     F   S KS +F + +  +  +Y  ++I     P   + +TLI+   
Sbjct: 223 -TNKSFYSLFSSSKFKEPSIKSLVFSYKHSLDKDYYLSLIIHRFVYPFSCIILTLISFVF 281

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTI----ITIMKSFGKSGILLPVAAALIPVILTISL 350
            L   ++N  R      +FS  +++ +    + ++ S G+  ++ P  + +I ++  +S+
Sbjct: 282 VL---KTNPRRGGFVKNVFSSSLVFLVYIGSLELISSMGRYSMVDPNISIVIFILFWLSV 338

Query: 351 SILILLQ 357
           S+  LL+
Sbjct: 339 SVYNLLK 345


>gi|148827126|ref|YP_001291879.1| permease [Haemophilus influenzae PittGG]
 gi|148718368|gb|ABQ99495.1| predicted permease [Haemophilus influenzae PittGG]
          Length = 358

 Score = 42.7 bits (99), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 149/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTMPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  +     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKDEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|326388615|ref|ZP_08210208.1| permease YjgP/YjgQ [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206866|gb|EGD57690.1| permease YjgP/YjgQ [Novosphingobium nitrogenifigens DSM 19370]
          Length = 356

 Score = 42.7 bits (99), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 65/325 (20%), Positives = 129/325 (39%), Gaps = 44/325 (13%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           R P ++ + +P+  L+  I+    LN+ SE++  +A G+S  Q+L P  + S    +FT 
Sbjct: 54  RTPQLVSRFLPYSVLLATIITLMTLNQNSEVIAMKAAGLSAHQVLAPLFLVSAAASVFTF 113

Query: 118 -----LVINPIATSGEKIGIDLIQQWKD---NGDKQKSDIIPWMQISNPQQDIFIGAKKI 169
                +V+   AT         ++ W+D         SD+   + + +    +F    K 
Sbjct: 114 TFNERVVVRSTAT---------LKAWQDVDYGAVPTDSDVKSNVWLQDGPNIVF---AKT 161

Query: 170 LPENHIWEDFTSITIDKKN------KIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDK 223
           +         + ++  +++      +I+H   A LA   +   +      +      +  
Sbjct: 162 ISGRGTATRMSEVSWYRRDPTGVVTEIVH---APLATYTHPGWRFDHPTSFDVQSAAL-- 216

Query: 224 NSTTLNIP-IKMDGFQK----FSEQFASRSFYEIIKKMSFSNKSNIFHNYRA---ETQFY 275
             TTL  P +   G +       +  A R   E I ++S S        YR    + +++
Sbjct: 217 --TTLPGPKVYASGVEPTQIIIRKTDADR---ESITQLSQSIAEIQAAGYRTNELDGKWW 271

Query: 276 FLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL 335
             I  PL  V M L+ +  +   +RS +  +    G+  GF  + +     + G  G   
Sbjct: 272 HKISGPLSAVLMPLLGSVAAFGLARSGKLFVRAVIGMALGFAYFVVDNAALAMGNFGGYS 331

Query: 336 PVAAALIPVILTISLSILILLQKED 360
           P  AA  P +L + +   +L++ E+
Sbjct: 332 PFLAAWSPFLLFLLIGETVLIRTEE 356


>gi|254498610|ref|ZP_05111329.1| permease [Legionella drancourtii LLAP12]
 gi|254352150|gb|EET10966.1| permease [Legionella drancourtii LLAP12]
          Length = 354

 Score = 42.7 bits (99), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 81/179 (45%), Gaps = 27/179 (15%)

Query: 21  LLGAMILVFVIDLNEIQNQMGELP--NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVV 78
           L+G  IL ++ D      Q+G+L   +Y I++ A     ++P  +    P  +L+  ++ 
Sbjct: 23  LVGLQILFYLFD------QLGDLGKLDYGITQAAFFVLMQMPYQVYLFFPMASLLGCLIG 76

Query: 79  FFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQW 138
              +   SELV+ RA G+SI Q+    +  S+LL IF V V+      GE +   L    
Sbjct: 77  LGAMANHSELVVMRASGMSILQITGAVLKASVLL-IFLVTVL------GETVVPYLSHYA 129

Query: 139 KD-------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKI 190
            D        G   ++    W++  N     FI   +ILP N++ ++      D+++ +
Sbjct: 130 NDYKTASVSGGQTIRTAKGFWLRHGND----FISVGRILP-NNVLQNIYQFRFDEQHHL 183


>gi|206889444|ref|YP_002249741.1| putative permease, YjgP/YjgQ family [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741382|gb|ACI20439.1| putative permease, YjgP/YjgQ family [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 369

 Score = 42.7 bits (99), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 111/251 (44%), Gaps = 35/251 (13%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNE-IQNQMGELPN--YSISRGAVLAATRVP 60
           I+ + + K +++T L  L     L+ ++ L E I + M   P+  + I  G       +P
Sbjct: 5   IVCKSYIKDFVRTFLVLLFSMSCLLSIVGLIEKIDDFMPYKPSTTFFIEYGLY----SIP 60

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL-- 118
             I  +IPF+TLV ++ +F    R+ E +I    G  +  LL PF++  I++ I   +  
Sbjct: 61  RYIFYLIPFVTLVTSLFIFSIGVRSREFLILSVSGGRLRGLLKPFLILGIVISIVGFIFG 120

Query: 119 -VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAK-----KI--L 170
             + P  T      I+ + Q      K KS I         Q+++F+ AK     KI   
Sbjct: 121 EFLQPEFTKKLNFMIEELTQ------KGKSSI---------QKELFVRAKDGTVIKIGKF 165

Query: 171 PENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY--GRIP-IDKNSTT 227
            +     D   I I K + +I R D+  A I  D+ KLK  + Y +  G++   D     
Sbjct: 166 SQQQKKADEVKIFIIKNDALIKRIDSQEAEIEQDQWKLKNSIVYDFVAGKVEKYDLMDYP 225

Query: 228 LNIPIKMDGFQ 238
           LN+ I +  F+
Sbjct: 226 LNLKISIAAFK 236


>gi|237799874|ref|ZP_04588335.1| hypothetical protein POR16_13650 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331022729|gb|EGI02786.1| hypothetical protein POR16_13650 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 353

 Score = 42.7 bits (99), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 90/214 (42%), Gaps = 24/214 (11%)

Query: 26  ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNR 84
           I++ ++ L    ++MG++ + Y+++          P  +   +P   L+  ++   +L  
Sbjct: 22  IILGLVSLFAFIDEMGDINDTYTLADALSYVFMTAPRRVYDTLPMAALIGCLIGLGSLAS 81

Query: 85  TSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQ 137
           +SEL I RA G+SI    W ++ P    +V  +L+G +    + P A +  +    L Q 
Sbjct: 82  SSELTIMRAAGVSIGRIVWAVMKPMLFLMVAGVLVGEY----VAPYAENQAQAARSLAQ- 136

Query: 138 WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDAD 197
              +GD Q +    W +    Q D FI    + P N +    T    D +  ++    A 
Sbjct: 137 --GSGDAQSARHGLWHR----QGDEFIHINTVQP-NGLMLGVTRYRFDDQRHMLTSSFAK 189

Query: 198 LAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIP 231
            A    D  +LK V    +     + ++  +N P
Sbjct: 190 EAHFKTDYWELKDVSTTHFN----EGSTQVINTP 219


>gi|90021021|ref|YP_526848.1| SecD export membrane protein [Saccharophagus degradans 2-40]
 gi|89950621|gb|ABD80636.1| permease YjgP/YjgQ [Saccharophagus degradans 2-40]
          Length = 352

 Score = 42.4 bits (98), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 70/350 (20%), Positives = 147/350 (42%), Gaps = 35/350 (10%)

Query: 24  AMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQIIPFITLVVNIVVF 79
           A +L+ ++ L+ I + + +L N    Y+ S   +     +P      +P   LV  ++  
Sbjct: 17  ATVLLVILSLDAISDLVDQLSNLSGDYTFSEAIIFVLLYIPSSAYDYLPLSALVGCLIGL 76

Query: 80  FNLNRTSELVISRAIGIS----IWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLI 135
             L  +SELV+ RA G+S    +W ++ P  V    +G+  VLV   +A   ++      
Sbjct: 77  GVLASSSELVVMRAAGVSVLQLVWAVMRPVCV---FIGV-GVLVGEYVAPYSDQYADSRR 132

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKD 195
              K +    +++   W    N + + ++    +LP   ++   T    D+K +++    
Sbjct: 133 ALAKGHDRALQAERGVW----NREGNEYMHFNAVLPNGKLY-GITRYIFDEKGQLLEASF 187

Query: 196 ADLAIIYNDKVKLKK---VVEYQYGRIP----IDKNSTTLNIPIKMDGFQKFSEQFASRS 248
            D A IY  +   ++   V  ++ GRI       +   T   P  ++     +++   + 
Sbjct: 188 VDSA-IYQGEFWFEQDGEVTSFEDGRIEKFGFATREWRTEVSPDLLNVLVLDADELPMKR 246

Query: 249 FYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIV 308
            Y+     ++ +K  +  +   +  F+     PL + ++ +IA S  L   R       V
Sbjct: 247 LYDY---STYLDKQGL-DSSEYKLAFWHKAFQPLAVASLVMIAISFILGPLRQTTMGFRV 302

Query: 309 AYGIFSGFMLYTIITIMKSFGKSGILL---PVAAALIPVILTISLSILIL 355
             G+  G +     T  K  G + I++   P+ A LIP+++ + L + ++
Sbjct: 303 FIGVIVGLVFQ---TSQKMLGPASIIMGFSPMFAVLIPIVVCLVLGVFLI 349


>gi|145629200|ref|ZP_01784999.1| hypothetical protein CGSHi22121_10370 [Haemophilus influenzae
           22.1-21]
 gi|145639140|ref|ZP_01794747.1| hypothetical protein CGSHiII_03859 [Haemophilus influenzae PittII]
 gi|144978703|gb|EDJ88426.1| hypothetical protein CGSHi22121_10370 [Haemophilus influenzae
           22.1-21]
 gi|145271702|gb|EDK11612.1| hypothetical protein CGSHiII_03859 [Haemophilus influenzae PittII]
 gi|309750721|gb|ADO80705.1| Lipopolysaccharide export permease, LptG [Haemophilus influenzae
           R2866]
          Length = 358

 Score = 42.4 bits (98), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 152/366 (41%), Gaps = 26/366 (7%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTIPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMII------- 118

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISN----PQQDIFIGAKKILPENHIWEDFTSI 182
           GE  GI   +Q+  +   +       + I N         F+  +++  +  + +D    
Sbjct: 119 GE-WGIPQTEQFARDTRAKALSGGSILSIKNGVWAKDGHHFVFVRRVTDDTKL-DDIYIY 176

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGF 237
           T D+++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D  
Sbjct: 177 TFDQQHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKDEIITTNHLSETWETSLTPDKL 236

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
              S +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S    
Sbjct: 237 GAVSLRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFG 295

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILI 354
             RS      +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +
Sbjct: 296 SLRSVTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWL 352

Query: 355 LLQKED 360
           L +K D
Sbjct: 353 LSRKRD 358


>gi|221133511|ref|ZP_03559816.1| predicted permease [Glaciecola sp. HTCC2999]
          Length = 354

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 72/364 (19%), Positives = 147/364 (40%), Gaps = 41/364 (11%)

Query: 14  LKTTLYFLLGAMI-LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITL 72
           L +T++  L  ++ L  +I   E   ++GE  +Y +    +     +P  I+Q  P  TL
Sbjct: 13  LLSTIFVTLSTLVGLSALIKFVEQLRKVGE-GDYDLIVAGLFVFFSLPRDIEQFFPMATL 71

Query: 73  VVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGI 132
           +  ++    L   SEL++ +A G+S W ++   +  ++++    +LV   +    E    
Sbjct: 72  LGGLIGMGVLASNSELIVMQASGMSKWNIIQSAMKCAVVMVCIILLVGEFLTPVSEAKAK 131

Query: 133 DLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE----------DFTSI 182
            +  +    G    S+ I W +  +     F+    +  + ++ +          D T I
Sbjct: 132 QIRTEALSGGQVFTSNKIVWTKDGSD----FVSIGNVFNQENLGDVTIYKFNDDLDLTQI 187

Query: 183 TIDKKNKIIHR----KDADLAIIYNDKVKLKKV--VEYQYGRIPIDKNSTTLNIPIKMDG 236
              K+   +      +D  +  I + ++   ++   E++    P DK S     P     
Sbjct: 188 IAAKRATFVEESWALQDVHITYINDQRISTNRISLTEWRAALTP-DKLSVATVKP----- 241

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
                E  + +  YE +  +    ++N   + R E   +  I+ P+ +  M L+A S   
Sbjct: 242 -----EALSIQGLYEYVGYL----QNNQQDSTRYELAMWRKILQPVSVCVMLLMAFSFVF 292

Query: 297 EFSRSNQ--PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
              RS     RIIV  G  +GF  +    +   F     L P+  A++P  L   +++L+
Sbjct: 293 GSLRSTTMGSRIIV--GTLTGFSFFIANEVFGPFAMVYNLPPMLGAIVPSALFAGVAVLL 350

Query: 355 LLQK 358
           L ++
Sbjct: 351 LRRQ 354


>gi|225075101|ref|ZP_03718300.1| hypothetical protein NEIFLAOT_00100 [Neisseria flavescens
           NRL30031/H210]
 gi|224953585|gb|EEG34794.1| hypothetical protein NEIFLAOT_00100 [Neisseria flavescens
           NRL30031/H210]
          Length = 356

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 77/378 (20%), Positives = 156/378 (41%), Gaps = 54/378 (14%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELP--NYSISRGAVLAATRVPLIIQ 64
           RY  +      +Y LL  + L       EI N++G+L   +Y+ +  A     ++P    
Sbjct: 6   RYIIRQMAVMAVYALLAFLALY---SFFEIINEVGDLGKGSYNGTTMAQYVLMQMPARAY 62

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++P   L+  +V    L   SEL + +A G+S  ++L       ++L  F ++     A
Sbjct: 63  ELMPLAVLIGGLVSLSQLAAGSELTVIKASGMSTKKIL-------LILSQFGLIFAIATA 115

Query: 125 TSGEKIGIDLIQQWKD------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN----- 173
           T GE I   L Q+ ++      NG     +   W++    +++  I  +++LP++     
Sbjct: 116 TLGEWIAPVLSQKAENIKAAAINGKISTGNTGLWLK----EKNSIINVREMLPDHTLLGI 171

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKV-KLKKVVEYQYGRIPID-KNSTTLNIP 231
            IW        + KN++    +A+ A++ ND   +LK +         ++   +   N P
Sbjct: 172 KIWAR------NDKNELTQATEAESAVLNNDGSWQLKNIRRSTLSEDKVEVSTAAEENWP 225

Query: 232 IK-----MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL-----IVIP 281
           I      MD      +Q +       I  +  +N++         TQ Y +     +V P
Sbjct: 226 IAVKRNLMDVLLVKPDQMSVGELTTYISHLENNNQN---------TQIYAIAWWRKLVYP 276

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           +    M L+A + + + +R     + +  GI  G + +    +     +   +LP  A  
Sbjct: 277 VAAWVMALVAFAFTPQTTRHGNMGLKLFGGICLGLLFHFAGRLFGFTSQLYGVLPFLAGA 336

Query: 342 IPVILTISLSILILLQKE 359
           +P +L   L++ ++  +E
Sbjct: 337 LPTVLFALLAVYLIRCQE 354


>gi|99080790|ref|YP_612944.1| permease YjgP/YjgQ [Ruegeria sp. TM1040]
 gi|99037070|gb|ABF63682.1| permease YjgP/YjgQ [Ruegeria sp. TM1040]
          Length = 379

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 13/111 (11%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRG-AVLA-----ATRVP 60
           RY    YL   L+F   A+ILV V  +N   +    L ++ I  G +VLA     A  +P
Sbjct: 6   RYVLSQYL---LFFGFFALILVAVFWINRAVS----LFDWLIGDGQSVLAFLEISALSLP 58

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL 111
            +++ ++P       + V   LN  SEL + RA G S WQL  P +V  +L
Sbjct: 59  NLVRMVLPLAAFAATVWVTNRLNSESELTVLRATGSSPWQLARPAMVFGLL 109


>gi|109899861|ref|YP_663116.1| permease YjgP/YjgQ [Pseudoalteromonas atlantica T6c]
 gi|109702142|gb|ABG42062.1| permease YjgP/YjgQ [Pseudoalteromonas atlantica T6c]
          Length = 353

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 75/356 (21%), Positives = 145/356 (40%), Gaps = 19/356 (5%)

Query: 8   YFFKYYLKTTLYFLLGAMI-LVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           ++    L +T    LG ++ L  +I   E    +G   +Y ++  AV     +P  ++Q 
Sbjct: 7   WYIARTLLSTTAMSLGVLVGLSALIKFIEQMKSVGR-GSYDMTVAAVYVFLSLPRELEQF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P  TL+  ++    L   SELV+ ++ G S W ++   +  +IL+ +F +++   +A  
Sbjct: 66  FPMATLIGGLIGMGILASNSELVVMQSAGQSRWNIIISAMKSAILMVLFVMVIGEWVAPV 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E    ++  Q    G    SD + W +      D F+   +++ ++ +  D +    D 
Sbjct: 126 SETKAKEIRTQAISGGSLFSSDRLVWAK----DGDNFVSIGEVVDKDTL-RDVSIYEFDN 180

Query: 187 KNKIIHRKDADLAIIYNDKV-KLKKV--VEYQYGRIPI----DKNSTTLNIPIKMDGFQK 239
           +  +     A+ A  Y DK  +L  V   E+   RI +    D    +   P K+     
Sbjct: 181 ELYLRQITTAESA-TYQDKTWELSHVQSTEFSDNRIQVQDAADGAWASSLTPDKLGVVTV 239

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
             E  + R   + +  +   N S     YR     +  ++ P+ +  M L+A S      
Sbjct: 240 KPEALSIRGLIDYVNYL--ENNSQNSERYR--LALWRKVLQPISVGVMLLMALSFIFGPL 295

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           RS      V  G+ +GF  +    +  S      + P   A++P ++   +SI +L
Sbjct: 296 RSVTMGARVIMGVLTGFGFFVSNEVFGSLSTVYHIPPFIGAILPSVVFTGISIHLL 351


>gi|189500954|ref|YP_001960424.1| permease YjgP/YjgQ family protein [Chlorobium phaeobacteroides BS1]
 gi|189496395|gb|ACE04943.1| permease YjgP/YjgQ family protein [Chlorobium phaeobacteroides BS1]
          Length = 360

 Score = 42.0 bits (97), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 128/307 (41%), Gaps = 20/307 (6%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P  I    P  +L+ ++ +   L+ +SEL   +  G  + QLL PF+  ++L+  F +L
Sbjct: 57  IPETILLTSPISSLLASLYITGRLSGSSELTAMKTAGAGMHQLLKPFLAVALLVSFFNIL 116

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGA---KKILPENHI 175
               +      +      Q+ D   +  S       + +  + + IG+   +     N  
Sbjct: 117 NAGWLYPKAAALKNRFETQYFDKTFENISSSNNLHILESRNRILSIGSLDQQNNTGLNIS 176

Query: 176 WEDFTSITIDKK---NKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPI 232
            E F    I  +    KI + +  D  I++  + ++       Y    ++  + TL + +
Sbjct: 177 LETFEGPEIASRIDAKKISYDETLDRWILHETRTRVFSQNGMSY---TLNPGNDTLTLSL 233

Query: 233 KMDGFQKFS---EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
                +  S   ++      Y  I +   +  SN+    R   +F+  + +PL  V + L
Sbjct: 234 SATSLRDLSIQPDEMDIMQHYRYIDEKREAGFSNL---DRVIVKFHNKLALPLASVIVIL 290

Query: 290 IAASVSLEFSRSNQPRIIVAYGI--FSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
               +S   +R  +  + + +GI  F+GF+   +   + + G  G+L PV AA +P +L 
Sbjct: 291 TGVPLS---ARKKRSGLAIEFGISLFTGFIYLGLQRTLSTAGYRGLLDPVLAAWLPDLLF 347

Query: 348 ISLSILI 354
           +++ I I
Sbjct: 348 LAVGIAI 354


>gi|327398771|ref|YP_004339640.1| permease YjgP/YjgQ family protein [Hippea maritima DSM 10411]
 gi|327181400|gb|AEA33581.1| permease YjgP/YjgQ family protein [Hippea maritima DSM 10411]
          Length = 348

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 123/295 (41%), Gaps = 62/295 (21%)

Query: 59  VPLIIQQIIPF-ITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP---FVVGSILLGI 114
           V  ++  I+P  +T+ +N  V+ +L+  SE+   R+ GIS++++  P   F V   +   
Sbjct: 58  VVFLLAFIVPMALTIAIN-YVYSDLSNNSEITAIRSCGISLFRVYFPAFLFSVAVFVFLF 116

Query: 115 FTVLVINPIATSGEKIGI------DLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKK 168
           +++  + P A    ++ I       +    K N    K D + W++  +P +        
Sbjct: 117 YSIAFVAPKARLSYRVEIAKTFRNKVYAALKPNMFYDKVDGVMWIKNLSPDK-------- 168

Query: 169 ILPENHIWEDFTSITIDKKNKIIHRKDAD--------LAIIYNDKVKLKKVVEYQYGRIP 220
                H+ + F +    +K KI   K  D        LA  +N K+       ++YG   
Sbjct: 169 ----KHLKDVFFA----QKGKIFLAKKGDFKDIPSGILAEFFNVKMYSPSKSGFEYG--- 217

Query: 221 IDKNSTTLNIPIKMDGFQKFSEQF-ASRSFYEIIKK----MSFSNKSNIFHNYRAETQFY 275
                           F ++   F   R +++  K     MSF    N +   +++   Y
Sbjct: 218 ---------------SFDRYELAFLTGRGYFKPNKNNTRFMSFGEVVNYYSKSKSKDALY 262

Query: 276 F---LIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKS 327
               ++ + + + A++LIA S  + FSRS +   IVA  +F  FM Y I+ + +S
Sbjct: 263 RINKIVSMSMSVFALSLIAFSFGITFSRSGKSAGIVA-SLFLFFMFYIILMLSES 316


>gi|121594279|ref|YP_986175.1| permease [Acidovorax sp. JS42]
 gi|120606359|gb|ABM42099.1| permease YjgP/YjgQ family protein [Acidovorax sp. JS42]
          Length = 369

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 60/331 (18%), Positives = 131/331 (39%), Gaps = 24/331 (7%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y +S   +  A  +P ++ +++P   L+  I V   L ++SE  I R  G+  W+ L+ 
Sbjct: 46  GYQLSHALLFVALSLPQLLYELLPITVLIGTIFVMARLAQSSEFTIMRTSGLGPWRALST 105

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            ++      + TV+V + IA + EK    L++  +  G         W++       I +
Sbjct: 106 LLMLGCAFVMVTVIVGDYIAPASEK-AASLVKA-RRLGQISTGATGAWLKERQGDHSIAV 163

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII--YNDKVKLKKVVEYQY-----G 217
             + + P N           D + ++     A+ A      D   L++V    +     G
Sbjct: 164 NVRAVDP-NGAMRGVRVFEFDARGRVAATIQAEQATFDDARDAWNLQQVQRTLFEAEADG 222

Query: 218 RIPIDK-NSTTLNIPIKMDGFQKFS-----EQFASRSFYEIIKKMSFSNKSNIFHNYRAE 271
            + + +    TL  P ++      +     ++ A+   +  ++ +  + +S      R E
Sbjct: 223 GMRVSRLQEPTLRWPTRISPDMVAASLLKPDKMATIELFRFVRHLEANGQS----AQRYE 278

Query: 272 TQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGK- 330
            +F+  +  PL  + M +++   +    RS      V  G+ +G   + +  +    G  
Sbjct: 279 IEFWRKVFYPLSCLVMVVLSLPFAYLHFRSGGIAGYVFGGVMAGISFFLLNNVFGFAGNL 338

Query: 331 ---SGILLPVAAALIPVILTISLSILILLQK 358
              S  L   A  LI  +L+++    ++L++
Sbjct: 339 QNWSPWLTAAAPGLIYSVLSLAAFGWLVLRR 369


>gi|322834555|ref|YP_004214582.1| permease YjgP/YjgQ family protein [Rahnella sp. Y9602]
 gi|321169756|gb|ADW75455.1| permease YjgP/YjgQ family protein [Rahnella sp. Y9602]
          Length = 356

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 80/369 (21%), Positives = 149/369 (40%), Gaps = 23/369 (6%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +    T +  L   + L  +I   +   ++G+   YS +   +     VP
Sbjct: 1   MFGVLDRYIGRTIFNTIMMTLFMLVSLSGIIKFVDQLRKVGQ-GGYSAAGAGLYTLLSVP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ + 
Sbjct: 60  KDIEIFFPMAALLGALLGLGTLATRSELVVMQASGFTRMQIAASVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE++  +   Q    G    +    W +  +     FI  +++  E    ++ T
Sbjct: 120 EWVAPQGEQMARNYRAQQMYGGSLLSTQNGVWAKDGHD----FIYIERVAGE----KELT 171

Query: 181 SITI---DKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY-GRIPIDKNSTTLNI------ 230
            + I   +++NK+   + A  A   N + KL +V E     ++ I  + T   +      
Sbjct: 172 GVNIYHFNEENKLQSVRYASSATFDNGEWKLSQVDESDLTDQLQITGSQTLTGVWKTNLT 231

Query: 231 PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
           P K+       +  +    +  +K +  S +       R +   +  I  PL +  M L+
Sbjct: 232 PDKLGVVALDPDALSISGLHNYVKYLKQSGQ----EAKRYQLNMWSKIFSPLSVAVMMLM 287

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISL 350
           A S      RS    + V  GI  GF+ Y +  I         + P+  AL+P  L   +
Sbjct: 288 ALSFIFGPLRSVPMGVRVVTGICFGFLFYVLDQIFGPLSLVYSIPPILGALLPSGLFFVI 347

Query: 351 SILILLQKE 359
           S+ +LL+K 
Sbjct: 348 SMFLLLKKR 356


>gi|88800548|ref|ZP_01116110.1| predicted Permease [Reinekea sp. MED297]
 gi|88776693|gb|EAR07906.1| predicted Permease [Reinekea sp. MED297]
          Length = 350

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 65/132 (49%), Gaps = 5/132 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGA--VLAATRVPLI 62
           L+RY +   +K    F+   ++L+ ++   EI + + ++     S  A  V+   +VP++
Sbjct: 3   LYRYLYGQIMKP---FVFMTLVLLILLIATEISDTLTKILTGQFSDNALWVVIGFQVPIL 59

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +Q+I+P    +  +     L++ SE  I  AIGIS   LL   +V + L  +  VL +N 
Sbjct: 60  LQEILPAAFFLACLTTLHRLSQDSERAILHAIGISDGDLLRFLLVFAALPAMLLVLALNH 119

Query: 123 IATSGEKIGIDL 134
             T   +  ++L
Sbjct: 120 YITPKAQENLEL 131


>gi|331007486|ref|ZP_08330657.1| putative permease [gamma proteobacterium IMCC1989]
 gi|330418710|gb|EGG93205.1| putative permease [gamma proteobacterium IMCC1989]
          Length = 362

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 70/346 (20%), Positives = 145/346 (41%), Gaps = 39/346 (11%)

Query: 33  LNEIQNQMGEL-PNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVIS 91
           L ++ +++G L P Y+ +   +     +P    Q +PF  LV  +V   +L  TSELV+ 
Sbjct: 29  LAKLIDELGNLTPAYTFAEALIYVVLAIPSSFYQYMPFAGLVGGLVGLGSLASTSELVVM 88

Query: 92  RAIGISI----WQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKS 147
           RA G+S+    W +L P +     + +F   VI P++    +     + Q  +     K 
Sbjct: 89  RAAGVSLLRLTWAVLKPVLWFIAAMLVFAEYVI-PVSDQYAESRRSALLQGGNTALSAKG 147

Query: 148 DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK 207
            +  W    N +  +F+    +     +    T    D K ++     A+ A+   D  +
Sbjct: 148 GV--W----NREGTLFMHFNSVQANGKLL-GVTRYQYDDKQRLTLASFAETALYTADGWR 200

Query: 208 LKKVVEYQY--GRIPIDKNS--TTLNIPIK----------MDGFQKFSEQFASRSFYEII 253
            + VVE ++   +   DK +  TT   P +          +    + ++  A    Y+  
Sbjct: 201 EENVVETRFLDAQSSSDKEALITTATYPSRPWQTELSPNLLTILVQDTDNLAITKLYDYA 260

Query: 254 KKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIF 313
           + +   N      N +    ++  ++ PL+++++ L+A S    F       + + Y IF
Sbjct: 261 QYLEKQN----LDNGKYLLAYWGKVLQPLVIISLVLVAIS----FIFGPLREVTMGYRIF 312

Query: 314 SGFMLYTIITI-MKSFGKSGILL---PVAAALIPVILTISLSILIL 355
           +G ++  +  +  K  G + +L    P+ A L+P++    + + +L
Sbjct: 313 TGVVVGIVFQLTQKLLGPASLLYGISPLFAVLLPILFCFGVGLFLL 358


>gi|260221416|emb|CBA29957.1| hypothetical protein Csp_A14750 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 384

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/186 (20%), Positives = 75/186 (40%), Gaps = 5/186 (2%)

Query: 22  LGAMILVFVIDLNEIQNQMGELPN--YSISRGAVLAATRVPLIIQQIIPFITLVVNIVVF 79
           LG M L F  D+ E    +  + +  Y + +  +  A  +P  + ++ P   L+  I V 
Sbjct: 37  LGFMALFFFFDVVEELQSVSRIASSGYQVPQALIYVALMIPAHVYELFPITVLIGTIFVM 96

Query: 80  FNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWK 139
             L R+SE  I R  G+  W+ L   +   +   +FT  V + +A   +K    L  +++
Sbjct: 97  ARLARSSEFTILRTSGLGPWRALRTLLALGLGFVLFTFAVGDYVAPLADKTAQLLKSRFQ 156

Query: 140 DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLA 199
                 K+      + +     + +GA   L  +   +D      D + K++   +A   
Sbjct: 157 GKISVGKTGAWLKERQAYGSYSVNVGA---LSSDATLKDVRVYEFDNQGKVVSLTEAKAG 213

Query: 200 IIYNDK 205
              +D+
Sbjct: 214 TFGDDE 219


>gi|126658379|ref|ZP_01729528.1| hypothetical protein CY0110_27505 [Cyanothece sp. CCY0110]
 gi|126620311|gb|EAZ91031.1| hypothetical protein CY0110_27505 [Cyanothece sp. CCY0110]
          Length = 394

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 61/326 (18%), Positives = 140/326 (42%), Gaps = 38/326 (11%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P  +    P   L+  ++ +  L+  SE++  R++G+S+++L+ P ++  +++     
Sbjct: 76  KMPGFVSLAFPMAMLLAALMAYSRLSSDSEIIALRSLGVSVYRLIIPVILFGLVVTGCAF 135

Query: 118 LV---INPIATSGEKIGIDLIQQWKDNGDKQKSDIIP---WMQISNPQQDIFIGAKKILP 171
           +V   I P AT    + +      +    K+++ + P    +Q  + QQ   +  +    
Sbjct: 136 IVNDWIAPAATHEAALTLQRAVNQERPDFKERNIVYPEYKTIQEEDGQQATVL-TRLFYA 194

Query: 172 ENHIWEDFTSITI-----DKKNKIIHRKDADLAI------IYNDKVKL-------KKVVE 213
           E +  +    +TI     +  N+I+  + A   I       +N  + L       + +V 
Sbjct: 195 EEYNGDKMKGLTILDRTQEGVNQIVTSESATWNISSNTWDFFNGTIYLIAPDGSYRNIVR 254

Query: 214 YQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQ 273
           +Q+ ++ + +    L      +  Q F+E   +++  E +K M  S         +   Q
Sbjct: 255 FQHQQLALPRAPLDL-----ANRRQNFTEMTIAQT-KEYLKAMQLSGDEKRVRKVKVRLQ 308

Query: 274 FYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKSFGKS 331
             +   +P + +   ++ A++ +    +N+     ++G+  G  F  Y +  +  S G  
Sbjct: 309 EKY--AMPFVCLIFGVVGAAIGVRPQNTNKA---TSFGVCVGLIFGYYLLAFMSTSLGIW 363

Query: 332 GILLPVAAALIPVILTISLSILILLQ 357
           GIL P   A +P IL ++   L+L+Q
Sbjct: 364 GILTPFLGAWLPNILGLTAGSLLLIQ 389


>gi|87302818|ref|ZP_01085629.1| possible permease [Synechococcus sp. WH 5701]
 gi|87282701|gb|EAQ74659.1| possible permease [Synechococcus sp. WH 5701]
          Length = 401

 Score = 42.0 bits (97), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 63/313 (20%), Positives = 126/313 (40%), Gaps = 36/313 (11%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           R+P  +    P  TL+  ++ +  L+  SEL+  R++G+S W+++ P ++ ++L+ + T 
Sbjct: 83  RMPGFLVLSFPMATLMATLLAYSTLSSNSELIALRSVGVSTWRMVLPALIVAVLMSLLTF 142

Query: 118 LVINPIATSGEKIGIDLIQQ--WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHI 175
           +  + I  S      + + Q   K    ++ S+II       P +    G+++ L +   
Sbjct: 143 VFNDLIVPSANLEATNTLNQALGKAIAAEKGSNIIYSRFSRRPSKLDESGSERYLSQLFY 202

Query: 176 WEDFTSITIDKKNKIIHRKDADLAII------YNDKVKLKKVVEYQYGRIPIDKNSTTLN 229
              F    +++   +   + +   I+      +ND+  +    E++ G+I +  +S T  
Sbjct: 203 SRQFKDGEMEEVTVLDFSRPSGTQILKAKTGTWNDEAGM---WEFRDGQIVLVGDSETTT 259

Query: 230 I-------------PIKMDGFQKFSEQFASRSFYEIIK-----KMSFSNKSNIFHNYRAE 271
                         P+K+    K     AS S  E ++     + +   K       R +
Sbjct: 260 SAKFDRYLYPLDQGPLKLAALPK---DAASMSVSEALRAETLLREAGDQKEARRLRVRIQ 316

Query: 272 TQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKS 331
            +F F    P + +   LI +S+ +  +            +   F  Y +  I  S G  
Sbjct: 317 EKFAF----PAICLVFGLIGSSLGVRPNARTSRSQGFGISVLLIFSYYLMSFIFSSLGVK 372

Query: 332 GILLPVAAALIPV 344
           G L PV AA  PV
Sbjct: 373 GTLGPVLAAWSPV 385


>gi|16273590|ref|NP_439845.1| hypothetical protein HI1703 [Haemophilus influenzae Rd KW20]
 gi|260581044|ref|ZP_05848866.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|1176473|sp|P45332|LPTG_HAEIN RecName: Full=Lipopolysaccharide export system permease protein
           lptG
 gi|1574557|gb|AAC23349.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092284|gb|EEW76225.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
          Length = 358

 Score = 42.0 bits (97), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 152/366 (41%), Gaps = 26/366 (7%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTIPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMII------- 118

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISN----PQQDIFIGAKKILPENHIWEDFTSI 182
           GE  GI   +Q+  +   +       + I N         F+  +++  +  + +D    
Sbjct: 119 GE-WGIPQTEQFARDTRAKALSGGSILSIKNGVWAKDGHHFVFVRRVTDDTKL-DDIYIY 176

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGF 237
           T D+++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D  
Sbjct: 177 TFDQQHNLIKLKHANQASYSEDEAKWTLRQVNHSTIMKDEIITTNHLSETWETSLTPDKL 236

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
              S +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S    
Sbjct: 237 GAVSLRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFG 295

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILI 354
             RS      +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +
Sbjct: 296 SLRSVTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWL 352

Query: 355 LLQKED 360
           L +K D
Sbjct: 353 LSRKRD 358


>gi|119899192|ref|YP_934405.1| integral membrane protein [Azoarcus sp. BH72]
 gi|119671605|emb|CAL95518.1| probable integral membrane protein [Azoarcus sp. BH72]
          Length = 358

 Score = 42.0 bits (97), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 9/141 (6%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVID-LNEIQNQMGELPNYSISRGAVLAATRV 59
           M  IL RY  K     T   L+  + L    D +NE+ + +G+   Y + +  +  A  V
Sbjct: 1   MSKILSRYLAKEIFGATATVLVAFLGLFAFFDFINEL-DSVGK-DGYQLYQAVIYVAMIV 58

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPF-VVGSILLGIFTVL 118
           P  + +++P   L+ ++     L R SE+ + RA G+S W++L    ++GS+ + + T +
Sbjct: 59  PGRVYELLPIAVLIGSLYALTTLARHSEITVMRASGLSTWRMLRILGLIGSVFV-VLTFV 117

Query: 119 VINPIATSGEKIGIDLIQQWK 139
               IA   E       QQW+
Sbjct: 118 FGEYIAPPAESAA----QQWR 134


>gi|170718033|ref|YP_001785073.1| permease YjgP/YjgQ family protein [Haemophilus somnus 2336]
 gi|168826162|gb|ACA31533.1| permease YjgP/YjgQ family protein [Haemophilus somnus 2336]
          Length = 356

 Score = 41.6 bits (96), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 88/370 (23%), Positives = 148/370 (40%), Gaps = 24/370 (6%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M   L RY  K  L T L  LL  + L  +I   E    +G+   Y + +  +     +P
Sbjct: 1   MMNTLDRYIGKNILGTILATLLMLVGLSAIIKFVEQFRSIGK-GTYDVIQATLFTLLTMP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+ +++   NL   SEL++ ++ G S +++    +  ++ L + T+++ 
Sbjct: 60  KDIETFFPMAALLGSLIALGNLASRSELIVIQSAGFSRFRIGLAVMKTALPLMLITMIIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
                  E    D+  +    G         W +  N     FI   +I  +  +  D  
Sbjct: 120 EWGIPQTEHFARDMRAKAISGGSMLSVKNSIWAKDGND----FIYVGRITNDISL-NDIY 174

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPI-------DKNSTTLNIPIK 233
             + D K ++     A+ A   + K KL  + + Q     I       D  STTL  P K
Sbjct: 175 IYSFDDKRQLKQVTHANQASFEHGKWKLSGINQSQIFADEIKTINRLKDNWSTTLT-PDK 233

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
           +          +    Y  IK M  + +       R E  F+  +  P+ +  M L+A S
Sbjct: 234 LGIASLRPTSLSMTGLYNYIKFMKETGQDA----KRFELTFWQKVFQPVSVAVMMLLALS 289

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGIL--LP-VAAALIPVILTISL 350
                 RS      +  GIF GF+ Y I  I+   G+  +L  +P V AALIP +L + L
Sbjct: 290 FIFGSLRSVTAGARIVTGIFFGFLFYVINEIL---GRLSLLYDIPIVLAALIPSLLFMIL 346

Query: 351 SILILLQKED 360
              +L +K +
Sbjct: 347 IWWLLNRKRE 356


>gi|290473525|ref|YP_003466395.1| putative transmembrane protein, transport [Xenorhabdus bovienii
           SS-2004]
 gi|289172828|emb|CBJ79599.1| putative transmembrane protein, transport [Xenorhabdus bovienii
           SS-2004]
          Length = 358

 Score = 41.6 bits (96), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 79/330 (23%), Positives = 131/330 (39%), Gaps = 19/330 (5%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L+T L  L   + L  +I   +   ++G+   YS     +     VP
Sbjct: 1   MFGVLDRYIGRTILQTILMTLFTLVSLSGIIKFVDQLRKVGQ-GEYSAFAAGIYTLLSVP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             IQ   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L   T+++ 
Sbjct: 60  KDIQIFFPMAALLGGLLGLGALATRSELVVMQASGFTRLQVAGSVMKTAIPLVFLTMVIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE+I  +   Q    G    +    W +  N     F+  K +  +N +  D +
Sbjct: 120 EWVAPQGEQIARNYRSQKMFGGSLMSTAKGMWAKDGND----FVYIKSVDKDNAL-RDVS 174

Query: 181 SITIDKKNKIIHRKDADLAII--YNDKVKLKKVVE---YQYGRIP----IDKNSTTLNIP 231
               D   K++  K A  A+    N + KL +V E    Q GRI     I     +L  P
Sbjct: 175 IYHFDDNKKLLSVKYAATAVYDQNNRQWKLSQVEESDLRQIGRITGSQRISAEWKSLLTP 234

Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
            K+       +  + R   + I  +    K       R +   +  +  PL +  M L+A
Sbjct: 235 EKLGVVALDPDALSIRGLQQYITYL----KQGQQDAGRYQLNMWKKVFAPLSVAVMMLMA 290

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTI 321
            S      RS    + V  GI +GF+ Y +
Sbjct: 291 LSFIFGPLRSVAMGVRVIAGISTGFIFYVL 320


>gi|91788271|ref|YP_549223.1| permease YjgP/YjgQ [Polaromonas sp. JS666]
 gi|91697496|gb|ABE44325.1| permease YjgP/YjgQ [Polaromonas sp. JS666]
          Length = 381

 Score = 41.6 bits (96), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 58/327 (17%), Positives = 121/327 (37%), Gaps = 27/327 (8%)

Query: 46  YSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPF 105
           Y I    +  A  +P  + +++P   L+  I V   L ++SE  I R  G+  W+ L   
Sbjct: 52  YQIRHALLYVALLIPNHLYELLPISVLIGTIFVMARLAQSSEYTILRTSGLGPWRALRLL 111

Query: 106 VVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIG 165
           +V        +  V + +A + E+    L  +++      ++    W++   P     + 
Sbjct: 112 LVLGAAFVTLSFAVGDYVAPTSERAAQLLKARYQSKITVGQTG--AWLKEKQPYNSYVVN 169

Query: 166 AKKILPENHIWEDFTSITIDKKNKIIHRKDADLA-IIYNDKVKLKKV--VEYQYGRIPID 222
            K++ P N + +       D K  I+    A +A     D   LK+    E+     P D
Sbjct: 170 VKELTPNNEM-KGVQIFEFDNKGLIVSTTQAPVAQFTGGDAWMLKQASRAEFDVPASPAD 228

Query: 223 KNSTTLNIPIKMDGFQKFS-----------------EQFASRSFYEIIKKMSFSNKSNIF 265
            +       +     Q F                  E+ ++   +  ++ ++ + ++   
Sbjct: 229 ISKPQNGARVSRTTLQTFRWPTEISAEMVSVALLKPERMSTLDLFNYVRHLNANGQT--- 285

Query: 266 HNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIM 325
              R E +F+  +  PL  + M ++A   +    RS      V  G+  G   + +  + 
Sbjct: 286 -AQRYEIEFWKKVFYPLSCLVMVMLALPFAYLHFRSGGIASYVFAGVMIGISFFLLNNVF 344

Query: 326 KSFGKSGILLPVAAALIPVILTISLSI 352
              G      P  AA  P ++ +++S+
Sbjct: 345 GYIGNLRNWQPWLAAATPGLMYMAVSL 371


>gi|71277954|ref|YP_267493.1| putative permease [Colwellia psychrerythraea 34H]
 gi|71143694|gb|AAZ24167.1| putative permease [Colwellia psychrerythraea 34H]
          Length = 355

 Score = 41.6 bits (96), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 71/337 (21%), Positives = 137/337 (40%), Gaps = 63/337 (18%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
           NY ++  A+     VP  ++   P   L+  ++    L   SEL++ +A G+S   ++  
Sbjct: 43  NYDLAHAALYVLYAVPRDVEVFFPMSALIGGLIGIGMLASNSELIVMQAAGLSRLDIIKS 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQ--------------WKDNGDK--QKSD 148
            +  ++LL I ++ +   +A SGE    ++  Q              W  +GD      +
Sbjct: 103 VMKTAVLLIIVSMAIGEWLAPSGEAKAREIRAQAISGGSLIAAKNGVWAKDGDYFVNIGE 162

Query: 149 IIPWMQISNPQ---------QDIFIGAKKILPENHIW-----EDFTSITIDKKNKIIHRK 194
           ++   Q+   Q          D ++ AK  + ++  W     E+F S+T   +N+II + 
Sbjct: 163 VLDRGQLKKVQIYGFNDELKIDSWLSAKSAIYQDKSWLLTDVEEF-SLT---ENEIITKS 218

Query: 195 DADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIK 254
            +    I+N  +  KK+     G + +   S +L   I    + + +EQ  SR       
Sbjct: 219 HSQK--IWNSSLTPKKL-----GVVTVTPESLSLRGLIDYLDYLEANEQDPSR------Y 265

Query: 255 KMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFS 314
           K++F  K                I+ PL +  M L+A S      RS      +  G+F+
Sbjct: 266 KLAFWRK----------------IMQPLTVAVMLLVALSFIFGPLRSVSMGARIMMGVFT 309

Query: 315 GFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLS 351
           G + +    ++ S      L P+  A+IP +  + ++
Sbjct: 310 GILFFISNEVLGSLSLVYQLPPILGAMIPSLFFVGIA 346


>gi|330994315|ref|ZP_08318243.1| Lipopolysaccharide export system permease protein lptG
           [Gluconacetobacter sp. SXCC-1]
 gi|329758782|gb|EGG75298.1| Lipopolysaccharide export system permease protein lptG
           [Gluconacetobacter sp. SXCC-1]
          Length = 369

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 72/356 (20%), Positives = 149/356 (41%), Gaps = 35/356 (9%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQQIIPFITLVVNIVVFFN 81
           A+I+V ++++  +  Q+ E+ +  +    VL  A  R+PL+    +P   L+  ++    
Sbjct: 29  AVIVVSLMEILSLLEQVTEIMHRHLGLTGVLYYAVMRLPLLFCNAMPIAVLIGALLALVQ 88

Query: 82  LNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDN 141
           +  ++E+ I RA G+S   L+  F+  +I LGI   LV + +    E+    L Q W   
Sbjct: 89  MTTSNEIAIMRAAGLSTPGLIKLFLPTTIALGILCGLVNDQVTPRTEQ---ALAQWWNVT 145

Query: 142 GDKQKSDIIP-WMQISNPQQDI-FIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLA 199
                ++    W++  N    I F+G+        +  D T    D+++ +      D A
Sbjct: 146 TPGAIAEAHNYWVRSGNDLISIHFLGSGA-----SVLGDVTVYHRDRQSLLQKVTTLDTA 200

Query: 200 II-----YNDKVKLKKVVEYQYGRIPIDKNSTTLNIP----IKMDGFQKFSEQFASR--- 247
                  Y    ++  V+     RI +      L++P    I++D     +  + ++   
Sbjct: 201 RYVHGHWYGTPTRMLSVISPT--RIDL------LDVPPGQSIRLDWPDTLTPGYITQLTI 252

Query: 248 SFYEIIKKMSFSNKSNIFHNYRAE---TQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQP 304
           SF + I  M       +  +       T+    I++PL    M L+A  V     R+   
Sbjct: 253 SFTQSISTMLDEEAGRLPSSQSPSFFLTEILGRIMLPLTFTVMLLLAVPVVYIPPRAGIR 312

Query: 305 RIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
             +  + + +G +      ++++ G +G L  + A  + +++ I   I +LL+ E+
Sbjct: 313 SWLPVWCLGAGLLFVVFQGLLRALGNAGTLPSLMAIFVGILIFILGVITVLLRIEE 368


>gi|149914658|ref|ZP_01903188.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Roseobacter sp.
           AzwK-3b]
 gi|149811451|gb|EDM71286.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Roseobacter sp.
           AzwK-3b]
          Length = 380

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 96/228 (42%), Gaps = 33/228 (14%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
           A  +P +I  I+P       + V   L+  SEL + +A G S W+L+ P +V  IL+ + 
Sbjct: 47  ALTLPGVIGVILPMAAFAATVYVTNRLSTESELTVVQATGYSPWRLMRPVIVFGILIALM 106

Query: 116 TVLVIN---PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
             L+ +   P + S  ++  D + Q         + ++   +  +P   I    + I P+
Sbjct: 107 MSLLTHFLIPSSLSQLRLRQDEVSQ------NITAKLLTEGEFLHPAPGITFYIRDITPD 160

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPI 232
             +   F S   D +N + +  +   A +  D     K++        +D  + T    +
Sbjct: 161 GELHNVFMSDRRDSENTMTYTSNR--AYLIQDPEGGTKLLM-------VDGLAQT----V 207

Query: 233 KMDGFQKFSEQFASRSFYEI----------IKKMSFSNKSNIFHNYRA 270
           + DG + F+  F   S Y+I          + K++F++  +I  + RA
Sbjct: 208 RRDGNRLFTTHFNDFS-YDISALIASEATSLDKVTFAHTLDIARDPRA 254


>gi|319776037|ref|YP_004138525.1| inner membrane protein [Haemophilus influenzae F3047]
 gi|329123195|ref|ZP_08251764.1| YjgP/YjgQ family membrane protein [Haemophilus aegyptius ATCC
           11116]
 gi|317450628|emb|CBY86848.1| conserved inner membrane protein [Haemophilus influenzae F3047]
 gi|327471540|gb|EGF16984.1| YjgP/YjgQ family membrane protein [Haemophilus aegyptius ATCC
           11116]
          Length = 358

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 79/362 (21%), Positives = 149/362 (41%), Gaps = 18/362 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  +I   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFSTLMTLVGLSAIIKFVEQFRSVGK-GTYDIWQAVIFTGLTIPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELVI ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVIMQSAGFSRFKIGIAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  +     F+  +++  +  + +D    T ++
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGHH----FVFVRRVTDDTKL-DDIYIYTFEQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGR---IPIDKNSTTLNIPIKMDGFQKFS 241
           ++ +I  K A+ A    D+ K  L++V      +   I  +  S T    +  D     S
Sbjct: 181 QHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKDEIITTNHLSETWETSLTPDKLGAVS 240

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S      RS
Sbjct: 241 LRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPVSVGVMMLLALSFIFGSLRS 299

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILILLQK 358
                 +  GI  GF+ Y +  I+   G++ ++  + A   ALIP +L I +   +L +K
Sbjct: 300 VTAGARIVTGICVGFLFYVVNEIL---GQTSVVYGIPAIFGALIPSLLFIVMIWWLLSRK 356

Query: 359 ED 360
            D
Sbjct: 357 RD 358


>gi|288940379|ref|YP_003442619.1| permease YjgP/YjgQ family protein [Allochromatium vinosum DSM 180]
 gi|288895751|gb|ADC61587.1| permease YjgP/YjgQ family protein [Allochromatium vinosum DSM 180]
          Length = 354

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 65/322 (20%), Positives = 133/322 (41%), Gaps = 25/322 (7%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y ++   +     +P  + Q+ P  TL+  ++    L   SELV  RA GIS+ +L+  
Sbjct: 43  RYGLAEAMLFTLLSLPRYLYQLFPIATLIGALIGLGTLASRSELVAMRAAGISVGRLVRA 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            ++G ++L    V++   +A   E+  ++L ++   +G+  +     +  I +     ++
Sbjct: 103 ALLGGLVLATIAVVLGELVAPIAEQRAVEL-RRLALSGEAAQLTPYGFWAIDDGA---YV 158

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVV-------EYQYG 217
             ++I     +  D     +D     +    A+ A   + +  L+ +          Q  
Sbjct: 159 NIREIRSGTSL-RDIDIYRVDAAAGTLEASHAEGARYEDGRWVLEGIALSRVDGEGVQVE 217

Query: 218 RIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL 277
           R+   +  + L+ P  +               Y+ I+ MS + +    +    E  F+  
Sbjct: 218 RVEHAEWDSMLD-PGLLKVVVADPRALPVWGLYKYIRFMSVNKQDASAY----EIAFWSK 272

Query: 278 IVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLY----TIITIMKSFGKSGI 333
           ++ P++ ++M LIA  + L  SRS      +  GI  G + Y    T   +   FG +  
Sbjct: 273 VLHPVLTLSMILIAIPMLLGSSRSTGMGRRMLAGILVGLVYYLVSRTFAYLALLFGMNAF 332

Query: 334 LLPVAAALIPVILTISLSILIL 355
           L    AA+ P +L I  ++L+L
Sbjct: 333 L----AAIAPPVLFIGAAMLLL 350


>gi|260754017|ref|YP_003226910.1| permease YjgP/YjgQ family protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258553380|gb|ACV76326.1| permease YjgP/YjgQ family protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 364

 Score = 41.2 bits (95), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
           R P +I + +PF  L+  ++    LN+ SE++  +A GIS  Q+L P +    L+G  +
Sbjct: 64  RTPQLIARFLPFAVLLGVLITLSTLNQNSEIISMKAAGISAHQILMPLIASCFLIGCVS 122


>gi|56552290|ref|YP_163129.1| permease YjgP/YjgQ family protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56543864|gb|AAV90018.1| permease YjgP/YjgQ family protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 364

 Score = 41.2 bits (95), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
           R P +I + +PF  L+  ++    LN+ SE++  +A GIS  Q+L P +    L+G  +
Sbjct: 64  RTPQLIARFLPFAVLLGVLITLSTLNQNSEIISMKAAGISAHQILMPLIASCFLIGCVS 122


>gi|241761652|ref|ZP_04759739.1| permease YjgP/YjgQ family protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373960|gb|EER63493.1| permease YjgP/YjgQ family protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 364

 Score = 41.2 bits (95), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
           R P +I + +PF  L+  ++    LN+ SE++  +A GIS  Q+L P +    L+G  +
Sbjct: 64  RTPQLIARFLPFAVLLGVLITLSTLNQNSEIISMKAAGISAHQILMPLIASCFLIGCVS 122


>gi|50083533|ref|YP_045043.1| hypothetical protein ACIAD0255 [Acinetobacter sp. ADP1]
 gi|49529509|emb|CAG67221.1| conserved hypothetical protein; putative permease [Acinetobacter
           sp. ADP1]
          Length = 356

 Score = 41.2 bits (95), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQI 66
           K+  KTT   +LG  I++ ++ +  +   +GEL N    YS  +  +      P  + +I
Sbjct: 9   KHVTKTTALAMLGTTIVLVILQV--LFTYLGELSNLKADYSAWQAFLYVLWGAPRYLYEI 66

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
           +P   L+  I+    L   SEL++ R++GIS+W+++   +  +++L
Sbjct: 67  LPISALIGAILGLGTLASNSELIVMRSVGISLWRIVGWVIRSALVL 112


>gi|292493020|ref|YP_003528459.1| permease YjgP/YjgQ family protein [Nitrosococcus halophilus Nc4]
 gi|291581615|gb|ADE16072.1| permease YjgP/YjgQ family protein [Nitrosococcus halophilus Nc4]
          Length = 354

 Score = 41.2 bits (95), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 87/203 (42%), Gaps = 14/203 (6%)

Query: 29  FVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSEL 88
           F+ +L E+    GE  NY +       A  +P  I  ++P   L+ +++   +L   SEL
Sbjct: 32  FITELEEV----GE-GNYGVMDALRYTAYSIPQYIYDLLPVAALLGSVLGLGSLAGQSEL 86

Query: 89  VISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSD 148
           V  RA G S+ ++    +   ++  + T+L+   +A   ++    L    K     ++++
Sbjct: 87  VAMRAAGFSVGRITRSALATGMIFVVVTILMGEVLAPPAKQAANTLRSLAKTGHLSEQAE 146

Query: 149 IIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKL 208
              W + +N    I     ++LP N  ++D      D+++++     A  A  + D   L
Sbjct: 147 RGFWTRNNNNFNRI----GRVLP-NGQYQDIEIFEFDEQHRLRVISRAAGATYHRDGWHL 201

Query: 209 KKVVEYQYGRIPIDKNSTTLNIP 231
             + +    RI   +  TT  +P
Sbjct: 202 SDITQ----RIISSQGITTRRLP 220


>gi|299138457|ref|ZP_07031636.1| permease YjgP/YjgQ family protein [Acidobacterium sp. MP5ACTX8]
 gi|298599703|gb|EFI55862.1| permease YjgP/YjgQ family protein [Acidobacterium sp. MP5ACTX8]
          Length = 785

 Score = 41.2 bits (95), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 64/315 (20%), Positives = 128/315 (40%), Gaps = 22/315 (6%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG--IFT 116
           +P I+  + P  +LV  ++ F  L+RTSEL   +A G+S++++  P ++ ++ L   +F 
Sbjct: 474 IPFILYNVTPLCSLVAVLITFGALSRTSELTAMKATGVSLYRIATPVLLVALALSAILFA 533

Query: 117 VLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQ---ISNPQQDIFIGAKKILPEN 173
                  A + ++  +  + + K      ++D   WM    + N +       +    + 
Sbjct: 534 FDETYLPAANRKQEALRSVIKGKPAQTFLRAD-RKWMSGQTLGNKEPTRIFYYQFFDSDK 592

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
           +++ + T          + R+    +  ++D V  + V E  + R     ++ +   P  
Sbjct: 593 NVFANLTVFEFQPGTFTLTRRIFATSARWDDSVN-RWVFENGWQRT-FSGDAISSYQPFT 650

Query: 234 MDGFQKFSEQ---FASRSFYEIIKKMSFSN--------KSNIFHNYRAETQFYFLIVIPL 282
           ++ F +  EQ   F         ++MS+S         K + F   R   Q    I  PL
Sbjct: 651 LNSFPEIHEQPGYFKKEDRQS--QEMSYSELSKYIRDLKQSGFDTTRLRVQLNRKIAYPL 708

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
           M + M ++A   +L   +      + A GI      + I  I ++ G    L  + AA  
Sbjct: 709 MALVMAILAVPFALSTGKRGGLAGMGA-GIGVAISYWVIAAIFENLGNVNSLPSILAAWS 767

Query: 343 PVILTISLSILILLQ 357
           P IL   +   +LL+
Sbjct: 768 PDILFAMVGTYLLLR 782


>gi|329894347|ref|ZP_08270217.1| putative permease [gamma proteobacterium IMCC3088]
 gi|328923143|gb|EGG30466.1| putative permease [gamma proteobacterium IMCC3088]
          Length = 353

 Score = 41.2 bits (95), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLN 103
           NY+ S+  +  A  VP  I ++ P   L+  +V    L  TSELV+ R  G+S W LL 
Sbjct: 42  NYTFSKALLYVAASVPARIVELAPIGILIGVLVALGQLASTSELVVIRGAGLSSWHLLR 100


>gi|113460663|ref|YP_718729.1| permease [Haemophilus somnus 129PT]
 gi|112822706|gb|ABI24795.1| conserved permease [Haemophilus somnus 129PT]
          Length = 356

 Score = 41.2 bits (95), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 87/370 (23%), Positives = 148/370 (40%), Gaps = 24/370 (6%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M   L RY  K  L   L  LL  + L  +I   E    +G+   Y + +  +     +P
Sbjct: 1   MMNTLDRYIGKNILGAILATLLMLVGLSAIIKFVEQFRSIGK-GTYDVIQATLFTLLTMP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+ +++   NL   SEL++ ++ G S +++    +  ++ L + T+++ 
Sbjct: 60  KDIETFFPMAALLGSLIALGNLASRSELIVIQSAGFSRFRIGLAVMKTALPLMLITMIIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
                  E    D+  +    G         W + SN     FI   +I  +  +  D  
Sbjct: 120 EWGIPQTEHFARDMRAKAISGGSMLSVKNSIWARDSND----FIYVGRITNDIRL-NDIY 174

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPI-------DKNSTTLNIPIK 233
             + D K ++     A+ A   + K KL  + + Q     I       D  STTL  P K
Sbjct: 175 IYSFDDKRQLKQVTHANQASFEHGKWKLSGINQSQIFADEIKTINRLKDNWSTTLT-PDK 233

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
           +          +    Y  IK M  + +       R E  F+  +  P+ +  M ++A S
Sbjct: 234 LGIASLRPTSLSMTGLYNYIKFMKETGQDA----KRFELTFWQKVFQPVSVAVMMMLALS 289

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGIL--LP-VAAALIPVILTISL 350
                 RS      +  GIF GF+ Y I  I+   G+  +L  +P V AALIP +L + L
Sbjct: 290 FIFGSLRSVTAGARIVTGIFFGFLFYVINEIL---GRLSLLYDIPIVLAALIPSLLFMIL 346

Query: 351 SILILLQKED 360
              +L +K +
Sbjct: 347 IWWLLNRKRE 356


>gi|330874293|gb|EGH08442.1| hypothetical protein Pgy4_05807 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 213

 Score = 40.8 bits (94), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 11  KYYLKTTLYFLLGAM-ILVFVIDLNEIQNQMGELPN-YSISRGAVLAATRVPLIIQQIIP 68
           +Y  K+ L  +L  + I++ ++ L    ++MG++ + Y+++          P  +   +P
Sbjct: 6   RYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRVYDTLP 65

Query: 69  FITLVVNIVVFFNLNRTSELVISRAIGISI----WQLLNP---FVVGSILLGIFTVLVIN 121
              L+  ++    L  +SEL I RA G+SI    W ++ P    +V  +L+G +    + 
Sbjct: 66  MAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLLLMVAGVLVGEY----VA 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           P A +  +    L Q    +GD Q +    W    + Q + FI    + P N +    T 
Sbjct: 122 PYAENQAQAARSLAQ---GSGDAQSARHGLW----HRQGEEFIHINTVQP-NGLMLGVTR 173

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKV 211
              D +  ++    A  A    D  +LK V
Sbjct: 174 YRFDDQRHMLTSSFAKEANFKTDYWELKDV 203


>gi|311694208|gb|ADP97081.1| permease YjgP/YjgQ family protein [marine bacterium HP15]
          Length = 345

 Score = 40.8 bits (94), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 80/191 (41%), Gaps = 19/191 (9%)

Query: 25  MILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNR 84
           +I  F+ +L++I+N      NY I          +P  I   +P    +  +V   ++  
Sbjct: 20  LIFAFIAELDDIRN------NYQILDALWYVFLTLPRRIYDYLPLGAFMGCLVGLGSMAS 73

Query: 85  TSELVISRAIGIS----IWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKD 140
           +SEL + RA G+S    +W  + P    ++++ +  VL+   +A   E++     Q +K 
Sbjct: 74  SSELTVVRAAGVSLKRIVWSAMKP----ALVIVVLGVLIGEYLAPPAERVA----QSYKA 125

Query: 141 NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAI 200
                 S++     + + + D +I    + P N +    +    D   +++    A+ AI
Sbjct: 126 VALGAGSNVASASGVWHKEGDSYIHLNAVQP-NGVLHGVSRFQFDDDRQLLAASFAERAI 184

Query: 201 IYNDKVKLKKV 211
              D   L+ V
Sbjct: 185 YQGDHWLLENV 195


>gi|145219916|ref|YP_001130625.1| permease YjgP/YjgQ family protein [Prosthecochloris vibrioformis
           DSM 265]
 gi|145206080|gb|ABP37123.1| permease YjgP/YjgQ family protein [Chlorobium phaeovibrioides DSM
           265]
          Length = 441

 Score = 40.8 bits (94), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 53/269 (19%), Positives = 105/269 (39%), Gaps = 48/269 (17%)

Query: 11  KYYLKTTLY-FLLGAMILVFVIDLNEIQNQMGELPNYSISRGAV--LAATRVPLIIQQII 67
           +Y LK  +  F    + ++FV+ L    +         I  GA+  L A +   ++    
Sbjct: 6   RYILKAHVGPFFFAFLTIIFVLILQFFASFADRFIGRGIGFGALVELIALQSAWMVGLAA 65

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL---VINPIA 124
           P   L+  ++ F  L  TSE+ + RA G+S+++L+ P ++  ++L  F      V+ P+A
Sbjct: 66  PMAVLIAVVMAFGALTTTSEMTVFRASGVSLYRLMIPILLAGLVLSFFVERFNNVVQPLA 125

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
               +  +D              DI+                 K  P   I E+  S  +
Sbjct: 126 NYQARSLMD--------------DIV-----------------KAKPNFGITENAFSPLV 154

Query: 185 DKKNKIIHRKD------ADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
           D  + ++ + D       D+ I  + +   + V+  + GRI    +   L + ++     
Sbjct: 155 DGYSILVRKSDERTGGIGDIIIYDSTRPDFRSVITAEEGRISFSDDGGYLLLTLRNGEIH 214

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHN 267
           +  +       Y + +KMSF     +F +
Sbjct: 215 EVQQ-----PDYRLYRKMSFQQHRYVFES 238


>gi|148244955|ref|YP_001219649.1| permease [Candidatus Vesicomyosocius okutanii HA]
 gi|146326782|dbj|BAF61925.1| permease [Candidatus Vesicomyosocius okutanii HA]
          Length = 360

 Score = 40.8 bits (94), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 115/265 (43%), Gaps = 35/265 (13%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
           NY++          +P ++      I L+ +++   NL  TS+LVI R+ G+SI Q+ N 
Sbjct: 43  NYTVFEATKYIILNIPAVMYSHSSVIILLGSLLALTNLASTSQLVIIRSSGVSIMQISNI 102

Query: 105 FVVGSILLGIFTVLV---INPIATS-GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQ 160
            V  +++     +L+   + PI T   E +    ++Q     ++Q+     W++      
Sbjct: 103 VVWVALMFIAIIILIGELVAPITTEYAECLRSKALEQNMTCRNQQEF----WLK----DN 154

Query: 161 DIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIP 220
            +FI  KK       ++D T I +     +     +D A    + ++L K + YQ  +  
Sbjct: 155 GLFIHVKKDFDAKS-FQDITFIKLRAPGVLDSIIYSDNATFNGNNLELNKPIHYQLSK-- 211

Query: 221 IDKNSTTLNIPIKMDGFQKFSEQFA--------------SRSFYEIIKKMSFSNKSNIFH 266
            +   TT +     + F+K+S Q +                S + + K+MSF   +N+  
Sbjct: 212 -NGELTTFS----KNYFEKYSVQISFNQKLIKNLKKDPRKLSTWHLYKQMSFLTNNNLVA 266

Query: 267 NYRAETQFYFLIVIPLMLVAMTLIA 291
           +   E + Y   ++P+ LVAM L +
Sbjct: 267 DI-VEIEIYKRFMMPVTLVAMILFS 290


>gi|259419313|ref|ZP_05743230.1| permease YjgP/YjgQ [Silicibacter sp. TrichCH4B]
 gi|259345535|gb|EEW57389.1| permease YjgP/YjgQ [Silicibacter sp. TrichCH4B]
          Length = 379

 Score = 40.8 bits (94), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 53/111 (47%), Gaps = 13/111 (11%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRG-AVLA-----ATRVP 60
           RY    YL   L+F   A+ILV V  +N   +    L ++ I  G +VLA     A  +P
Sbjct: 6   RYVLSQYL---LFFGFFALILVAVFWINRAVS----LFDWLIGDGQSVLAFLEISALSLP 58

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL 111
            +++ ++P       + V   LN  SEL + RA G S WQL  P +   +L
Sbjct: 59  NLVRMVLPLAAFAATVWVTNRLNSESELTVLRATGSSPWQLARPAMAFGVL 109


>gi|262370180|ref|ZP_06063507.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315219|gb|EEY96259.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 356

 Score = 40.8 bits (94), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV----PLIIQQI 66
           K+  KTT   +LGA  ++ V+ +  +   +GEL +     GA  A   V    P  + +I
Sbjct: 9   KHVTKTTAMAMLGATAILSVLQI--LFTYLGELGSLKEGYGAWDALRYVLWGAPQYLYEI 66

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
           +P   L+ +++    L   SEL++ R++G+S+W+++   +  +++L
Sbjct: 67  LPIAALIGSVLGLGTLASNSELIVMRSVGVSLWRIVGWVIRSALIL 112


>gi|296115280|ref|ZP_06833920.1| permease YjgP/YjgQ family protein [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978183|gb|EFG84921.1| permease YjgP/YjgQ family protein [Gluconacetobacter hansenii ATCC
           23769]
          Length = 372

 Score = 40.8 bits (94), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 67/360 (18%), Positives = 144/360 (40%), Gaps = 43/360 (11%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQQIIPFITLVVNIVVFFN 81
           A +++ ++++  +  ++ E+ +  +    VL  A  R+PL+    +P   L+  ++    
Sbjct: 32  AAVIIALMEVLALLEEVTEIMSRHLGLSGVLYYAVIRLPLLFGNAMPLAVLIGALITLVQ 91

Query: 82  LNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDN 141
           L  ++E+ I RA G+S   L   F+   + LG+  V+V + +A   E   I   + W   
Sbjct: 92  LTSSNEISIMRAAGLSTAGLFRLFLPAVLGLGVLCVVVDDQVAPRSE---IAQARWWNST 148

Query: 142 GDKQKS---DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKN------KIIH 192
                    D+  W +       + IG        H   +   +T+ +++      K+IH
Sbjct: 149 APAPNGVTRDV--WFRTG--MTLVNIGGVA-----HGGRELHDVTVYRRDDEGALQKVIH 199

Query: 193 RKDA-----------DLAIIYNDKVKLKKVVEYQYGRIPID-KNSTTLNIPIKMDGFQKF 240
                          D A+      +++ V      R+ +D   + T ++ ++M      
Sbjct: 200 LPTVRYFINRWSGVPDHALTVLSPTRVEDVALQDDTRLTLDWPRALTPDVLLQMSENTPL 259

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
           S     R  +        S++S  F      T+    I++PL    M L+A  V     R
Sbjct: 260 SIMTMVRVLHNAFP----SSQSPAFF----MTEILGRIMLPLTFTVMLLLAIPVVYIPPR 311

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
           +     +  + + +G +      ++++ G +G L  V A  + +++ I   + +LL+ E+
Sbjct: 312 AGARSWLPVWCLGAGLVFVVFQGLLRALGNAGTLPSVVAVFVGIVIFILGVVTVLLRIEE 371


>gi|34558361|ref|NP_908176.1| permease [Wolinella succinogenes DSM 1740]
 gi|34484080|emb|CAE11076.1| conserved hypothetical protein-PREDICTED PEMEASE [Wolinella
           succinogenes]
          Length = 355

 Score = 40.8 bits (94), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 126/300 (42%), Gaps = 27/300 (9%)

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN--PI 123
           I+P   ++  I++F  L RT+EL    +IG S  Q+  P ++G  LL  F  +V+N  P 
Sbjct: 61  ILPIALVLAQILLFVVLLRTNELTALLSIGYSKRQITTP-LLGIALLFTFGFIVLNATPF 119

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           A + E++   L Q +  N  ++         +     D +I   KI P     E      
Sbjct: 120 AYAKERVDTILDQGYVGNFKRE---------LFVKYHDSYIYFDKIYPLLQKAEGVKVYR 170

Query: 184 I--DKKNKIIHRKDA---DLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
           +  D+  + I  K+A   D     N+ + +    E   G  P++      +    ++GF+
Sbjct: 171 LEGDRVAQWIEAKEARFVDNHWRLNEAMVMTIPSELTLGGSPLEVEKV--DFMEVLEGFR 228

Query: 239 -----KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML-VAMTLIAA 292
                   E+  + S  + I+ MS   +  + ++ +     Y L++ P    + M L+A 
Sbjct: 229 PRILDSIYERHGAVSIIDAIESMSLLLEQQV-NSQKIRGILYSLVLFPFFAPLCMVLVAY 287

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSI 352
            + +     N   IIV   I    + + +   +     SG + P  + LIP+IL  +L++
Sbjct: 288 YMPITMRYGNLA-IIVFAAILGVLLFWGLFFALSRLSMSGFIHPEVSLLIPMILWTALAL 346


>gi|317486217|ref|ZP_07945051.1| permease YjgP/YjgQ family protein [Bilophila wadsworthia 3_1_6]
 gi|316922516|gb|EFV43768.1| permease YjgP/YjgQ family protein [Bilophila wadsworthia 3_1_6]
          Length = 385

 Score = 40.8 bits (94), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 83/388 (21%), Positives = 162/388 (41%), Gaps = 66/388 (17%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGEL---PNYSISRGAVLAAT 57
           MP +L R  FK   +    F+L   +L+ +I ++    QM EL    +  I    +L   
Sbjct: 1   MPSLLQRQIFK---EIANLFVLAVGVLLTLILISR-AVQMRELFLGLDLGILDTVLLFGY 56

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
             PL +  +IP   ++   + F  ++   ELV  RA GI+I+Q+L   ++ S++  + T+
Sbjct: 57  MTPLFLMLVIPIACMLSVFLTFLRMSTDRELVALRAGGINIYQMLPAPLLFSVICMLLTL 116

Query: 118 LV---------------INPIATSGEKIGID------------LIQQWKDNGDKQKSDII 150
            V               I  IA +  ++ +             L  +  + GD   S ++
Sbjct: 117 WVSLHWLAWGMGHFRETILEIANTRARVVVQPGVFNTDFPNLVLFARQVNPGDGDMSQVL 176

Query: 151 PWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKK 210
                S+P++ + I A    PE     D      ++   +   +D  +         +  
Sbjct: 177 V-DDRSHPERHMTILA----PEGRFDTD-----TERGELVFLLEDGKIYTTDKKGASVLA 226

Query: 211 VVEYQYGRIPIDKNSTTLNI----PIKMDGFQKFSEQFASRSFYEIIK-KMSFSNKSNIF 265
             EY+  R+P+D    +L++    P +M        + +S +  E +K   +++NK  + 
Sbjct: 227 FDEYKV-RLPLDSLFKSLDLGDVRPREMSW-----SKLSSITREEALKVDANYANKLEVE 280

Query: 266 HNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR-SNQPRIIVAYGIFSGFMLYTIITI 324
            + R           P+  +A+TL    ++  F     Q  +++A  +F  F+ Y+++++
Sbjct: 281 RHKR--------WAYPVACIALTLFVLPLASAFEGLHRQTGLMLALAMF--FVYYSLMSL 330

Query: 325 MKSFGKSGILLPVAAALIPVILTISLSI 352
             S G+SG + P     +P IL + L I
Sbjct: 331 GFSTGESGAIPPSIGLWVPNILFLCLGI 358


>gi|189500558|ref|YP_001960028.1| permease YjgP/YjgQ family protein [Chlorobium phaeobacteroides BS1]
 gi|189495999|gb|ACE04547.1| permease YjgP/YjgQ family protein [Chlorobium phaeobacteroides BS1]
          Length = 441

 Score = 40.8 bits (94), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 57/113 (50%), Gaps = 9/113 (7%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRG----AVLAATRV 59
           IL+RY  K ++     FL   + ++F++ L  +           +  G    A L + +V
Sbjct: 3   ILYRYILKEHIGP---FLFSFITILFILTLQFVTRFFDRFAGKDL--GFIVIAELISLQV 57

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
             ++   +P   LV  ++ F NL  +SE+ + RA G+S+++L+ P +V + LL
Sbjct: 58  AWMVVLALPMAVLVATLIAFGNLANSSEMTVMRAGGVSLYRLVFPVLVAAALL 110


>gi|222110916|ref|YP_002553180.1| permease yjgp/yjgq family protein [Acidovorax ebreus TPSY]
 gi|221730360|gb|ACM33180.1| permease YjgP/YjgQ family protein [Acidovorax ebreus TPSY]
          Length = 369

 Score = 40.4 bits (93), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 60/331 (18%), Positives = 131/331 (39%), Gaps = 24/331 (7%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y +S   +  A  +P  + +++P   L+  I V   L ++SE  I R  G+  W+ L+ 
Sbjct: 46  GYQLSHALLFVALSLPQHLYELLPITVLIGTIFVMARLAQSSEFTIMRTSGLGPWRALST 105

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            ++      + TV+V + IA + EK    L++  +  G         W++       I +
Sbjct: 106 LLMLGCAFVMVTVIVGDYIAPASEK-AASLVKA-RRLGQISTGATGAWLKERQGDHSIAV 163

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYN--DKVKLKKVVEYQY-----G 217
             + + P N           D + ++     A+ A   +  D   L++V    +     G
Sbjct: 164 NVRAVDP-NGAMRGVRVFEFDARGRVAATIQAEQATFDDARDAWNLQQVERTLFEAEADG 222

Query: 218 RIPIDK-NSTTLNIPIKMDGFQKFS-----EQFASRSFYEIIKKMSFSNKSNIFHNYRAE 271
            + + +    TL  P ++      +     ++ A+   +  ++ +  + +S      R E
Sbjct: 223 GMRVSRLQEPTLRWPTRISPDMVAASLLKPDKMATIELFRFVRHLEANGQS----AQRYE 278

Query: 272 TQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGK- 330
            +F+  +  PL  + M +++   +    RS      V  G+ +G   + +  +    G  
Sbjct: 279 IEFWRKVFYPLSCLVMVVLSLPFAYLHFRSGGIAGYVFGGVMAGISFFLLNNVFGFAGNL 338

Query: 331 ---SGILLPVAAALIPVILTISLSILILLQK 358
              S  L   A  LI  +L+++    ++L++
Sbjct: 339 QNWSPWLTAAAPGLIYSVLSLAAFGWLVLRR 369


>gi|149186433|ref|ZP_01864746.1| predicted permease [Erythrobacter sp. SD-21]
 gi|148830022|gb|EDL48460.1| predicted permease [Erythrobacter sp. SD-21]
          Length = 409

 Score = 40.4 bits (93), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 67/329 (20%), Positives = 134/329 (40%), Gaps = 62/329 (18%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLN-PFVVGSILLGI 114
           AT +P      IP   L+  ++ F  L  TSEL + RA+G+S  +LL  PF++  +L+ +
Sbjct: 58  ATLLPEYASLAIPLGLLLGILLAFRKLATTSELDVFRAVGMSYGRLLRVPFLITGVLMTL 117

Query: 115 FTVLV--INPIAT-SGEKIGIDL------------------------IQQWKDNGDKQKS 147
              LV  I P++  + E++  +L                        I++ +D+G + K 
Sbjct: 118 NVALVFFIQPVSRFTYERLEYELRSGALGASIKVGEFTTLADRMALRIEESEDDGRQLKG 177

Query: 148 DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK 207
               + +++N +  +                  SI+  + N +    D D  I+   ++ 
Sbjct: 178 I---FARVANDKGQVL-----------------SISAKEGNFLATTDDPDTIIL---RLT 214

Query: 208 LKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHN 267
              +V+    + P     T  ++PI +   ++F  +      Y + + +      N   +
Sbjct: 215 EGTIVQDTGSQTPRVLTFTRHDLPIDLPAIEEFRARGEDEREYILPELLRIGWADNQTES 274

Query: 268 YRAETQ--FYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIM 325
            R  +Q  F F +V  +M+  M L+A ++ +   RS       A G+F   ++      +
Sbjct: 275 KRDASQASFNFRLVEVVMMALMPLLAVALGIPPKRSTS-----ALGVFLSIIMVVAYHKV 329

Query: 326 KSFGKS----GILLPVAAALIPVILTISL 350
             +G+     G+  P+ A  +P  L  +L
Sbjct: 330 NQYGEDLAAIGMFDPILALWVPFFLFAAL 358


>gi|187250533|ref|YP_001875015.1| permease YjgP/YjgQ family protein [Elusimicrobium minutum Pei191]
 gi|186970693|gb|ACC97678.1| Permease YjgP/YjgQ family protein [Elusimicrobium minutum Pei191]
          Length = 370

 Score = 40.4 bits (93), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 83/183 (45%), Gaps = 21/183 (11%)

Query: 167 KKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST 226
           K+I+  N +W        DK  KI   KD  +   + + + +++ V         D   +
Sbjct: 198 KQIVARNLVW--------DKDEKIWFYKDGVIRY-FEEGITIREEV--------FDTLES 240

Query: 227 TLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            L +  K        E+  + S  E++KK+SF  +S +   Y+ +T  +  + +P+M + 
Sbjct: 241 DLKVAPKDISVGDIEEK--AISVRELLKKISFLGRSGLV-TYKEKTNLHNKLAMPVMTII 297

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
           M LI    ++   +  +   I+A  + S F  + ++T+  + G++GIL P  A    V+L
Sbjct: 298 MCLIGMPFAVTVRKRGKVINIIAALVMS-FSFWWVMTMASTAGQNGILSPFIAGWGIVVL 356

Query: 347 TIS 349
             +
Sbjct: 357 AAA 359


>gi|260427478|ref|ZP_05781457.1| permease YjgP/YjgQ [Citreicella sp. SE45]
 gi|260421970|gb|EEX15221.1| permease YjgP/YjgQ [Citreicella sp. SE45]
          Length = 379

 Score = 40.4 bits (93), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 84/200 (42%), Gaps = 17/200 (8%)

Query: 10  FKYYLKTTLYFLLG--AMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT--RVPLIIQQ 65
           F  Y+ + L  + G  A++LV V  LN       EL     + G  L  T   +P ++  
Sbjct: 4   FDRYMLSQLMVVFGFFALVLVMVYWLNRSVGLFDELIANGHTAGIFLEFTLLALPGVVAI 63

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT 125
           ++P       + V   ++  SEL + +A G+S W+L  P +V   ++G    ++ + +  
Sbjct: 64  VLPMAAFGAAVYVTNRMSNESELTVLQATGLSPWRLARPVLVFGAIIGAMMAILSHVLVP 123

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
           +   IG  L ++  +      + ++      +P + +    + I PE  + + F S    
Sbjct: 124 A--SIG-QLRERESEISGSVSARLLHEGTFLHPTRGVTFYIRDITPEGELRDVFLS---- 176

Query: 186 KKNKIIHRKDADLAIIYNDK 205
                  R+D D AI Y  +
Sbjct: 177 ------DRRDPDRAIAYTAQ 190


>gi|126728787|ref|ZP_01744602.1| Predicted permease [Sagittula stellata E-37]
 gi|126710717|gb|EBA09768.1| Predicted permease [Sagittula stellata E-37]
          Length = 376

 Score = 40.4 bits (93), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 88/207 (42%), Gaps = 9/207 (4%)

Query: 10  FKYYLKTTLYFLLG--AMILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQQ 65
           F  Y+ + L  L G  A++LV V  +N        L N   S   VL   A  +P +I  
Sbjct: 4   FDRYVLSQLMVLFGFFALVLVSVYWVNRAVVLFDRLINDGHSARIVLEFTALSLPAVIAL 63

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT 125
           ++P  T    + V   L+  SEL + +A G S W+L  P +V  I++ +   ++ + +  
Sbjct: 64  VLPMATFAAAVYVTNRLSGDSELTVVKATGFSPWRLARPVLVFGIMVTLMMSVLTHVLVP 123

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
              K    L  + ++      + ++      +P + I    + I PE  + +   S   +
Sbjct: 124 QSLK---QLRMREQELSSSVSARLLREGTFLHPSKGITFYIRDITPEGTLQDVLLSDRRE 180

Query: 186 KKNKIIHRKDADLAIIYNDKVKLKKVV 212
            + ++I+   AD A +  D    K V+
Sbjct: 181 PEREVIY--TADRAYLIRDDEGPKMVM 205


>gi|110596903|ref|ZP_01385193.1| permease YjgP/YjgQ [Chlorobium ferrooxidans DSM 13031]
 gi|110341590|gb|EAT60050.1| permease YjgP/YjgQ [Chlorobium ferrooxidans DSM 13031]
          Length = 359

 Score = 40.0 bits (92), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (48%), Gaps = 16/133 (12%)

Query: 4   ILWRYFFKYYLK------TTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT 57
           IL RY F+ + K      TT  FL    IL+ +++   + + MG   N SI +       
Sbjct: 3   ILDRYIFRQFAKAFIFTSTTFVFLF---ILITMVE--HLDDMMGR--NLSIFQIIGYYLL 55

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
            +P  +    P  +L+ +I+V   L+ +SEL   R+ G+S+ QLL PF+ G+  +    +
Sbjct: 56  SIPSTVLVTAPVSSLLASILVAGRLSASSELSAIRSAGVSMRQLLYPFLAGASFIAAVNL 115

Query: 118 LV---INPIATSG 127
           +    I P A SG
Sbjct: 116 VNSCWIAPAAFSG 128


>gi|320352233|ref|YP_004193572.1| permease YjgP/YjgQ family protein [Desulfobulbus propionicus DSM
           2032]
 gi|320120735|gb|ADW16281.1| permease YjgP/YjgQ family protein [Desulfobulbus propionicus DSM
           2032]
          Length = 360

 Score = 40.0 bits (92), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 78/373 (20%), Positives = 160/373 (42%), Gaps = 32/373 (8%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNE-IQNQMGELPNYSISRGAVLAATRVPLI 62
           +L+RY   ++L+     +   + L  +ID  E I N + +  ++S+   A      +P I
Sbjct: 3   LLYRYILAHFLRNLGMIMASFITLYLLIDFFEKIDNFLEKGKSFSLI--ATFFFANIPFI 60

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           I  + P   L+  +V    LN ++EL+  +A GI + ++  P ++G+ L      L ++ 
Sbjct: 61  IDLMSPVCILLAGVVTLGVLNHSNELIALKACGIPLKKITVP-IIGAALACTLLFLAMDQ 119

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ-----QDIFIGAKKILPENHIWE 177
                + I +   Q W    +K+    +P     N +     Q+ F    +  P+ ++++
Sbjct: 120 YVLP-KTIAVT-NQIW----NKEIKGKVPLGIYRNGRYYYRGQEGFYSFSRPDPQKNLFK 173

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT------LNIP 231
           +F+    DK++       A++A ++N  V   +  + Q      D+ +T       +N P
Sbjct: 174 NFSYTVWDKEHAANTLIAAEIA-VWNKGVWTLRNGQIQKA-AGGDRFATQVFTNRRINFP 231

Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFY----FLIVIPLMLVAM 287
              D F   + +    S  ++ K+   +         +A   FY    + ++   +L+  
Sbjct: 232 ETPDDFFVPAYRSMELSLVQLYKETQHTRSEE--ERSKAWADFYGRISYTLLGLPLLLLG 289

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
             +   V  ++ R     I V+ G+   F+ + + T ++S  K+  + P+AAA I V L 
Sbjct: 290 LPLLLLVYRKWGRDLSLAIPVSCGM--AFLCWGVYTTLQSLAKASYIPPLAAA-ISVHLL 346

Query: 348 ISLSILILLQKED 360
           +      LL +ED
Sbjct: 347 VGCVGFFLLLRED 359


>gi|78188415|ref|YP_378753.1| hypothetical protein Cag_0437 [Chlorobium chlorochromatii CaD3]
 gi|78170614|gb|ABB27710.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 443

 Score = 40.0 bits (92), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +P   LV  ++ F  L  TSE+ + RA GIS+++++ P +V S+LL  FTV   N +
Sbjct: 65  LPMAVLVAVVMSFGTLTTTSEMTVCRASGISLYRVMVPVIVVSLLLS-FTVERFNNV 120


>gi|16332044|ref|NP_442772.1| hypothetical protein sll0496 [Synechocystis sp. PCC 6803]
 gi|1001356|dbj|BAA10843.1| sll0496 [Synechocystis sp. PCC 6803]
          Length = 394

 Score = 40.0 bits (92), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 77/366 (21%), Positives = 146/366 (39%), Gaps = 59/366 (16%)

Query: 32  DLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVIS 91
           +L+++ N++ E  N  +++ A +   +VP  +   +P   ++  ++ F  L+   E++  
Sbjct: 52  NLSDLGNKIVE-KNLPVAKAAEVLLLKVPEFLAYSLPVAVMLATMMTFGRLSGDCEIIAI 110

Query: 92  RAIGISIWQLLNPFVVGSIL-------LGIFTVLVINPIATSGEKIGIDLIQQWKDNGDK 144
           R+ G+S+++L+ P VV S+L       L  + V V N  ATS     ID    +  N D 
Sbjct: 111 RSCGVSLYRLILPAVVLSLLVTGWAFVLTEWVVPVANYRATSILIESIDEEHPFWQNRDV 170

Query: 145 QKSDIIPWMQISNPQQDIFIGAKK----ILPENHIWEDFTSITIDK--KNKIIHRKDADL 198
              +    +++ N Q      A++    +  E    ++  ++T+ +  +N + H   +D 
Sbjct: 171 FYPEFEE-IKLDNGQT-----ARRLKSLVYAEKFDGKEMQNLTVLQWTENHLKHIVLSDN 224

Query: 199 AIIYNDK----------VKLKKVVEYQYGRIPIDKNSTTL---NIPIKMDGFQKFSEQFA 245
           A   ND            +L +  +YQ   +P       L          G   +    A
Sbjct: 225 ATWNNDNKRWDFFHGTVYRLTETEDYQEA-VPFTNKQIALPQSAFDFARQGRDPYEMTIA 283

Query: 246 SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPR 305
               Y  I K+    K   F   R E +  F    P + +   ++ +++     R ++  
Sbjct: 284 EAQDYIKILKLIGDEKKTQFFQVRTEQKLAF----PFVCIVFAVVGSAIGARPQRISRAT 339

Query: 306 -------IIVAY---GIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
                  II AY   G FSG           S G  G++ P  AA +P  + + + I +L
Sbjct: 340 GFGLTIVIIFAYYILGFFSG-----------SLGIVGLISPTLAAWLPNFVGLGVGIWLL 388

Query: 356 LQKEDG 361
            +   G
Sbjct: 389 YEFNQG 394


>gi|15618903|ref|NP_225189.1| hypothetical protein CPn0995 [Chlamydophila pneumoniae CWL029]
 gi|15836526|ref|NP_301050.1| hypothetical protein CPj0995 [Chlamydophila pneumoniae J138]
 gi|16752032|ref|NP_445398.1| hypothetical protein CP0860 [Chlamydophila pneumoniae AR39]
 gi|33242364|ref|NP_877305.1| hypothetical protein CpB1032 [Chlamydophila pneumoniae TW-183]
 gi|4377324|gb|AAD19132.1| CT838 hypothetical protein [Chlamydophila pneumoniae CWL029]
 gi|7189772|gb|AAF38649.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 gi|8979368|dbj|BAA99202.1| CT838 hypothetical protein [Chlamydophila pneumoniae J138]
 gi|33236875|gb|AAP98962.1| hypothetical protein CpB1032 [Chlamydophila pneumoniae TW-183]
 gi|269302795|gb|ACZ32895.1| putative permease, YjgP/YjgQ family [Chlamydophila pneumoniae
           LPCoLN]
          Length = 366

 Score = 40.0 bits (92), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 85/407 (20%), Positives = 169/407 (41%), Gaps = 117/407 (28%)

Query: 10  FKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAAT------------ 57
           +K +L T  +F L +++++ +I    I + +  L      +GA  AA+            
Sbjct: 4   WKRHLLTRFWFALTSLLVLALIFYASIHHSLHTL------KGASTAASGASVKLSILYYL 57

Query: 58  -RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVV-GSILLGIF 115
            ++ L  + ++P +  V      F +    E+++ +A G+S+  L++P ++ G++++ + 
Sbjct: 58  AQISLKAEFLMPQLVAVATTSTLFAMQNKREIILLQASGLSLKSLMHPLLLSGAVIMMVL 117

Query: 116 TVLV--INPIATSGEKIGIDLIQQWKDNGDKQKSDI----IPWMQISNPQQDIF--IGAK 167
                 ++PI    EKI I      K+N D+  +D     IP + + +    ++  I  K
Sbjct: 118 YANFQWLHPIC---EKISIT-----KENMDRGTTDKEQGKIPALYLKDQTVLLYSSIEPK 169

Query: 168 KILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT 227
            +   N  W         K  K I+  +  LA                          TT
Sbjct: 170 TLTLNNVFW--------IKDPKTIYTME-KLAF-------------------------TT 195

Query: 228 LNIPIKMDGFQKFS---------EQFASRSFYEI---------IKKMSFSNKSNIFHNYR 269
           L++PI ++  Q F+         E F  + F EI          K  S  NK+ +   ++
Sbjct: 196 LSLPIGLNVTQFFANDSENLELKEFFDMKEFPEIEFNFYENPFSKLFSAGNKNRLSEFFK 255

Query: 270 A---------------------ETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIV 308
           A                       QFY++++ PL  +A  +++A + L FSR+  P + +
Sbjct: 256 AIPWNATGLGLSTQVPQRILSLLAQFYYVLISPLACMAAIILSAYLCLRFSRT--PTVTL 313

Query: 309 AYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           AY I  G      + I   F K+GI+L  +++++P +  ++  +++L
Sbjct: 314 AYLIPLG-----TVNIFFVFLKAGIVL-ASSSVLPTLPVMAFPLIVL 354


>gi|126661397|ref|ZP_01732459.1| hypothetical protein CY0110_10922 [Cyanothece sp. CCY0110]
 gi|126617328|gb|EAZ88135.1| hypothetical protein CY0110_10922 [Cyanothece sp. CCY0110]
          Length = 353

 Score = 40.0 bits (92), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 66/327 (20%), Positives = 142/327 (43%), Gaps = 44/327 (13%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG---- 113
           +VP      +P   ++  ++ +  L+  SEL+  R+ G+S+++L+ P +V S+ +     
Sbjct: 36  KVPEFTAYALPISVMLSTLLTYGRLSNDSELIAFRSCGVSLYRLIIPAMVMSLAVTGVTF 95

Query: 114 IFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDII--PWMQISNPQQDIFIGAKKI-L 170
           + + LV+         I ++ +Q+  D+   Q  DI    + Q++ P  D     K +  
Sbjct: 96  LMSELVVPAANYRATAILVEYLQE--DHPYWQNKDIFYPDYEQVTLPNGDQEKRLKHLFF 153

Query: 171 PENHIWEDFTSITI-----DKKNKIIHRKDADL-----------AIIY--NDKVKLKKVV 212
            E    +   ++T+     ++ N+I+    A               IY  +     K+  
Sbjct: 154 AEQFDGQHLKTLTVLEWLEERLNRIVVSDSATWNGQEETWDFFNGTIYQLSSDASYKEAY 213

Query: 213 EYQYGRIPIDKNSTTLNI----PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNY 268
            +++ ++P+ K +    +    P +M+  Q       +R + +I+K M    K  +F   
Sbjct: 214 PFEHRQLPLTKAAFEFALQGRDPYEMNIIQ-------ARQYMKILKMMGDDKKLRMFQ-V 265

Query: 269 RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF 328
           R + +  F  +  +  V  + + A+   + SR+    + V   IFS ++L  +I    S 
Sbjct: 266 RIQQKLAFPFICVVFGVVGSALGATPQ-QMSRATGFGLSVVI-IFSYYLLGFLI---GSL 320

Query: 329 GKSGILLPVAAALIPVILTISLSILIL 355
           G  G++ PV A  +P +L +++   +L
Sbjct: 321 GLMGLISPVLAGWLPNLLGLAMGGWLL 347


>gi|193212079|ref|YP_001998032.1| permease YjgP/YjgQ family protein [Chlorobaculum parvum NCIB 8327]
 gi|193085556|gb|ACF10832.1| permease YjgP/YjgQ family protein [Chlorobaculum parvum NCIB 8327]
          Length = 383

 Score = 40.0 bits (92), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 76/367 (20%), Positives = 150/367 (40%), Gaps = 44/367 (11%)

Query: 1   MPG-----ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL- 54
           +PG     I+ RY  + +L T  +F L +   +F+I +N I+N +    +  I  G ++ 
Sbjct: 20  LPGLGKLSIIDRYIIRQFL-TIFFFSLASFAALFII-INLIEN-LDRFMSRQIPVGQIII 76

Query: 55  -AATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG 113
              + +P       P   L+ ++ V   L+  SEL   +A G+S+ +L+ PF++ +  + 
Sbjct: 77  YYLSGLPDTFLLTSPLSVLLASLFVTGKLSMQSELPALKAAGMSLSRLMKPFLLATFFIT 136

Query: 114 IFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
            F ++    I  +   +     +++  +  +Q+ + +   +  N          +IL   
Sbjct: 137 AFNLVNSCFITPAMYDLSKGYEKRYLKSQKEQQEEAVHIRESKN----------RILTVG 186

Query: 174 HIWEDFTSI------TIDKKNKIIHRKDADLA---------IIYNDKVKLKKVVEYQYGR 218
            I  D  S       T D  +++  R DAD           + YN K +      +  GR
Sbjct: 187 QINRDRQSAVSVSLETFD-GSRLASRLDADSLRISSNGRHWVFYNTKQR-----TFVNGR 240

Query: 219 IPIDKN--STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYF 276
             +  N  + TL + +  + F          +  + +  ++   +S +    RAE +   
Sbjct: 241 ETLVANPGADTLKLALAKNTFTMIDADPDEMNLVQHLAFIAQKKRSGLPGLERAEVELQT 300

Query: 277 LIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLP 336
            I +PL  + + LI   +S    RS    +  A  +  G     ++  + S G  G++ P
Sbjct: 301 KIALPLASMLIVLIGVPLSTRKKRSGLA-LEAATSLLIGLFYLGMLKTIGSLGYDGLINP 359

Query: 337 VAAALIP 343
           V AA +P
Sbjct: 360 VLAAWLP 366


>gi|261855830|ref|YP_003263113.1| permease YjgP/YjgQ family protein [Halothiobacillus neapolitanus
           c2]
 gi|261836299|gb|ACX96066.1| permease YjgP/YjgQ family protein [Halothiobacillus neapolitanus
           c2]
          Length = 376

 Score = 40.0 bits (92), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 42  ELPNYSISRGAVLAATRV----PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
           ELP  + S  A+ A + V    P  +    P   LV  ++   NL   SEL + R  G+S
Sbjct: 35  ELPKVNASYSAIDALSFVLMTTPGYLYDFYPAAVLVGGLLSLGNLAAHSELTVMRCSGMS 94

Query: 98  IWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNG 142
           +++L  P +VG+ +L +  +L+   I   G++   ++  + + +G
Sbjct: 95  MFRLARPVLVGATILALIGMLMGETIGAWGQEKANEMRAEAQGSG 139


>gi|323697853|ref|ZP_08109765.1| permease YjgP/YjgQ family protein [Desulfovibrio sp. ND132]
 gi|323457785|gb|EGB13650.1| permease YjgP/YjgQ family protein [Desulfovibrio desulfuricans
           ND132]
          Length = 375

 Score = 40.0 bits (92), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 129/293 (44%), Gaps = 23/293 (7%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++PLI+ Q++P + L+  +V    L R+ E++  RA G+S    +  FV+ +++     +
Sbjct: 57  KIPLIVSQLMPAVFLLAMVVQLGVLARSREMLALRAGGVSFAWFIRFFVIYALIWSCGQL 116

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           +    +   GE+   +  + WK++  K++ D +    +        + AK+  P      
Sbjct: 117 VFSQFLGVFGEQ---EANRIWKEDVRKKQLDELTIHNLWFRDGPFIVQAKEAQPSKSRAS 173

Query: 178 DFT--SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR-IPIDKNSTTLNIPIKM 234
           D T    T D + ++I   +A  A+I +    L  V E      I +D+ S  L++   +
Sbjct: 174 DITIYEFTTDNQ-ELIRILNAKKALIDDHGWGLLDVHELDTRTFITVDRPSQFLSVRQNL 232

Query: 235 DGFQ--KFSEQFASRSFYEIIKKM-----SFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
             +   +     A     E+ + +     S SN   +   +  +  + F +V+ + L+A+
Sbjct: 233 KAYAAVELKGDTAQLPLIELSRAIARLQESGSNVEMLLTIWHGKLSYAFSMVV-MALLAL 291

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
            L+       FS +    I +A  +   F+ Y +  +  + G+ G+L P+ AA
Sbjct: 292 VLVT------FSENVYANIGLALILI--FIQYGMHVVGATAGEKGVLPPILAA 336


>gi|291614864|ref|YP_003525021.1| permease YjgP/YjgQ family protein [Sideroxydans lithotrophicus
           ES-1]
 gi|291584976|gb|ADE12634.1| permease YjgP/YjgQ family protein [Sideroxydans lithotrophicus
           ES-1]
          Length = 358

 Score = 40.0 bits (92), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 75/363 (20%), Positives = 149/363 (41%), Gaps = 29/363 (7%)

Query: 13  YLKTTLY----FLLGAMILVF-VIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           YL+  +Y     +  A+I++F ++DL    N MG   +Y +    +     +P  I ++ 
Sbjct: 7   YLRREIYASVALVFAALIMLFALLDLVNELNSMGR-GDYRLGYVLLFVTLTIPGHIYELF 65

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           P   L+  I     +  +SEL + R+ G+S+ Q++   V   + L +   L    IA   
Sbjct: 66  PVAVLIGTIFALVQMAASSELTVYRSSGVSLKQMIVMLVKIGLPLVVLCFLFGEVIAPPS 125

Query: 128 EKIGIDL---IQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITI 184
           E++  +L    Q  K +  + +S +  W +     +  FI  + +LP+  +  D +    
Sbjct: 126 ERMAQELRMKAQNLKVSVKEFRSGV--WAK----DERSFINVRSMLPDTSL-LDVSIYEF 178

Query: 185 DKKNKIIHRKDADLA-IIYNDKVKLKKVVEYQYGR-------IPIDKNSTTLNIPIKMDG 236
           D    +     A+ A  +  D+ +L  V +  + +        P  +  T+LN P  +  
Sbjct: 179 DATYHLRSITSAEHASYLDEDRWQLDGVRQTLFSKQGATTDNRPRAEWHTSLN-PDILSV 237

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
                EQ ++ + Y+    +    + N     R E   +  +V PL ++ M L+A   S 
Sbjct: 238 LLVVPEQMSAWNLYQYTMHL----RENHQKTSRYEIAMWNKLVYPLAVLVMMLLALPFSA 293

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
              R       +  GI  G   + +  +  + G      P+ +A     L ++L++ +L 
Sbjct: 294 YQRREGGISGKIFMGIVLGLSFHFVGRLFANVGALNDWSPLLSATAMSWLFLALAMGMLW 353

Query: 357 QKE 359
           + E
Sbjct: 354 RTE 356


>gi|124009520|ref|ZP_01694195.1| putative permease, YjgP/YjgQ family [Microscilla marina ATCC 23134]
 gi|123984866|gb|EAY24834.1| putative permease, YjgP/YjgQ family [Microscilla marina ATCC 23134]
          Length = 371

 Score = 39.7 bits (91), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 136/312 (43%), Gaps = 37/312 (11%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P     + P +  +  + V   L   +E++   + G+S  ++L P+++GS L+ + T  
Sbjct: 59  IPYWANSLSPILIFIATVFVTARLATHTEIIAILSSGVSFKRMLVPYLLGSSLIAVLTFY 118

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQK---SDIIPWMQISNPQQDIFIGAKKILPENHI 175
           +I  +     ++ +    ++++   K K   +D    ++I+ P    +I +      +H+
Sbjct: 119 LIGWVIPKANRVRL----KFENTHIKDKFYFTDRNVHLKIA-PNTFAYIESYD--NTSHV 171

Query: 176 WEDFTSITID-------KKNKIIHRKDADLAIIYNDKVKLK------KVVEYQYG----- 217
              FT   I        ++ K ++ K     I++ DK + K      K+ E+  G     
Sbjct: 172 GYKFTLENISGFEYDGKRQQKKLNSKVECRRILW-DKDRKKWVMENYKITEFNRGDSLNY 230

Query: 218 RIPIDKN-STTLNI-PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFY 275
           +I   ++  T +N+ P   +    F+EQ  S      I ++       +   Y  E   Y
Sbjct: 231 KITYGQSLDTLMNLKPSDFESKYMFNEQLTSDQLEAYIAELKQRGVGKL-ETYLVER--Y 287

Query: 276 FLIVIPLMLVAMTLIAASVSLEFSRSNQP-RIIVAYGIFSGFMLYTIITIMKSFGKSGIL 334
             +  P  ++ +T+I   VS   +R     +I V +G+   F+   +I + +S GK+G L
Sbjct: 288 ERMAYPFAVIILTVIGVIVSSRKTREGAGLQIAVGFGL--AFIYVMLIMVSRSIGKNGEL 345

Query: 335 LPVAAALIPVIL 346
            P+ AA +P IL
Sbjct: 346 PPLVAAWMPNIL 357


>gi|320107369|ref|YP_004182959.1| permease YjgP/YjgQ family protein [Terriglobus saanensis SP1PR4]
 gi|319925890|gb|ADV82965.1| permease YjgP/YjgQ family protein [Terriglobus saanensis SP1PR4]
          Length = 782

 Score = 39.7 bits (91), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP-FVVGSIL-LGIFT 116
           +P +I  + P   L+  +V    LNR+SEL   +A G+S+++++ P FV+ ++L +G+F 
Sbjct: 472 IPYMIYSLTPLCALIAVLVTVGGLNRSSELTAMKASGMSLYRIVAPIFVLAAVLAVGLFA 531


>gi|332307892|ref|YP_004435743.1| permease YjgP/YjgQ family protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175221|gb|AEE24475.1| permease YjgP/YjgQ family protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 368

 Score = 39.7 bits (91), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 70/325 (21%), Positives = 134/325 (41%), Gaps = 53/325 (16%)

Query: 4   ILWRYFFKYYLKT-TLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVP 60
           +++RY  K  +K+ T  FL    +L+ +   N+    + E  N  I    VL   A  +P
Sbjct: 2   LIFRYLVKETVKSQTAVFL----VLMAIFITNKFVRVLSEASNGDIPASLVLGFLALSMP 57

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT---V 117
           ++   I+P    +  ++    L   SE+ + RA GIS W +    +V ++++ + T    
Sbjct: 58  VLASLILPLSLFLGIMLAHGRLYVDSEMTVMRACGISEWYVTRVMLVLAVIMALITGAMT 117

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP--WMQISNPQQDIFIG--AKKILPEN 173
           L + P++   E     L +Q     D   + +IP  + Q +N +  IF+        P  
Sbjct: 118 LWVAPMSVERE---YQLEEQ--AGADTGLTTLIPGRFQQTANEKAVIFVHEIGNDSEPLK 172

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
            ++      T D +N  +H       ++Y  +  L++        +P    +  L   I+
Sbjct: 173 RVFMAQHDTTTDSQN--VH-------LVYAKQGGLRE--------LPDGSETLVLGDGIQ 215

Query: 234 MDG-----------FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYR----AETQFYFLI 278
            +G           F ++  Q A +   +  +K+S    + +F++      AE Q+ F  
Sbjct: 216 YEGTLGEKDYRVVEFGEYQIQIAEQEAEQKRRKLSAYTTAQLFNDPSIDAIAELQWRF-- 273

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQ 303
            IPL L  + +IA  +S    R  +
Sbjct: 274 AIPLSLFFLVIIAVPLSAADPRQGR 298


>gi|109899862|ref|YP_663117.1| permease YjgP/YjgQ [Pseudoalteromonas atlantica T6c]
 gi|109702143|gb|ABG42063.1| permease YjgP/YjgQ [Pseudoalteromonas atlantica T6c]
          Length = 368

 Score = 39.7 bits (91), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 71/325 (21%), Positives = 132/325 (40%), Gaps = 53/325 (16%)

Query: 4   ILWRYFFKYYLKT-TLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVP 60
           +++RY  K  +K+ T  FL    +L+ +   N+    + E  N  I    VL   A  +P
Sbjct: 2   LIFRYLVKETVKSQTAVFL----VLMAIFITNKFVRVLSEASNGDIPASLVLGFLALSMP 57

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT---V 117
           ++   I+P    +  ++    L   SE+ + RA GIS W +    +V ++++ + T    
Sbjct: 58  VLASLILPLSLFLGIMLAHGRLYVDSEMTVMRACGISEWYVTRVMLVLAVIMALITGAMT 117

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIP--WMQISNPQQDIFIG--AKKILPEN 173
           L I P++   E     L +Q     D   + +IP  + Q +N +  IF+        P  
Sbjct: 118 LWIAPLSVERE---YQLEEQ--AGADTGLTTLIPGRFQQTANEKAVIFVHEIGNDSEPLK 172

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
            ++      T D +N  +H       ++Y  +  L++        +P    +  L   I+
Sbjct: 173 RVFMAQHDTTTDSQN--VH-------LVYAKQGGLRE--------LPDGSETLVLGDGIQ 215

Query: 234 MDG-----------FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYR----AETQFYFLI 278
            +G           F ++  Q A +   +  +K+S      +F +      AE Q+ F  
Sbjct: 216 YEGTLGEKDYRVVEFGEYQIQIAEQEAEQKRRKLSAYTTMQLFEDSSIDAIAELQWRF-- 273

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQ 303
            IPL L  + +IA  +S    R  +
Sbjct: 274 AIPLSLFFLVIIAVPLSAADPRQGR 298


>gi|163759136|ref|ZP_02166222.1| hypothetical protein HPDFL43_05210 [Hoeflea phototrophica DFL-43]
 gi|162283540|gb|EDQ33825.1| hypothetical protein HPDFL43_05210 [Hoeflea phototrophica DFL-43]
          Length = 385

 Score = 39.7 bits (91), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%)

Query: 53  VLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
           +LAAT +P +I  + PF  L+    V   +N  SELV+  A G     +L P +  S+ L
Sbjct: 40  LLAATIIPSVISVVAPFALLIGVSQVLSGMNSDSELVVIEAAGARPATVLRPVMALSVAL 99

Query: 113 GIFTVLVIN 121
            I  +LV N
Sbjct: 100 SIMVLLVAN 108


>gi|87198520|ref|YP_495777.1| permease YjgP/YjgQ [Novosphingobium aromaticivorans DSM 12444]
 gi|87134201|gb|ABD24943.1| permease YjgP/YjgQ [Novosphingobium aromaticivorans DSM 12444]
          Length = 366

 Score = 39.7 bits (91), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 46/103 (44%), Gaps = 12/103 (11%)

Query: 38  NQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
           N  GEL  Y         + R+P ++ + +P+  L+  I+    LN+ SE++  +A G+S
Sbjct: 52  NGQGELLTY--------VSLRMPQLVSRFLPYSVLLATIITLMTLNQNSEVIAMKAAGLS 103

Query: 98  IWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKD 140
             Q+L P  + +    + T      I T         ++ W+D
Sbjct: 104 AHQVLAPLFLVAAATSVVTFAFNERIVTRSTST----LKAWQD 142


>gi|224825294|ref|ZP_03698399.1| permease YjgP/YjgQ family protein [Lutiella nitroferrum 2002]
 gi|224602215|gb|EEG08393.1| permease YjgP/YjgQ family protein [Lutiella nitroferrum 2002]
          Length = 358

 Score = 39.7 bits (91), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 68/330 (20%), Positives = 131/330 (39%), Gaps = 31/330 (9%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
           +Y + +  +  A  +P    +++P + L+  +V    L  +SE  I R  G+++ Q    
Sbjct: 43  SYGVPQMLLYIALLMPGHAYELMPLVVLIGGMVAMTQLATSSEYTIIRTSGVTLAQ---- 98

Query: 105 FVVGSIL-LGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQ--KSDIIPWMQISNPQQD 161
            V G +L  GI   ++   +   G        ++ K +  K     +    + + + Q  
Sbjct: 99  -VAGVLLRFGIGFAVITGLLGEFGAPFSEKQAERMKLSATKSMVTQEFHSGIWVKDDQN- 156

Query: 162 IFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKV--KLKKVVEYQYGRI 219
            FI   ++LP+N +       T DK  +++  + A+       +   +L+KV E   G  
Sbjct: 157 -FINVGEMLPDNTLL-GVRIYTYDKDYRLVQTRFAERGTYQRPQHVWRLEKVKETTLG-- 212

Query: 220 PIDKNSTTLNI----------PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYR 269
             DK +TT  +          P  +D      EQ ++      I+ +    +SN     R
Sbjct: 213 --DKATTTRQLNTLDWHSVIEPSILDVLLVVPEQMSAMDLTTYIEHL----RSNEQKTQR 266

Query: 270 AETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFG 329
            E   +     PL  ++M L+A + +    R  Q  I +  GI  G   + +  +    G
Sbjct: 267 YEIALWSKFFYPLACISMALVALAFTPRQRRHAQLGIRLFVGICLGVAFHFVNRLFAHLG 326

Query: 330 KSGILLPVAAALIPVILTISLSILILLQKE 359
                  + AA +P +L +   I I +++E
Sbjct: 327 LLYDWNAMFAATLPTLLFLLAGITITVRQE 356


>gi|172036161|ref|YP_001802662.1| putative permease YjgP/YjgQ [Cyanothece sp. ATCC 51142]
 gi|171697615|gb|ACB50596.1| putative permease YjgP/YjgQ [Cyanothece sp. ATCC 51142]
          Length = 401

 Score = 39.7 bits (91), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 68/328 (20%), Positives = 139/328 (42%), Gaps = 54/328 (16%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           +VP      +P   ++  ++ +  L+  SEL+  R  G+S+++L+ P VV S+++   T 
Sbjct: 84  KVPEFTAYALPISVMLSTLLTYGRLSNDSELIAFRGCGVSLYRLIVPAVVMSLVVTGVTF 143

Query: 118 LV---INPIAT-SGEKIGIDLIQQWKDNGDKQKSDII--PWMQISNPQQDIFIGAKKI-L 170
           LV   + P A      I ++ +Q+  ++   Q  DI    + Q+  P  +     K +  
Sbjct: 144 LVSELVVPAANYRATAILVEYLQE--EHPYWQNKDIFYPDYEQVVLPNGEKEKRLKHLFF 201

Query: 171 PENHIWEDFTSITI-----DKKNKIIHRKDADL-----------AIIYN--DKVKLKKVV 212
            E    ++  ++T+     ++ N+I+    A               IY        K+  
Sbjct: 202 AEQFDGQNLKTLTVLEWLEERLNRIVVSDSATWNGQEETWDFFDGTIYQLAPDASYKEAY 261

Query: 213 EYQYGRIPIDKNSTTLNI----PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNY 268
            +++ ++P+ K +    +    P +M+  Q       +R + +I+K M    K  +F   
Sbjct: 262 PFEHRQLPLTKAAFEFALQGRDPYEMNIIQ-------ARQYMKILKMMGDDKKLRMFQ-V 313

Query: 269 RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYG-----IFSGFMLYTIIT 323
           R + +  F    P + V   ++ +++    S   Q      +G     IFS ++L  +I 
Sbjct: 314 RIQQKLAF----PFICVVFGVVGSALG---SMPQQMSRATGFGLSVVIIFSYYLLGFLIG 366

Query: 324 IMKSFGKSGILLPVAAALIPVILTISLS 351
              S G  G++ PV A  +P IL +++ 
Sbjct: 367 ---SLGLMGLISPVLAGWLPNILGLAMG 391


>gi|255066290|ref|ZP_05318145.1| permease, YjgP/YjgQ family [Neisseria sicca ATCC 29256]
 gi|255049500|gb|EET44964.1| permease, YjgP/YjgQ family [Neisseria sicca ATCC 29256]
          Length = 356

 Score = 39.7 bits (91), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 92/207 (44%), Gaps = 25/207 (12%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAA---TRVPLII 63
           RY  +      +Y LL  + L       EI N++G+L   S + GA +A     ++P   
Sbjct: 6   RYIIRQMAVMAVYALLAFLALY---SFFEIINEVGDLGKGSYN-GATMAQYVLMQMPARA 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   L+  +V    L   SEL + +A G+S  +LL       ++L  F ++     
Sbjct: 62  YELMPLAVLIGGLVSLSQLAAGSELTVIKASGMSTKKLL-------LILSQFGLIFAIAT 114

Query: 124 ATSGEKIGIDLIQQWKD------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           A  GE I   L Q+ ++      NG     +   W++    +++  I  +++LP+ H   
Sbjct: 115 AALGEWIAPVLSQKAENIKSAAINGKISTGNTGLWLK----EKNSIINVREMLPD-HTLL 169

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYND 204
                  + KN++    +A+ A++ ND
Sbjct: 170 GIKIWVRNDKNELRQATEAESAVLNND 196


>gi|126031979|gb|ABN71555.1| putative permease [uncultured bacterium]
          Length = 365

 Score = 39.7 bits (91), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 33/53 (62%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSI 110
           R+P ++ + +P+  L+  I+    LN+ SE+V  +A G+S  Q+L P ++ ++
Sbjct: 64  RLPQLVARFLPYSALLATIITLATLNQNSEVVAMKAAGLSAHQVLAPLLLTAL 116


>gi|332707452|ref|ZP_08427501.1| putative permease [Lyngbya majuscula 3L]
 gi|332353803|gb|EGJ33294.1| putative permease [Lyngbya majuscula 3L]
          Length = 388

 Score = 39.7 bits (91), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 5/80 (6%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG---- 113
           ++P  I   +P   L+  ++ +  L+  SEL+  R+ G+SI++L+ P VV S+L+     
Sbjct: 72  QIPQFISYALPMSMLLAALMAYSRLSSDSELIAMRSFGVSIYRLVIPAVVVSLLVTSLTF 131

Query: 114 IFTVLVINPIATSGEKIGID 133
           +F  LV+ P A    KI +D
Sbjct: 132 VFNELVV-PAANYQSKITLD 150


>gi|327481778|gb|AEA85088.1| permease [Pseudomonas stutzeri DSM 4166]
          Length = 353

 Score = 39.7 bits (91), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 65/347 (18%), Positives = 132/347 (38%), Gaps = 38/347 (10%)

Query: 16  TTLYFLLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVV 74
           T L  ++G A++  F+ +L ++Q       NY +           P  +  ++P   L+ 
Sbjct: 18  TVLGIIVGLALLFAFIDELGDVQG------NYGLGDALQYVLLTSPRRLYDMLPMAALIG 71

Query: 75  NIVVFFNLNRTSELVISRAIGISIWQL----LNP---FVVGSILLGIFTVLVINPIATSG 127
            ++    L  +SEL I RA G+S+ ++    + P    +V  IL+G +   +   IA + 
Sbjct: 72  CLIGLGTLASSSELTIMRAAGVSLGRIVLSVMKPMLVLLVAGILIGEYVAPLTEDIAQAR 131

Query: 128 EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKK 187
             +        +  G+ Q S    W +    Q++ F+    + P   +    T    D++
Sbjct: 132 RSLA-------QGAGEAQSSKRGLWHR----QENEFVHVNAVQPGG-VLVGVTRYRFDEE 179

Query: 188 NKIIHRKDADLAIIYNDKVKLKKVVEYQY-------GRIPIDKNSTTLNIPIKMDGFQKF 240
            +++    A  A    D  +L+ +    +        R P ++    L  P  +      
Sbjct: 180 RRLLSSSFARRASYQGDHWRLENIATTHFRGDHTEVARAPEERWDVQLT-PQLLGTVVME 238

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
            E  +    +  I  +         +N R    F+  ++ P + VA+ L+A S      R
Sbjct: 239 PEALSITGLWRYIHYLGEQG----LNNSRYWLAFWTKVLQPAVTVALVLLAISFIFGPLR 294

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
           S      +  G+  GF+   I  ++    +     P+ A ++P  + 
Sbjct: 295 SVTLGQRIFTGVVVGFVFRIIQDLLGPASQVFGFSPLLAVVLPACVC 341


>gi|254282266|ref|ZP_04957234.1| permease YjgP/YjgQ family protein [gamma proteobacterium NOR51-B]
 gi|219678469|gb|EED34818.1| permease YjgP/YjgQ family protein [gamma proteobacterium NOR51-B]
          Length = 353

 Score = 39.7 bits (91), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 64/312 (20%), Positives = 124/312 (39%), Gaps = 27/312 (8%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P  I + +PF  L+  +V    L  +SELV+ R+ G+SI QL    +  ++L  +   +
Sbjct: 56  LPRRIHEFMPFAALIGALVGLGRLAGSSELVVVRSAGVSIGQLAISVMKPALLAAVVGFV 115

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           V + IA S E++ I      +    + +S +       N     FI    +     +   
Sbjct: 116 VGDFIAPSSEQLAITQ----RALAQRSESTVSARHGSWNRDGGTFIHVSAV-QRGGVAYG 170

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL--------NI 230
            +  + D+   ++   +A+      D   L++VV  Q     ++   TT+        N 
Sbjct: 171 LSLFSFDEDKHLVRSLNAERGTYRGDHWLLEEVVLTQ-----LESEKTTVSQYLTWRWNT 225

Query: 231 PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLI 290
            I  D       +  S   +++     F  +  +      E  F+  +  PL +  + L+
Sbjct: 226 QITPDLLVLEVVEPESLPVFKLWPWAKFLEQQGLTAT-DIELAFWRKVTQPLAIAGLVLV 284

Query: 291 AASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKS-FGKSGILL---PVAAALIPVIL 346
           A S      R       +   IF+G ++  +  I +  FG + +L    PV AA+ P++ 
Sbjct: 285 AMSFIFGPLREGS----MGARIFAGVIVGVMFRISQDFFGPASVLFGLPPVLAAITPILF 340

Query: 347 TISLSILILLQK 358
                I +L ++
Sbjct: 341 CWLAGIWLLNRR 352


>gi|313206715|ref|YP_004045892.1| permease yjgp/yjgq family protein [Riemerella anatipestifer DSM
           15868]
 gi|312446031|gb|ADQ82386.1| permease YjgP/YjgQ family protein [Riemerella anatipestifer DSM
           15868]
 gi|315023785|gb|EFT36787.1| hypothetical protein RAYM_00180 [Riemerella anatipestifer RA-YM]
 gi|325335845|gb|ADZ12119.1| permease YjgP/YjgQ family protein [Riemerella anatipestifer RA-GD]
          Length = 364

 Score = 39.7 bits (91), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 75/369 (20%), Positives = 167/369 (45%), Gaps = 32/369 (8%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  K +L T ++ L+   I+V V+D   IQ +   +     + G  L       +I  I+
Sbjct: 7   YIIKKFLGTLVFMLVLLSIIVIVVD---IQAKAPNIEKSGYTVGDFLLHFYPFWMIYLIL 63

Query: 68  PFITLVVNIVVFFNLNR---TSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
            F++++V I V +  +R    +E+V   + G S  +   P+ + ++ + +F +L++N  A
Sbjct: 64  TFMSILVFISVIYFSSRMADNTEIVAIVSSGASFHRFARPYFMVAVGIALF-MLMLNHFA 122

Query: 125 TSGEKIGIDLIQQWKDNGDKQ--KSDIIPWMQISNPQQDIFIGA---KKILPENHIWEDF 179
                +  + +  + ++  +Q  K+  +      +P + +FIG+   K+    +++++ F
Sbjct: 123 LPWANVKKNELMVFTESQVRQEEKNRSVAISAQMSPTEYVFIGSYHRKEARGSDYLYQKF 182

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVK---LKKVVEYQYGRIPIDK--NSTTLNIPIKM 234
                DK NK+IH+   D  + +++K +   +    E + G+   +K  N T        
Sbjct: 183 -----DKNNKLIHQIRGDY-VSWDEKKQAFSITSFYEKKAGKNETEKLSNGTQTYQSFGY 236

Query: 235 DGFQKFSEQF--ASRSFYEIIKKMSFSNKSNIFHNYRAET---QFYFLIVIPLMLVAMTL 289
              + F ++    +++  E++K   F N+  I  N    T   + +    +P+ ++ +T+
Sbjct: 237 PPEELFPDELLGENKTTPELVK---FINREKIKGNGNINTYLNELHARTSMPVSIIILTI 293

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           +  +++ E  R     + +A GI   F+       +K    S IL P  A  +P  +   
Sbjct: 294 LGLALASEKKRGGIG-VNLAVGIALAFVFIFSFEALKVVSSSKILTPFVAMWMPNFVFAP 352

Query: 350 LSILILLQK 358
           L++L+  ++
Sbjct: 353 LALLLYFRR 361


>gi|149200566|ref|ZP_01877574.1| putative permease, YjgP/YjgQ family protein [Lentisphaera araneosa
           HTCC2155]
 gi|149136338|gb|EDM24783.1| putative permease, YjgP/YjgQ family protein [Lentisphaera araneosa
           HTCC2155]
          Length = 329

 Score = 39.3 bits (90), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 134/326 (41%), Gaps = 40/326 (12%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL------- 111
           +P I+   IP  +LV   +VF  ++  +E+   RA GIS+WQ++NP ++ +++       
Sbjct: 3   LPKILAYAIPIASLVSVTLVFSRMSAENEITAMRASGISLWQIVNPAILLALVSSACLFY 62

Query: 112 LGIFTV--------------LVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISN 157
           L +F V              L+ NP         IDL +   + G+K++   +  +++  
Sbjct: 63  LNMFAVPHLEATRKSMMKGELLSNPSTFLRGGTTIDLGKLSVEIGEKKEDGTLKDLRVIE 122

Query: 158 PQQDIFIGAKKILPENH--IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ 215
             +   I + ++L ++   I     S TI+  + II   D +   + NDK + K +   +
Sbjct: 123 VDKATDIVSNQLLAQSGKIINTTENSFTIEFIDVII--LDNNWEFLKNDKGENKSLSGVK 180

Query: 216 YGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKM-----SFSNKSNIFHNYRA 270
             R+P    + T     +++     S     R+ Y  IK+M        NK       R 
Sbjct: 181 VTRLPNANTTYTFYTNDELN-----SGNLRKRAKYLNIKEMIARLAVLKNKEQTKTVRRE 235

Query: 271 ETQFYFLIVIPLML----VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMK 326
            T   + +   L L    +A  L+A    L  SRS +  I +   +      Y  I I  
Sbjct: 236 HTDLLYNLNKNLALSFSPLAFLLMALPFGLRSSRS-ETSIGLLISLIVMMTYYATILITG 294

Query: 327 SFGKSGILLPVAAALIPVILTISLSI 352
           +F K   + P     +P I+  SL +
Sbjct: 295 AFDKHTAMHPEILVWLPNIIFQSLGL 320


>gi|262277385|ref|ZP_06055178.1| putative permease, YjgP/YjgQ family [alpha proteobacterium HIMB114]
 gi|262224488|gb|EEY74947.1| putative permease, YjgP/YjgQ family [alpha proteobacterium HIMB114]
          Length = 365

 Score = 39.3 bits (90), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 47/88 (53%)

Query: 273 QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSG 332
           +F+  + +P +L AM +++   +++ + +    I    GI +G ++Y    +  + GKSG
Sbjct: 278 KFHKYLSLPFLLFAMIVLSTFFTIKMNFTFNNFIYAFLGILTGIIVYFFYDLSIAVGKSG 337

Query: 333 ILLPVAAALIPVILTISLSILILLQKED 360
            L  + +  +PVIL    SI IL+  ED
Sbjct: 338 KLPLILSVWMPVILINVFSIYILINNED 365


>gi|37522902|ref|NP_926279.1| hypothetical protein gvip459 [Gloeobacter violaceus PCC 7421]
 gi|35213904|dbj|BAC91274.1| ycf84 [Gloeobacter violaceus PCC 7421]
          Length = 384

 Score = 39.3 bits (90), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 63/335 (18%), Positives = 133/335 (39%), Gaps = 40/335 (11%)

Query: 47  SISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFV 106
           S++  A + A R+P +I    P   L+  ++ +  L+  +E V  RA G+S+++L+ P +
Sbjct: 59  SVTVAAQVFALRLPSVIVITFPTAMLLATLLAYARLSGDAETVAMRACGMSVYRLVLPAL 118

Query: 107 VGSILLGIFTVLVINPIATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFI 164
              +L+   T +    +  +       L+ Q   +D  D QK +II       P+   F+
Sbjct: 119 AVGLLVTGATFMCNELVVPASNAEASRLLFQAIDRDKPDFQKDNII------YPEYG-FV 171

Query: 165 GAKKILPENH--------------IWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKK 210
             +   P  H              I  + T   +D     I++     A +Y+++     
Sbjct: 172 TPRDGRPTYHTLVRLFYARQFAGGIMRELT--VLDYSQDAINQVITAAAAVYDNRSGSWT 229

Query: 211 VVEYQ-YGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRS---------FYEIIKKMSFSN 260
           + +   Y   P       L    +     +  EQF   +           + I+++  S 
Sbjct: 230 LQDGTVYVVAPDGSYRNVLRFKRQQVKLSERPEQFGGGARPEDLPIAQLSDYIRRLELSQ 289

Query: 261 KSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYT 320
           +         + ++     IP+      L+ A++ L   R++   + +   I   F  Y 
Sbjct: 290 QQVRTLQVSLQQKY----AIPVTCFVFALVGATLGLRRVRTSNA-LGLGLSILIIFGYYL 344

Query: 321 IITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           ++ + ++ G++G++ P   A  P + T +L +L+L
Sbjct: 345 LMFVAQALGQTGVIAPWLGAWAPNLATGALGVLLL 379


>gi|323697852|ref|ZP_08109764.1| permease YjgP/YjgQ family protein [Desulfovibrio sp. ND132]
 gi|323457784|gb|EGB13649.1| permease YjgP/YjgQ family protein [Desulfovibrio desulfuricans
           ND132]
          Length = 391

 Score = 39.3 bits (90), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 131/313 (41%), Gaps = 29/313 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
            P  +  I P  T++   + F  ++  +ELV  +A G+S++++L   V+   L  +F   
Sbjct: 57  TPFFLLLITPIATMLSVFLTFLRMSTDNELVALKASGVSLYRMLPAPVLFCSLCTLFAFF 116

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ-QDIFIGAKKILPENHIWE 177
               I+  G   G+D+ +       K  S       + N +  +I   A ++  +N   E
Sbjct: 117 ----ISFWGLAWGMDMFKTKLYYFAKTHSKFALQPGVFNKEFPNITFYAHQV--DNEKGE 170

Query: 178 -DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNI------ 230
             F  +  D          A  A + ++  + K  V +  GRI   ++   LNI      
Sbjct: 171 LKFAFVRDDSIKGTSVVVVAPEAEVVSNPQEAKIHVVFHNGRI-FRQSGDELNILKFRKY 229

Query: 231 PIKMD------GFQKFSEQFASR----SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVI 280
            IK+D      GF  F+EQ A         +I K  S     N     + +T+FY  + +
Sbjct: 230 SIKLDLGKLLTGFN-FAEQKAKDMPFFRLRDIRKDHSLMPHENERFFRKVDTEFYKRLTL 288

Query: 281 PLMLVAMTLIAASVSLEF-SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           PL    + L A  ++  F     Q  +++A G+F   + YT+ +I  S G+SG + P   
Sbjct: 289 PLGCFILGLFAIPIASIFRGLRQQYGLLLAMGLF--MVYYTMFSIGVSMGESGTIPPEYG 346

Query: 340 ALIPVILTISLSI 352
              P IL I +++
Sbjct: 347 MWAPDILFIFVAL 359


>gi|282860179|ref|ZP_06269254.1| putative membrane protein [Prevotella bivia JCVIHMP010]
 gi|282587068|gb|EFB92298.1| putative membrane protein [Prevotella bivia JCVIHMP010]
          Length = 633

 Score = 39.3 bits (90), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 75/166 (45%), Gaps = 30/166 (18%)

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +++ Q +P   L+ +++ + NL  +SEL   ++ GIS++Q     +  +IL+ I +    
Sbjct: 62  MLVPQALPLAVLLSSLMTYGNLGESSELTAIKSAGISLFQSFRGLIATTILITILSFYFQ 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISN-------PQQDIFIGAKKILPEN 173
           N +A   +K    L+        KQKS   P ++I         PQ ++++  KK L   
Sbjct: 122 NNVAPIAQKHIYQLLISM-----KQKS---PELEIPEGVFYDGIPQTNLYV-EKKDLNTG 172

Query: 174 HIWEDFTSITIDKKNKIIHRKD---ADLAIIYNDKVKLKKVVEYQY 216
           H++           N +++R      D AII  D   L+   E ++
Sbjct: 173 HLY-----------NIMVYRMTDSYEDQAIILADSGMLQSTAEKKH 207


>gi|78356992|ref|YP_388441.1| permease [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78219397|gb|ABB38746.1| permease, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 359

 Score = 39.3 bits (90), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 72/347 (20%), Positives = 149/347 (42%), Gaps = 34/347 (9%)

Query: 11  KYYLKTTLYF-LLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPLIIQQII 67
           +Y L+T L+  +L   I   +  L+++ +++ +     +    +L   A ++PLII QI+
Sbjct: 6   RYLLRTNLFLTMLTLTIGTGIYLLSDLFDRLDDFLGAGLGLKVILTYFAVKIPLIISQIL 65

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSG 127
           P + L+  ++    + R  ELV  +A GIS  +L   F++ +++     +     +   G
Sbjct: 66  PAVFLLSAVIQLCVMARDRELVALQAGGISFLRLARFFIIYALIWSAVQLGFSQVLGIYG 125

Query: 128 EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT--SITID 185
           E+   +  + WK+    ++ D +    +   +    I  + + P        T   +T D
Sbjct: 126 ER---EASRIWKEQVRNREIDEVQLTNLWFTEHGRIIHLETLHPAAQKGSGITVYELTPD 182

Query: 186 KKN--KIIHRKD--ADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
           + +  ++I  K   AD +    D   +     Y+         S ++ +PI+ D  + FS
Sbjct: 183 ELSVQRVIRGKSFRADSSGWTLDGCDILIPGSYEVA------TSESIVLPIEQD-VKAFS 235

Query: 242 --------EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
                    +       + I +++ S  SN+       T ++  +     LV M L+A +
Sbjct: 236 IVDPRGDPSRLPLWQLQDAIARLTESG-SNV---EALRTAWHMKLSYAFSLVTMALLALA 291

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           +    +  +   I V   +   F+ YT+ T+  S G++GI+ P+ AA
Sbjct: 292 L---ITWRDSIYINVGTSLLLVFVFYTLFTVGGSLGENGIVPPLFAA 335


>gi|258645769|ref|ZP_05733238.1| membrane protein, YjgP/YjgQ family [Dialister invisus DSM 15470]
 gi|260403140|gb|EEW96687.1| membrane protein, YjgP/YjgQ family [Dialister invisus DSM 15470]
          Length = 361

 Score = 39.3 bits (90), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 59/311 (18%), Positives = 125/311 (40%), Gaps = 26/311 (8%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P II    P   L+  ++    L+ +SEL++ R  G S  +L+ P  + + L+ +  V 
Sbjct: 58  LPRIIVYTFPMAVLLGALMATSRLSGSSELIVMRTSGQSFSRLVMPIFILTFLISLCAVA 117

Query: 119 VINPIATSGEKIGIDLIQ-QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
               +     +    +I  + K N +   +D +    + N +    + A++  PEN   E
Sbjct: 118 FNEYVVPWTNRKYEQVINIEIKRNLNPGVTDHVILRDVQNGKIAHLLYARRYNPENKKLE 177

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR-------------IPIDKN 224
           + T I   +   +I  ++A  A+  + K  ++    Y  G              IP  ++
Sbjct: 178 NIT-IQEFQNEAVIRVENAPNAVWKDGKWFMENGTIYDLGEDGISRTMRFKNQFIPYGQS 236

Query: 225 STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
             T+    K        E F +R  YE   + + +    I   +           +P   
Sbjct: 237 PETIQKEHKDYDEMTIRELFTARKAYEAAHEDATAIVMEIHRRFS----------LPFAS 286

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
               L+ A + ++  RS+   I     +   F+ Y ++T +++ GK  ++  VAA  +P 
Sbjct: 287 FVFGLVGAPLGVQRERSSSS-IGFGLSVVIIFVYYAVMTFLEALGKGHVISAVAAVWLPN 345

Query: 345 ILTISLSILIL 355
           ++ +  ++ ++
Sbjct: 346 LIALICAVYLI 356


>gi|257095655|ref|YP_003169296.1| permease YjgP/YjgQ family protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048179|gb|ACV37367.1| permease YjgP/YjgQ family protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 357

 Score = 39.3 bits (90), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 63/324 (19%), Positives = 131/324 (40%), Gaps = 24/324 (7%)

Query: 33  LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISR 92
           L EI+N +G+   Y +         R+P  + +++P   L+  +     L R SE+ + R
Sbjct: 33  LGEIRN-VGQ-GGYQLHHAFAFVLLRIPGRVYELMPIAVLIGTLYALSTLARHSEITVLR 90

Query: 93  AIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDN--GDKQKSDII 150
             G+S   LL      + +L + T L+   +A   E+    L  + +    G   +S + 
Sbjct: 91  VSGLSSGGLLTVLFQVAGVLAVLTFLIGEYVAPPSERAAFQLRSKERTGMVGQDLRSGL- 149

Query: 151 PWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKD-ADLAIIYNDKVKLK 209
            W++     +  FI  + +LP+  +         D+  K+    + A+   +  D  +L 
Sbjct: 150 -WVK----DERSFINVRIVLPDTRL-RGIRIFEFDEDAKLRSMTEAAEGEYVVPDSWRLT 203

Query: 210 KVVE--YQYGR-----IPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKS 262
            VV+   + GR     +P  +  + LN P  +       ++ + R      K ++ ++++
Sbjct: 204 NVVQTVLEGGRAEVRSVPDMQWRSALN-PDILAVLLVSPDRMSLRHLSAYTKHLADNHQT 262

Query: 263 NIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
                 R +  F+  ++ PL  + M  +A       SR     + +  G+  G + + + 
Sbjct: 263 ----TNRYDIAFWKKVIYPLAGLVMVALALPFGGAHSRVEGVGLKIFVGVMIGTLFHMLN 318

Query: 323 TIMKSFGKSGILLPVAAALIPVIL 346
            +  + G      P+ +A  P IL
Sbjct: 319 GLFSNLGAINHWSPLLSAATPSIL 342


>gi|296272453|ref|YP_003655084.1| permease YjgP/YjgQ family protein [Arcobacter nitrofigilis DSM
           7299]
 gi|296096627|gb|ADG92577.1| permease YjgP/YjgQ family protein [Arcobacter nitrofigilis DSM
           7299]
          Length = 356

 Score = 39.3 bits (90), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 125/295 (42%), Gaps = 36/295 (12%)

Query: 84  RTSELVISRAIGISIWQLLNPFVVGSILLGIFTV-LVINPIATSGEKIGIDLIQQWKDNG 142
           +T+E+V S ++G+   Q+  P V  SI+L +  +   + P+A S E     L   +  + 
Sbjct: 79  KTNEMVASFSLGVGNRQIFMPVVNVSIILIVLLIGFQMTPLAYSYEYKEKILKNTYFTSS 138

Query: 143 DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED---FTSITIDKKNKIIHRKDADLA 199
              KSDI           D F+  KK+ P     ED   +  +  D +  I+ +K    A
Sbjct: 139 ---KSDIFV------KYNDYFVYFKKLYPLQKYAEDIHIYKVVDDDIEEGIVAKK----A 185

Query: 200 IIYNDK--------VKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ-----KFSEQFAS 246
              N++         K  KV+++   +I I            ++GF+        E  +S
Sbjct: 186 YFQNNRWYVLDARITKKPKVIDWNNSKIEIHHEKFLYT----LEGFKPKILDSVYESTSS 241

Query: 247 RSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRI 306
            S  + I  ++  N   + +  +     Y+ IV PL  V + ++  S +   SR      
Sbjct: 242 FSILDAITALTLLNDQEV-NTSKIRASLYYEIVAPLYFVPLIILIFSYTSFNSRFFNIGK 300

Query: 307 IVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
             ++ I +  +++ +  ++  F   G++ P  + L+P+ L   ++  IL++K+ G
Sbjct: 301 FTSFSIAATLVIWGVFFMLHKFSSGGVINPEISILLPIFLWYIIT-YILIKKQIG 354


>gi|116624897|ref|YP_827053.1| permease YjgP/YjgQ family protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228059|gb|ABJ86768.1| permease YjgP/YjgQ family protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 777

 Score = 39.3 bits (90), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL--GIFT 116
           P +I Q++P   LV  +  F  +++ +E+   +A G+S+++L  P +VGS+LL  G+F 
Sbjct: 469 PQLIYQMLPVSILVAVLAAFGVMSKQNEITAFKACGVSLFRLAAPILVGSVLLSGGLFA 527


>gi|119357818|ref|YP_912462.1| permease YjgP/YjgQ family protein [Chlorobium phaeobacteroides DSM
           266]
 gi|119355167|gb|ABL66038.1| permease YjgP/YjgQ family protein [Chlorobium phaeobacteroides DSM
           266]
          Length = 358

 Score = 39.3 bits (90), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 128/304 (42%), Gaps = 27/304 (8%)

Query: 57  TRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
           + +P  +    P   L+  I+V   L+  SEL   ++ GIS+ QLL PFV+G  +  I +
Sbjct: 55  SSIPSTLMVTSPVAALLSAILVAGKLSAMSELSAIKSAGISLKQLLKPFVLGGTI--ICS 112

Query: 117 VLVINPI----ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISN---PQQDIFIGAKKI 169
           + ++N      A + +KI  +    +    + Q +  +  ++  N      ++ I   K 
Sbjct: 113 INMLNSCWLGPAAAADKIAFERT-SFNRTQNLQANSNMHILESGNRIVSIGELLINQSKG 171

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK---LKKVVEYQYG----RIPID 222
           L   HI     SI      ++  R DA   +I++  V    LK+     +     +  ++
Sbjct: 172 L---HI-----SIEQFNGTRLSTRMDAP-EMIFDQNVHKWVLKETSSRSFTGNNEQYHLN 222

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPL 282
             + TL + + +   +K + Q    +  E  +     +K+      RA+ + +  I +P 
Sbjct: 223 PGNDTLGMAMSLKSLRKLNVQPDEMNILEHYRYTREKDKAGFSGLDRAKVKLHAKIALPF 282

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
             +   LI   +S    R  +     +  +F GF+   +   + + G +G+L P  AA +
Sbjct: 283 ASLISILIGVPLSTIRKRGGKAAEF-SITLFIGFLYLGLQKTIATIGYTGLLEPWIAAWL 341

Query: 343 PVIL 346
           P +L
Sbjct: 342 PNML 345


>gi|67922983|ref|ZP_00516478.1| permease YjgP/YjgQ [Crocosphaera watsonii WH 8501]
 gi|67855202|gb|EAM50466.1| permease YjgP/YjgQ [Crocosphaera watsonii WH 8501]
          Length = 394

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 60/312 (19%), Positives = 130/312 (41%), Gaps = 38/312 (12%)

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P  +    P   L+  ++ +  L+  SE++  R++G+SI++L+ P ++   ++     +V
Sbjct: 78  PGFVSLAFPMAMLLAALMAYTRLSSDSEIIALRSLGVSIYRLIIPVILFGFMVTGCAFIV 137

Query: 120 ---INPIATSGEKIGIDLIQQWKDNGDKQKSDIIP---WMQISNPQQDIFIGAKKILPEN 173
              I P AT    + ++     +    K+++ + P    +Q  N Q+   + ++    E 
Sbjct: 138 NDWIAPAATHEAAVTLERAVNQERPDFKERNIVYPEYKTIQEENGQEATVL-SRLFYAEE 196

Query: 174 HIWEDFTSITI-----DKKNKIIHRKDADLAI------IYNDKVKL-------KKVVEYQ 215
           +  E    +TI     +  N+I+  + A   I       +N  + L       + +V +Q
Sbjct: 197 YNGEQMQGLTILDRTQEGVNQIVTSESATWNISSNTWDFFNGTIYLIAPDGSYRNIVRFQ 256

Query: 216 YGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFY 275
           + ++ + +    L      +  Q F+E   + +  E +K M  S         +   Q  
Sbjct: 257 HQQLALPRAPLDL-----ANRRQNFTEMTIAET-KEYLKAMQLSGNEKRIRKVQVRLQEK 310

Query: 276 FLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKSFGKSGI 333
           +   +P + +   L+ A++ +    +N+     ++G+  G  F  Y +  +  S G  GI
Sbjct: 311 Y--ALPFVCLIFGLVGAAIGVRPQNTNKS---TSFGVCVGLIFGYYLLAFMSTSLGIWGI 365

Query: 334 LLPVAAALIPVI 345
           L P   A +P I
Sbjct: 366 LTPFLGAWLPNI 377


>gi|88810479|ref|ZP_01125736.1| putative permease [Nitrococcus mobilis Nb-231]
 gi|88792109|gb|EAR23219.1| putative permease [Nitrococcus mobilis Nb-231]
          Length = 358

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P    Q  PF TL+ +++    L   SELV+ R  G+S   +  P V+  + L +  + V
Sbjct: 58  PYSAYQAFPFATLIGSLIGLGGLAARSELVVMRGTGMSALTIARPLVMAGLSLALLAMGV 117

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
              +A   +++  +L  +          +   W +      D ++ A+++ PE  + ED 
Sbjct: 118 GEWLAPRTDRLATELQTRAVGGQLSAGGESGFWAR----DGDRYVHARQV-PEADVLEDL 172


>gi|317969817|ref|ZP_07971207.1| permease [Synechococcus sp. CB0205]
          Length = 400

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 51  GAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSI 110
           G VLA  R+P  +    P  TL+  ++ F  L+ +SEL   R+IG+  W+++ P +V + 
Sbjct: 75  GKVLA-LRMPGFLVLSFPMATLMATLLAFSRLSGSSELTALRSIGVKTWRMVVPALVLAA 133

Query: 111 LLGIFT 116
           L+ + T
Sbjct: 134 LMTLLT 139


>gi|304413751|ref|ZP_07395195.1| inner membrane component LptG of LptABCFG lipopolysaccharide
           transporter [Candidatus Regiella insecticola LSR1]
 gi|304283842|gb|EFL92236.1| inner membrane component LptG of LptABCFG lipopolysaccharide
           transporter [Candidatus Regiella insecticola LSR1]
          Length = 358

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 131/334 (39%), Gaps = 29/334 (8%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L T L  L   + L  +I   E   ++GE  +YS+    +     VP
Sbjct: 3   MFGVLDRYIGRNILHTILMTLFMLVSLSGIIKFIEQLRKLGE-GSYSVLGAGIYTLLSVP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+  +     L   SEL++ +A G +  Q+ +  +  +I L + T+++ 
Sbjct: 62  KDIEIFFPMAALLGVLFGLGTLASRSELIVMQASGFTRTQIASAVMKTAIPLVLLTMVIG 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI-GAKKILPENHIWEDF 179
             +A   E+I  D            ++ +I    I   Q  ++    +  L  NHI  D 
Sbjct: 122 EWVAPLSERIASD-----------YRTKMIFGGAILTTQSGLWARDGENFLYINHILNDN 170

Query: 180 TS-----ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLN----- 229
           T        ID++N+++  + A  A   ++  +L +V E           S TL      
Sbjct: 171 TLSGVNIYHIDQENRLLSVRYAATATFKDNVWQLSQVDESDLSDAKKINGSKTLTGEWKI 230

Query: 230 --IPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
              P K+       +        + I+ +    K N   + R +   +  I  PL +  M
Sbjct: 231 NLTPDKLGIVSVDPDSLPISGLRDYIQYL----KQNKQESLRYQLIMWNKIFSPLSVAVM 286

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTI 321
            L+A S      R+    + V  GI  GF+ Y +
Sbjct: 287 MLVALSFIFGPLRTVTMGVRVMVGIAVGFLFYVL 320


>gi|88703587|ref|ZP_01101303.1| Predicted permease YjgP/YjgQ family protein [Congregibacter
           litoralis KT71]
 gi|88702301|gb|EAQ99404.1| Predicted permease YjgP/YjgQ family protein [Congregibacter
           litoralis KT71]
          Length = 352

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 72/168 (42%), Gaps = 5/168 (2%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P  + + IPF  L+  ++    L  TSELV+ RA GIS  +L    +  ++++ +F  L
Sbjct: 56  MPRRVYEFIPFAALIGALIGLGQLASTSELVVMRAAGISNGRLAWMVLKQALVIAVFGFL 115

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           +   IA   E+         +  G +  ++   W +       +F   + I P+N ++  
Sbjct: 116 LGEYIAPKAEQQAQSGRAIARYAGRQVDTEQGIWRRDGA----VFFHVQAIAPDNEVF-G 170

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST 226
            T+   ++   +     AD      +  +L+ V   ++ R  + K S 
Sbjct: 171 VTAYEFEEDGWMQRALFADSGRYDGEGWRLRDVQSSEFSRDRVRKASA 218


>gi|296532233|ref|ZP_06894980.1| permease YjgP/YjgQ [Roseomonas cervicalis ATCC 49957]
 gi|296267440|gb|EFH13318.1| permease YjgP/YjgQ [Roseomonas cervicalis ATCC 49957]
          Length = 381

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
           +P     I+P  T VV +  +  LN   ELV+ RA G+S WQL  P
Sbjct: 57  LPSFFAVILPITTFVVTLFSYVRLNGDRELVVMRAAGLSDWQLSRP 102


>gi|253991456|ref|YP_003042812.1| hypothetical protein PAU_03983 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782906|emb|CAQ86071.1| similar to putative membrane protein yjgq of escherichia coli
           [Photorhabdus asymbiotica]
          Length = 358

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 88/368 (23%), Positives = 154/368 (41%), Gaps = 19/368 (5%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  +  L+T L  L   + L  +I   +   ++G+    +IS G + A   VP
Sbjct: 1   MFGVLDRYIGRTILQTILMTLFMLVSLSGIIKFVDQLRKVGQGEYTTISAG-LYALLSVP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             IQ   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L I T+++ 
Sbjct: 60  KDIQIFFPMAALLGALLGLGALATRSELVVMQASGFTRMQVAGSVMKTAIPLVILTMIIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  GE++  +   Q    G    +    W +        FI  ++++ +  I +   
Sbjct: 120 EWVAPQGEQMARNYRAQKMFGGSLVSTTKGMWAKDGAD----FIYIQRVMSDTEI-KGVN 174

Query: 181 SITIDKKNKIIHRKDADLAII--YNDKVKLKKVVEYQY-------GRIPIDKNSTTLNIP 231
               +   K++  K AD A+    ND  KL +V E          G   I  +  T   P
Sbjct: 175 IYHFNDDKKLLSVKYADSAVYDENNDLWKLSQVEESDLTDSKKITGSQRISADWKTRLTP 234

Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
            ++       E  +    Y+ I  +  S +     + R +   +  I  PL +  M L+A
Sbjct: 235 EQLGVVALDPEALSISGLYQYISYLKQSEQ----ESGRYQLNMWKKIFAPLSVAVMMLMA 290

Query: 292 ASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLS 351
            S      R+    + +  GI  GF+ Y +  I         +  V AAL+P +L ++LS
Sbjct: 291 LSFIFGPLRTVPMGVRIITGITLGFLFYLLNEIFGPLSLVYSMPAVLAALLPSLLFLTLS 350

Query: 352 ILILLQKE 359
           I +LL+++
Sbjct: 351 IYLLLKRQ 358


>gi|90408709|ref|ZP_01216858.1| hypothetical protein PCNPT3_03815 [Psychromonas sp. CNPT3]
 gi|90310191|gb|EAS38327.1| hypothetical protein PCNPT3_03815 [Psychromonas sp. CNPT3]
          Length = 354

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 83/392 (21%), Positives = 147/392 (37%), Gaps = 74/392 (18%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
           GIL RY  K     T   L   + L  +I   E    +G+  +Y +         ++P+ 
Sbjct: 2   GILDRYIGKTVFAATFLTLFVLLGLSSIIKFVEQMRSVGQ-GSYDVLAAGYFVLLKMPVE 60

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLN-------PFVVGSILLGIF 115
           +    P   L+  ++   +L  +SELV+ +A G+S +++         P V   +LL  F
Sbjct: 61  MTVFFPMAALIGALIGLGSLASSSELVVMQAAGMSKFRIAGAVLKTAVPMVFAVMLLAEF 120

Query: 116 TVLVINP-------IATSGEKIGIDLIQQWKDNGD--------KQKSDIIP---WMQISN 157
              V +        +A SG+    +    W  + D          +S++     +    +
Sbjct: 121 VAPVTDKEAYSMRDLARSGQSSVSNKYGVWVKDADAFISIGRMNSQSELFNVRFYFFNES 180

Query: 158 PQQDIFIGAKKILPENHIW--EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ 215
            Q D  + AKK+      W  ED T    +     +  KD+D+               +Q
Sbjct: 181 MQLDHAVLAKKVSYRGGYWLLEDSTWTKFESDRTNVEHKDSDV---------------WQ 225

Query: 216 YGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFY 275
               P  K    L+ P KM          + R  Y  I  +          N + +   Y
Sbjct: 226 TDLTP-KKLDVILSDPSKM----------SMRDIYGYITYL---------ENNQQDANRY 265

Query: 276 FLI-----VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGK 330
            LI     V+P  +V M L++ S      R+      +  GI SGF  +    +   FG 
Sbjct: 266 LLILWRKAVLPFTVVVMMLLSVSFIFGGLRTVTMGTRLILGIASGFAFHVSGEL---FGP 322

Query: 331 SGI---LLPVAAALIPVILTISLSILILLQKE 359
           + +   L P+  AL+P +L + +++ +L ++ 
Sbjct: 323 ASLVFGLSPLLGALLPSMLVLCIAMYLLRRQS 354


>gi|319954060|ref|YP_004165327.1| permease yjgp/yjgq family protein [Cellulophaga algicola DSM 14237]
 gi|319422720|gb|ADV49829.1| permease YjgP/YjgQ family protein [Cellulophaga algicola DSM 14237]
          Length = 359

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 88/392 (22%), Positives = 169/392 (43%), Gaps = 75/392 (19%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFV-----IDLNEIQNQMGE-----------LPNYS 47
           IL +Y  K YL T        M+L+F+     + L+E  N+M +           L N+S
Sbjct: 3   ILDKYILKRYLVT-----FSVMLLLFIPIGIMVHLSEQYNKMQDNEAPLNEILMYLGNFS 57

Query: 48  ISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFN--LNRTSELVISRAIGISIWQLLNPF 105
           I  G++L    +P+ +     F++     V+FF   L   +E+V   + GIS  + L P+
Sbjct: 58  IYIGSML----LPIFL-----FLS-----VIFFTSKLAGNTEIVAMLSSGISYGRFLRPY 103

Query: 106 VVGSILLGIFTVLV---INPIATSG-EKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQD 161
           ++G++++  F +L+   I P A+ G  +     +++ K   D+   +I   +  ++    
Sbjct: 104 LMGAVIVAAFMLLMGMFIVPNASKGFNEFKFKYLKKGKQ--DRVTENIFNQLNAND---- 157

Query: 162 IFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDA------DLAIIYNDKVKLKKVVEYQ 215
            FI   +  P   I  +F+    +K N + ++  A      +   IY     +K+ ++  
Sbjct: 158 -FIYVSRFDPTRDIGYNFSMEHFNKDNVLEYKLSAANIRWIEADSIYRLTSYVKRTLK-- 214

Query: 216 YGRIPIDKNSTTLN--IPIKMDGFQKFSEQFASRSFYEI------IKKMSFSN-KSNIFH 266
            G   I +    L+   P K++     S    +++ +E+       K+   SN  + I  
Sbjct: 215 -GDTEILETKRRLDTVFPFKINDLTPVSYVAETKNLFELNEFIANEKRKGASNINTYILV 273

Query: 267 NYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMK 326
            Y+  T       +P+    +TLIA +VS +  R     + +A+GI   F+      +  
Sbjct: 274 KYKRWT-------MPITAFILTLIAVAVSSQKRRGGMG-VNLAFGILVAFVYIFFDRVFG 325

Query: 327 SFGKSGILLPVAAALIPVILTISLSILILLQK 358
           +  +     P+ A ++P +L   L+   LLQK
Sbjct: 326 TLAEQSGFSPLLAVIVPNVLFGFLA-FYLLQK 356


>gi|307566095|ref|ZP_07628553.1| putative membrane protein [Prevotella amnii CRIS 21A-A]
 gi|307345283|gb|EFN90662.1| putative membrane protein [Prevotella amnii CRIS 21A-A]
          Length = 633

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 16/123 (13%)

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +++ Q +P   L+ +++ + NL  +SEL   +A GIS++Q     +  +IL+ + +    
Sbjct: 62  MMVPQALPLAVLLSSLMTYGNLGESSELTAIKAAGISLFQSFRGLIGITILITLLSFYFQ 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISN-------PQQDIFIGAKKILPEN 173
           N IA   +K    LI        KQKS   P ++I         PQ ++++  KK L   
Sbjct: 122 NNIAPVAQKHLYQLIISM-----KQKS---PELEIPEGVFYSGIPQTNLYV-EKKNLKTG 172

Query: 174 HIW 176
           H++
Sbjct: 173 HLY 175


>gi|77165378|ref|YP_343903.1| permease YjgP/YjgQ [Nitrosococcus oceani ATCC 19707]
 gi|254434004|ref|ZP_05047512.1| putative permease, YjgP/YjgQ family [Nitrosococcus oceani AFC27]
 gi|76883692|gb|ABA58373.1| permease YjgP/YjgQ [Nitrosococcus oceani ATCC 19707]
 gi|207090337|gb|EDZ67608.1| putative permease, YjgP/YjgQ family [Nitrosococcus oceani AFC27]
          Length = 354

 Score = 38.9 bits (89), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 90/375 (24%), Positives = 150/375 (40%), Gaps = 50/375 (13%)

Query: 4   ILWRYFFKYYLKTTLY--FLLGAM--ILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           IL RY  K  +  TL   F+L A+   L FV +L ++    GE  +Y +          +
Sbjct: 3   ILDRYIAKAVISYTLLVLFILIALYTFLQFVTELEDV----GE-GDYGVMGALRYTTYSI 57

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQL-LNPFVVGSILLGIFTVL 118
           P  I  ++P   L+ +++    L   SELV  RA G S+ ++ L+    G I + I TVL
Sbjct: 58  PQHIYDLLPVAALLGSVLGLGYLAGQSELVAMRAAGFSVGRITLSALATGMIFV-IVTVL 116

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           +   +A   ++    L    K     +      W +  N     F    ++LP N  +E 
Sbjct: 117 MGEVVAPPAQQAANKLRSLAKTGHLSEDGGQGFWSRNGNN----FNHVGRVLP-NGQYEY 171

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNI-------- 230
                 D + ++     A  AI + D   L  V +    R+   K  TT  +        
Sbjct: 172 IEIFEFDDQRRLRIVTQAARAIYHKDGWHLYDVTQ----RLISTKGITTRRLDEALWESG 227

Query: 231 --PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIP-----LM 283
             P  +D      +Q ++   Y  I  +  S ++     YR    F+  IV P     +M
Sbjct: 228 LNPEMLDVVMVDPQQLSAWGLYRYIGYLQKSKQAA--EQYR--QAFWSKIVAPFSTLIMM 283

Query: 284 LVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGI---LLPVAAA 340
            +A+  I   +    S S   RI+V   +  GF L+      + F + G+   L P   A
Sbjct: 284 FLAIPFIFGPLR---SVSVGQRILVGALVGIGFFLFN-----RLFNQLGLVFDLPPWLGA 335

Query: 341 LIPVILTISLSILIL 355
             P +L ++L +++L
Sbjct: 336 AFPSLLCLALGVVML 350


>gi|330824939|ref|YP_004388242.1| permease YjgP/YjgQ family protein [Alicycliphilus denitrificans
           K601]
 gi|329310311|gb|AEB84726.1| permease YjgP/YjgQ family protein [Alicycliphilus denitrificans
           K601]
          Length = 366

 Score = 38.9 bits (89), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/146 (18%), Positives = 55/146 (37%), Gaps = 3/146 (2%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y +S   +  A  +P  + +++P   L+  I V   L ++SE  I R  G+  W+ L+ 
Sbjct: 43  GYRMSHALLFVALSLPQHLYELLPITVLIGTIFVMARLAQSSEFTIMRTSGLGPWRALST 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +         T  V + +A   E+    +  Q    G         W++         +
Sbjct: 103 LLALGCAFVALTFAVGDYLAPISERAAALVRAQ--QLGQISTGATGAWLKERQGDHSFAV 160

Query: 165 GAKKILPENHIWEDFTSITIDKKNKI 190
             + + P+ H+  D      D + ++
Sbjct: 161 NVRALTPDGHM-RDVRVFEFDARGRV 185


>gi|319762859|ref|YP_004126796.1| permease yjgp/yjgq family protein [Alicycliphilus denitrificans BC]
 gi|317117420|gb|ADU99908.1| permease YjgP/YjgQ family protein [Alicycliphilus denitrificans BC]
          Length = 366

 Score = 38.9 bits (89), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/146 (18%), Positives = 55/146 (37%), Gaps = 3/146 (2%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y +S   +  A  +P  + +++P   L+  I V   L ++SE  I R  G+  W+ L+ 
Sbjct: 43  GYRMSHALLFVALSLPQHLYELLPITVLIGTIFVMARLAQSSEFTIMRTSGLGPWRALST 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +         T  V + +A   E+    +  Q    G         W++         +
Sbjct: 103 LLTLGCAFVALTFAVGDYLAPISERAAALVRAQ--QLGQISTGATGAWLKERQGDHSFAV 160

Query: 165 GAKKILPENHIWEDFTSITIDKKNKI 190
             + + P+ H+  D      D + ++
Sbjct: 161 NVRALTPDGHM-RDVRVFEFDARGRV 185


>gi|86141356|ref|ZP_01059902.1| putative membrane protein [Leeuwenhoekiella blandensis MED217]
 gi|85831915|gb|EAQ50370.1| putative membrane protein [Leeuwenhoekiella blandensis MED217]
          Length = 358

 Score = 38.9 bits (89), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 56/285 (19%), Positives = 118/285 (41%), Gaps = 22/285 (7%)

Query: 82  LNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDN 141
           L   +E++   + G+S ++ L P+++G+ ++ +   ++   +A +  +   +   ++  N
Sbjct: 80  LANNTEVIAFLSSGVSFYRFLRPYLIGATIVCVGAYILGTYLAPAASQGFNEFTYEYLKN 139

Query: 142 GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII 201
           G   +     + QI++   + +I   +  P + + ++FT    +  N  +  K    +I+
Sbjct: 140 GKAARETRNVYRQIND---NDYIYVSRFTPSSKMGQNFTLEHFE--NNTLQYKIQARSIV 194

Query: 202 YNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF-----------SEQFASRSFY 250
           Y  +  L ++  Y+  RI   +    ++ P K+D    F           +E   +    
Sbjct: 195 YRPEDTLYRLNGYK-KRIVGKEGDILISEP-KLDTLFSFDLEDLTPLEYIAETLTTPRLR 252

Query: 251 EIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAY 310
           E I K      S I    R E   Y    +P+    +T+IA +VS    R     I +A 
Sbjct: 253 EFIDKERARGSSAI---NRYEVVLYKRYSLPVSAYILTIIAVAVS-SMKRRGGMGINLAL 308

Query: 311 GIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           GI   F+      +  +  +     P+ A  +P +L   L+I +L
Sbjct: 309 GISLAFIFIFFDKVFGTISEQSDFSPMVAVWLPNVLFGILAIYLL 353


>gi|119476402|ref|ZP_01616753.1| hypothetical protein GP2143_08124 [marine gamma proteobacterium
           HTCC2143]
 gi|119450266|gb|EAW31501.1| hypothetical protein GP2143_08124 [marine gamma proteobacterium
           HTCC2143]
          Length = 353

 Score = 38.9 bits (89), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 20/186 (10%)

Query: 36  IQNQMGELP-NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAI 94
           I ++MG L  NY            VP  +  ++PF  LV  +     L   SELV+ R+ 
Sbjct: 32  IVDEMGYLSGNYDFVAALRFVIYSVPATMFDLLPFAALVGCLAGLGTLASGSELVVMRSA 91

Query: 95  GIS----IWQLLNPFVV---GSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKS 147
           G+S    +W ++ P +V     +L+  +   V   IA S   I +           K+  
Sbjct: 92  GVSTLRIVWMVMRPIIVVMIAGMLVSEYVAPVTESIAKSERAIAL-----------KKSQ 140

Query: 148 DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK 207
           +I+    + + + + F+    + P N I    T    D+++K      A  AI  + +  
Sbjct: 141 NIVSREGLWHREANRFMHFNAVQP-NGILYGVTMYQFDEQHKPQSTLYAQRAIYQSGEWL 199

Query: 208 LKKVVE 213
           L+ VVE
Sbjct: 200 LEDVVE 205


>gi|318041350|ref|ZP_07973306.1| permease [Synechococcus sp. CB0101]
          Length = 388

 Score = 38.5 bits (88), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
           R+P  +    P  TL+  ++ F  L+ +SEL   R+IG+  W+++ P +V + L+ + T
Sbjct: 67  RLPGFLVLSFPMATLMATLLAFSRLSSSSELTALRSIGVPTWRMVVPALVVAALMTVLT 125


>gi|282892298|ref|ZP_06300694.1| hypothetical protein pah_c221o032 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281497889|gb|EFB40240.1| hypothetical protein pah_c221o032 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 361

 Score = 38.5 bits (88), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 77/363 (21%), Positives = 144/363 (39%), Gaps = 55/363 (15%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI--IQ 64
           RYFF+  +K    F+     L  +ID +    Q      +S     + +     LI  + 
Sbjct: 13  RYFFREVVKLFCVFIGSFYGLYVLIDFSSHTTQFSTHFQWS----EIFSYYFYELIRRLD 68

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN--- 121
            I+PF  ++  I    +L+  +ELV   A G+S+  LL PF++  +    FTVL+     
Sbjct: 69  VILPFALMLATIKTLCSLSTNNELVALMASGMSLKSLLRPFIIIGLF---FTVLMYGNAE 125

Query: 122 ---PIATSGEKIGIDLIQQWKDNGDKQ----------KSDIIPWMQISNPQQDIFIGAKK 168
              P A  G K   D     K+  + +          ++ I+   Q  + ++  F  +  
Sbjct: 126 FLLPKAQKGLKQIHDRHTSLKNKLENRGFVQHIILDDQTQIL--FQYYDEERQFFFDSYW 183

Query: 169 ILPENHIWE---DFTSITIDKKNKIIHRKDADLAIIYNDK-VKLKKVVEYQYGRIPIDKN 224
           I   + I+     F  + +     + H     L    ND+ V+    VE ++ +I  ++ 
Sbjct: 184 IKSADDIFRIKYLFPHLEVPLGRYVHH-----LTRNQNDELVESASFVEKEFPQIYFNQK 238

Query: 225 --STTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAE--TQFYFLIVI 280
               TL++P               +S  ++++++  +N+  I H   A+  + FY  + +
Sbjct: 239 KLQETLSLP-------------EEQSLTDLVQQLPHNNR--ISHEKEAQVVSHFYHKMAL 283

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           P + +   +  A   + FSR     +I A  IF     Y  +       K  +L P+ A 
Sbjct: 284 PWLCLFAVIAPAPFCVRFSRGLPVFMIYACSIFGLITFYLTMDAALILAKRQVLDPIWAI 343

Query: 341 LIP 343
            +P
Sbjct: 344 WMP 346


>gi|302879721|ref|YP_003848285.1| permease YjgP/YjgQ family protein [Gallionella capsiferriformans
           ES-2]
 gi|302582510|gb|ADL56521.1| permease YjgP/YjgQ family protein [Gallionella capsiferriformans
           ES-2]
          Length = 358

 Score = 38.5 bits (88), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 77/366 (21%), Positives = 145/366 (39%), Gaps = 33/366 (9%)

Query: 13  YLKTTLY----FLLGAMILVFVIDLNEIQNQMGELP--NYSISRGAVLAATRVPLIIQQI 66
           YL   +Y     +  A+I++F   L+ I  Q+G +    YS+    +     +P  I ++
Sbjct: 7   YLAREIYASIALVFAALIMLFAF-LDFI-GQLGTMGYGQYSLGYVVLFVLLTIPGHIYEL 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  IV    +   SEL I RA G S  Q+L      ++ + + + +    IA  
Sbjct: 65  FPVAVLIGTIVALVQMAARSELTIYRASGASTGQMLGALSKIAVPMILLSFICGELIAPP 124

Query: 127 GEKIGIDL-IQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
            E++   L ++        Q      W++        F+  + ++P+  +  D    T D
Sbjct: 125 SERLAQKLRLKALNTQVSLQAFRSGVWVK----DDASFVNVRSVMPDTSL-SDIDIYTFD 179

Query: 186 KK---NKIIHRKDADLAIIYNDKVKLKKVVEYQYG-------RIPIDKNSTTLNIPIKMD 235
           K    N +I  K A  + +     +L  V+E  +         +P+ +  + L  P  + 
Sbjct: 180 KSFHMNSVIRAKRA--SYLEPGVWQLHDVLETSFAARGVSTKSMPVREWQSALT-PGILS 236

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
                 EQ ++   Y+    +    K N   + R E   +  +V P  L+ M ++A   +
Sbjct: 237 VMLVVPEQMSALDLYKYASHL----KENKQQSARYEIAMWNKLVYPFALLVMMVLALPFA 292

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPV--AAALIPVILTISLSIL 353
               R+    I+V  GI  G + +    ++ S G      P+  A A+  V L I   +L
Sbjct: 293 SYQRRAGGVSILVFMGIVLGLVFHFAGRLVGSLGSLNDWQPLFSATAMTGVFLLIGAFML 352

Query: 354 ILLQKE 359
             +++ 
Sbjct: 353 WRVERR 358


>gi|227114630|ref|ZP_03828286.1| putative permease [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
 gi|227327172|ref|ZP_03831196.1| putative permease [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 358

 Score = 38.5 bits (88), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 83/383 (21%), Positives = 158/383 (41%), Gaps = 49/383 (12%)

Query: 1   MPGILWRYFFKY---YLKTTLYFLLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAA 56
           M G+L RY  K     + TTL+ L+  + I+ FV  L ++    GE   YS     +   
Sbjct: 1   MFGVLDRYIGKTIFTTIMTTLFMLVSLSGIIKFVDQLRKVGQ--GE---YSALGAGLYTL 55

Query: 57  TRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
             VP  I+   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T
Sbjct: 56  LSVPKDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRLQIATAVMKTAIPLVLLT 115

Query: 117 VLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
           + +   ++  GE++  +   Q    G    +    W +  N     FI  +++  +    
Sbjct: 116 MAIGEWVSPQGEQMARNYRSQMISGGSMISTQGGLWAKDGND----FIYIERVTGD---- 167

Query: 177 EDFTSITI---DKKNKIIHRKDADLAIIYNDK--VKLKKVVEYQYGRIPIDKNSTTLNIP 231
           ++ + + I   D KNK++  + A  A   +D+   KL +V E            + L+  
Sbjct: 168 KELSGVNIYHFDDKNKLLSVRYAASAEFEDDRNVWKLSQVDE------------SDLSDG 215

Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKS---NIFHNY------------RAETQFYF 276
            ++ G Q FS ++ +    + +  ++    +      HNY            R +   + 
Sbjct: 216 KQIGGSQTFSGEWKTNLTPDKLGVVALEPDALSIRGLHNYAKYLKQSGQESNRYQLNMWS 275

Query: 277 LIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLP 336
            I  P+ +  M L+A S      RS      +  GI  GF+ Y +  I +       + P
Sbjct: 276 KIFAPVSVAVMMLMAVSFIFGPLRSVSAGSRIVIGISFGFLFYLLNEIFRPLSLVYGIPP 335

Query: 337 VAAALIPVILTISLSILILLQKE 359
           +  A++P  + + +S+ +LL++ 
Sbjct: 336 ILGAILPSSVFLFISVALLLKRR 358


>gi|326796830|ref|YP_004314650.1| permease YjgP/YjgQ family protein [Marinomonas mediterranea MMB-1]
 gi|326547594|gb|ADZ92814.1| permease YjgP/YjgQ family protein [Marinomonas mediterranea MMB-1]
          Length = 353

 Score = 38.5 bits (88), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 63/313 (20%), Positives = 133/313 (42%), Gaps = 23/313 (7%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQL----LNPFVVGSIL 111
           A R P+   + IP  +L+  ++    L  TSEL + RA G+ IW++      P ++ S L
Sbjct: 53  AYRAPIKFAEYIPVASLIGTLIGLGALASTSELTVIRATGVPIWRIGFAACKPILLIS-L 111

Query: 112 LGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP 171
           +G+     ++P AT       DLI++ +   + + + +   + I +    ++I A     
Sbjct: 112 IGVGISEYVSPYATQQA----DLIERLRGQSEGRFA-LTGGVWIKSDGNFVYINAAD--- 163

Query: 172 ENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQY--GRIPID-KNSTTL 228
              +  D    T + +     +K      + +++ +L++V E  +   RI    K +   
Sbjct: 164 REGVLYDIQIFTPNGQALEKIQKAKFARHLSDNQWRLEQVTETHFLGDRIETGYKETVPW 223

Query: 229 NIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMT 288
              +K       S++  + S  E+ +  S+     +      + +F+   ++P    A+ 
Sbjct: 224 TASLKPSHLFLASQEPEALSLSELHQYQSYLTGQELNAGLY-QLEFWTKSLMPFACFALV 282

Query: 289 LIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL---PVAAALIPVI 345
           ++A S      RS+     +  G+  G M    + +   FGK  + L   P+    IP+ 
Sbjct: 283 IVALSSVFGPLRSSTMGGRIFSGVLIGIMFQNGLNL---FGKMSLALSFSPLIGVAIPIA 339

Query: 346 LTISLSILILLQK 358
           L  ++ +L++ +K
Sbjct: 340 LCFAIGLLLMSRK 352


>gi|312142810|ref|YP_003994256.1| permease YjgP/YjgQ family protein [Halanaerobium sp. 'sapolanicus']
 gi|311903461|gb|ADQ13902.1| permease YjgP/YjgQ family protein [Halanaerobium sp. 'sapolanicus']
          Length = 366

 Score = 38.5 bits (88), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 58/297 (19%), Positives = 111/297 (37%), Gaps = 24/297 (8%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P II    P   L+  I+ +  L+  SE+   RA GISI  ++ P ++  ++    T+ 
Sbjct: 58  LPEIIILTFPMAALLGTIMAYNRLSGDSEITAMRAGGISIMAIVLPALIMGLVTSGITIA 117

Query: 119 VINPIATSGEKIGIDLIQQWKDNG---DKQKSDIIPWMQISNPQQDIFIGAKKILPEN-- 173
           +   I          +I Q+K      D Q    +  +     + D  + AK    EN  
Sbjct: 118 ITEFIVPGANYQAEQIIHQFKHGERRPDTQYDLFLTPLDSRTSRPDYMLYAKSFNAENGR 177

Query: 174 ------HIWEDFTSITIDKKNKIIHRKDA----DLAIIYNDKVKLKKVVEYQYGRIPIDK 223
                   +ED    ++ +  + +  +D     +  + + D+      +E+   R   D 
Sbjct: 178 MTDVVLQSFEDGRPRSVLEAEEALWLRDGWSFFNGTVYFLDREDRSPSLEFSQYRSREDI 237

Query: 224 NSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLM 283
           +S     P +     K  ++   R   E I  +    ++     Y    +F+    +P+ 
Sbjct: 238 HS-----PAQAGKLGKDIDEMNIRELNEHIALLEQQGRA----AYEERVEFHHRFSVPMA 288

Query: 284 LVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
                L+AA + ++  RS          I   F+ Y ++TI  + G  G + P   A
Sbjct: 289 SFIFALLAAPLGIKPQRSAGSATGFGISIIIIFIYYVLMTIGDALGSQGTIEPWLGA 345


>gi|53803847|ref|YP_114531.1| hypothetical protein MCA2101 [Methylococcus capsulatus str. Bath]
 gi|53757608|gb|AAU91899.1| putative membrane protein [Methylococcus capsulatus str. Bath]
          Length = 356

 Score = 38.5 bits (88), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 116/273 (42%), Gaps = 27/273 (9%)

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGIS----IWQLLNPFVVGSILLGIF 115
           P  + ++IP   L+  +VV  N+    ELV  +A G+S    +W +L   +V S++  + 
Sbjct: 58  PHSLYELIPSGALIGGLVVLGNMANNHELVAMQAAGVSRGRIVWAVLRAGIVISLISVVI 117

Query: 116 TVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKI-----L 170
           +  VI P   + + +     +Q      + K  +  W++  N    +++  ++I     L
Sbjct: 118 SEYVIPPAERAAQMLKATATRQ--QVASQTKYGV--WIRDGN----VYVNVREIENQERL 169

Query: 171 PENHIWEDFTSITIDKKNKI-IH--RKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT 227
            + HI+E    I+ D +  + +H  R   D  I   + + L +        I   K    
Sbjct: 170 GDIHIFE----ISPDGRPALAMHAARASFDRGIWKLEDIGLTRFDPAGNAAIAEHKEQED 225

Query: 228 LNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
            +  +  D    F  +  + S  ++ K M++  + N   +   E  F+  +V PL+ +AM
Sbjct: 226 WSSVLSPDMLDVFIVRPENLSAQDLAKYMAYQTE-NAQKSLAVEQAFWGRMVNPLITLAM 284

Query: 288 TLIAASVSLEFSR--SNQPRIIVAYGIFSGFML 318
            L+A        R  S+  RI++   I  GF L
Sbjct: 285 LLLAIPFVFNARRDVSSGQRIVIGVTIGLGFYL 317


>gi|284037837|ref|YP_003387767.1| permease YjgP/YjgQ family protein [Spirosoma linguale DSM 74]
 gi|283817130|gb|ADB38968.1| permease YjgP/YjgQ family protein [Spirosoma linguale DSM 74]
          Length = 358

 Score = 38.1 bits (87), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 69/319 (21%), Positives = 130/319 (40%), Gaps = 47/319 (14%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P     I P +  +  + +   L   +E++   + G+S  +LL P+V+G+ +L + T  
Sbjct: 58  IPYWANYISPLMVFIATVFLTSRLAARTEIIAILSSGVSFVRLLLPYVLGATVLAVATYF 117

Query: 119 VINPIATSGEKIGIDLIQQWKDN-----GDKQKSDIIP----WMQISNPQQDIFIGAKKI 169
           ++N +     K  I    ++ ++     G      I P    +++  N Q +   G K  
Sbjct: 118 MVNYVIPKANKTRIAFEIKYINDAYNFSGRNVHLKIAPNTYAYLESYNNQSN--TGYK-- 173

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI--------PI 221
                    FT   ++  N++  +  AD  I ++ K K   V +Y+   I        P 
Sbjct: 174 ---------FTMERVE-GNQLKQKLSAD-HIEWDAKKKKWTVFDYKIRTINGPQETLTPG 222

Query: 222 DKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLI--- 278
            K  TTLN  +K D    FS  F   + YE + +   ++   +  +  A+    +L+   
Sbjct: 223 AKIDTTLN--LKPD---DFSSDF---NLYETLTRPELNDHIELLQSRGADGVETYLLEKY 274

Query: 279 ---VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL 335
                P  ++ +T+I   +S   SR       VA G F  F       + K   +SG L 
Sbjct: 275 SRDTRPFAIIILTVIGVIMSARKSRRGVG-WQVALGFFLAFTYLLFFMLAKGIAESGNLN 333

Query: 336 PVAAALIPVILTISLSILI 354
           P+ A  +P  +  ++ +L+
Sbjct: 334 PIVAVWLPNAIFAAIGVLL 352


>gi|253686793|ref|YP_003015983.1| permease YjgP/YjgQ family protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753371|gb|ACT11447.1| permease YjgP/YjgQ family protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 358

 Score = 38.1 bits (87), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 81/375 (21%), Positives = 153/375 (40%), Gaps = 33/375 (8%)

Query: 1   MPGILWRYFFKY---YLKTTLYFLLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAA 56
           M G+L RY  K     + TTL+ L+  + I+ FV  L ++    GE   YS     +   
Sbjct: 1   MFGVLDRYIGKTIFTTIMTTLFMLVSLSGIIKFVDQLRKVGQ--GE---YSALGAGLYTL 55

Query: 57  TRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
             VP  I+   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T
Sbjct: 56  LSVPKDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRLQIATAVMKTAIPLVLLT 115

Query: 117 VLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
           + +   ++  GE++  +   Q    G    +    W +  N     FI  +++  +    
Sbjct: 116 MAIGEWVSPQGEQMARNYRSQMISGGSMISTQGGLWAKDGND----FIYIERVAGD---- 167

Query: 177 EDFTSITI---DKKNKIIHRKDADLAIIYNDK--VKLKKVVEYQYGRIPIDKNSTTLN-- 229
           ++ + + I   D  NK++  + A  A   +D+   +L +V E           S TL+  
Sbjct: 168 KELSGVNIYHFDDSNKLLSVRYAASAEFEDDRNVWRLSQVDESDLSDGKQIGGSQTLSGE 227

Query: 230 -----IPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLML 284
                 P K+       +  + R  +   K +  S +     + R +   +  I  P+ +
Sbjct: 228 WKTNLTPDKLGVVALEPDALSIRGLHNYAKYLKQSGQ----ESSRYQLNMWSKIFAPVSV 283

Query: 285 VAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
             M L+A S      RS      +  GI  GF+ Y +  I +       + P+  A++P 
Sbjct: 284 AVMMLMAVSFIFGPLRSVSAGSRIVIGISFGFLFYLLNEIFRPLSLVYGIPPILGAILPS 343

Query: 345 ILTISLSILILLQKE 359
            + + +S+ +LL++ 
Sbjct: 344 SVFLCISVALLLKRR 358


>gi|229845238|ref|ZP_04465371.1| predicted permease [Haemophilus influenzae 6P18H1]
 gi|229811833|gb|EEP47529.1| predicted permease [Haemophilus influenzae 6P18H1]
          Length = 358

 Score = 38.1 bits (87), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 80/365 (21%), Positives = 149/365 (40%), Gaps = 24/365 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RY  K  L      L+  + L  VI   E    +G+   Y I +  +     +P  I+  
Sbjct: 7   RYIGKSILGAIFATLMTLVGLSAVIKFVEQFRSVGK-GTYDIWQAVIFTGLTMPKDIETF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
            P   L+  ++   NL   SELV+ ++ G S +++    +  ++ L +FT+++       
Sbjct: 66  FPMAALLGALIALGNLASRSELVVMQSAGFSRFKIGMAVMKTALPLVVFTMIIGEWGIPQ 125

Query: 127 GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDK 186
            E+   D+  +    G         W +  N     F+  +++  +  + +D    T D+
Sbjct: 126 TEQFARDMRAKALSGGSILSIKNGVWAKDGNN----FVFVRRVTDDAKL-DDIYIYTFDQ 180

Query: 187 KNKIIHRKDADLAIIYNDKVK--LKKVVEYQYGRIPIDKNSTTLNI------PIKMDGFQ 238
           ++ +   K ++ A    D+ K  L++V    +  I  D+  TT ++       +  D   
Sbjct: 181 QHNLTELKHSNQASYSEDEAKWTLRQV---NHSTITKDEIITTNHLLETWETSLTPDKLG 237

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
             S +  S S   +   +SF  ++      R E  F+  I  P+ +  M L+A S     
Sbjct: 238 AVSLRPTSLSISGLYHYISFLRETGQ-DVSRFELTFWRKIFQPISVGVMMLLALSFIFGS 296

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA---ALIPVILTISLSILIL 355
            RS      +  GI  GF+ Y +  I+   G+  ++  + A   ALIP +L I +   +L
Sbjct: 297 LRSVTAGARIVTGICVGFLFYVVNEIL---GQMSVVYGIPAIFGALIPSLLFIVMIWWLL 353

Query: 356 LQKED 360
             K D
Sbjct: 354 SHKRD 358


>gi|294012649|ref|YP_003546109.1| putative permease [Sphingobium japonicum UT26S]
 gi|292675979|dbj|BAI97497.1| putative permease [Sphingobium japonicum UT26S]
          Length = 367

 Score = 38.1 bits (87), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 51/97 (52%), Gaps = 6/97 (6%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL---AATRVPLIIQ 64
           Y  + +L  T   L    +LV V+   ++  + G++  Y+ +  A L    A R P I+ 
Sbjct: 15  YMARLFLTRTFAVL---AMLVAVLQTLDLLGESGDILAYAGNGDAQLWHYVALRAPQIVA 71

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQL 101
           + +PF  L+  +++  +LN+ SE++  +A G+S  Q+
Sbjct: 72  RFLPFSVLLGTLIMLASLNQNSEIISMKAAGLSAHQI 108


>gi|332530549|ref|ZP_08406487.1| permease YjgP/YjgQ [Hylemonella gracilis ATCC 19624]
 gi|332039995|gb|EGI76383.1| permease YjgP/YjgQ [Hylemonella gracilis ATCC 19624]
          Length = 372

 Score = 38.1 bits (87), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/204 (18%), Positives = 80/204 (39%), Gaps = 10/204 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMG--ELPNYSISRGAVLAATRVPLIIQ 64
           R  F+  L T  +  L  + L    D  +  + +G  + P + + +  +      P  + 
Sbjct: 9   RLLFREILFTASFVTLAFLALFVFFDFIDQLSAVGRPDRPGFELPQALIYVVLLAPGHLY 68

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++P   L+  I V   L ++SE  I R  G+  W+ L   +    +    T ++ + ++
Sbjct: 69  ELLPITVLIGTIYVMTRLAQSSEFTILRTSGLGPWRALAMLLTAGGVFASATFVIGDYLS 128

Query: 125 TSGEKIGIDLIQQWKDNGDKQKSDII---PWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
               ++     Q ++    K+ +  I    W++   P     I    +LP+  + +    
Sbjct: 129 PWSNQVA----QAYRAQFRKEGASTIKGGAWLREREPYAKYGINIGALLPDGTL-QRVRI 183

Query: 182 ITIDKKNKIIHRKDADLAIIYNDK 205
             ID    ++    A  A I ND+
Sbjct: 184 YEIDNAGNLVSTLQASTARINNDQ 207


>gi|255020900|ref|ZP_05292956.1| hypothetical protein ACA_1122 [Acidithiobacillus caldus ATCC 51756]
 gi|254969691|gb|EET27197.1| hypothetical protein ACA_1122 [Acidithiobacillus caldus ATCC 51756]
          Length = 357

 Score = 38.1 bits (87), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 70/353 (19%), Positives = 134/353 (37%), Gaps = 17/353 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           R  F+  L  +   L   + L+FV +L       G   ++ + +     + ++P +   +
Sbjct: 6   RLLFRGMLGYSTLVLFVLLALMFVANLIAKSGGPGH-GSWDMGKLVTYISLQLPDLAYNL 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPF----VVGSILLGIFTVLVINP 122
           IP   L+  ++    LN  SELV  R  G S+W+L  P     + G++L       V+  
Sbjct: 65  IPLALLLGALIWVSLLNSHSELVALRMSGWSLWRLQRPLLWVGLWGALLTFALGEWVVPY 124

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT-S 181
            A + E I       W + G       +P   +   Q D  I  + I  +    E     
Sbjct: 125 TAPAAEAI-------WANGGQGSGFQALPDGGVWLRQGDQLIQIRAIAADGRRLEGLRIV 177

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIP--IKMDGFQK 239
           IT    + +    DA  A+  +   +L+ V  +  G   I  ++T +  P  +++D    
Sbjct: 178 ITTPSLDAVTRMLDAREALYRDGAWQLQGVQSHVLGAQRI-VSTTLVQQPWDVRLDPGTL 236

Query: 240 FSEQFASRSFYEIIKKMSFSN-KSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
            S    +R+        S+ N + ++    R    F+  +  P + + M  +   +    
Sbjct: 237 RSFSHPTRTMTLPALWESYQNLQGSVLSMNRFALAFWKRVTYPWVGLVMIWLVVPLVTRN 296

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLS 351
            R       +  G+  G   + +  +      SG + PV A + P+ L  S++
Sbjct: 297 PRGGGLAGRILMGLVLGLAFHFLTEMSGFISISGGIPPVFATVFPLALFASIA 349


>gi|86609743|ref|YP_478505.1| YjgP/YjgQ permease [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558285|gb|ABD03242.1| putative permease, YjgP/YjgQ family [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 362

 Score = 38.1 bits (87), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 120/302 (39%), Gaps = 27/302 (8%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL---LGIF 115
           +P I+    P   L   ++    +   SE+   RA GI   ++  P +   +L   L + 
Sbjct: 54  LPAILVVTFPIAGLFTTLLTLGKMGADSEITALRAAGIPYRKVFIPVLCIGLLISGLALL 113

Query: 116 TVLVINPIATSGEKI-GIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
           T  VI P      KI   +LI         Q + +    +I     D++     I P+  
Sbjct: 114 TNEVIVPETNQKVKILNKNLIL-------AQDALLFNPEEIVRVDDDLWFHVGSIDPKTG 166

Query: 175 IWEDFTSITIDKKNKIIHRK-----DADLAIIYNDKVKLKKVVEYQY---GRIPIDK--N 224
           + +D   + +D+K +  H +      A  A       +L+ VV  +Y   GR   +    
Sbjct: 167 LMQDL--LILDRKAETGHLRYPQVISAQTAQQVGQSWQLRDVVIRRYDEQGRTYYEGQVE 224

Query: 225 STTLNIPIKMDGF---QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIP 281
              LNI  K+ G    +K  ++  +   +E  ++     + +     R  T+++    IP
Sbjct: 225 EMQLNIVNKLVGLVYAEKVPQEQRAGELWEQCQRYRAEQRPSA-DVARCLTEYHLKFAIP 283

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
           L      L+AA + L+  R       VA  I   F+ Y ++++ ++ G+   + P  AA 
Sbjct: 284 LASFFAILVAAPLGLQTVRQTGRYGGVALAIVLVFIYYVLMSLGRAMGRVEHIDPWLAAW 343

Query: 342 IP 343
           +P
Sbjct: 344 LP 345


>gi|50119364|ref|YP_048531.1| putative permease [Pectobacterium atrosepticum SCRI1043]
 gi|49609890|emb|CAG73325.1| putative permease [Pectobacterium atrosepticum SCRI1043]
          Length = 358

 Score = 38.1 bits (87), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 151/372 (40%), Gaps = 27/372 (7%)

Query: 1   MPGILWRYFFKY---YLKTTLYFLLG-AMILVFVIDLNEIQNQMGELPNYSISRGAVLAA 56
           M G+L RY  K     + TTL+ L+  + I+ FV  L ++    GE   YS     +   
Sbjct: 1   MFGVLDRYIGKTIFTTIMTTLFMLVSLSGIIKFVDQLRKVGQ--GE---YSALGAGLYTL 55

Query: 57  TRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
             VP  I+   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T
Sbjct: 56  LSVPKDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRLQIATAVMKTAIPLVLLT 115

Query: 117 VLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
           + +   ++  GE++  +   Q    G    +    W +  N     FI  +++  +  + 
Sbjct: 116 MAIGEWVSPQGEQMARNYRSQMISGGSMISTQGGLWAKDGNN----FIFIERVTGDKEL- 170

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDK--VKLKKVVEYQYGRIPIDKNSTTLN----- 229
              +    D +NK++  + A  A   +D+   KL +V E           S TL+     
Sbjct: 171 SGVSIYRFDDQNKLLSVRYAASAEFEDDRNVWKLSQVDESDLSDGKQIGGSQTLSGEWKT 230

Query: 230 --IPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAM 287
              P K+       +  + R  +   K +  S +     + R +   +  I  P+ +  M
Sbjct: 231 NLTPDKLGVVALEPDALSIRGLHNYAKYLKQSGQ----ESNRYQLNMWSKIFAPVSVAVM 286

Query: 288 TLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILT 347
            L+A S      RS      +  GI  GF+ Y +  I +       + P+  A++P  + 
Sbjct: 287 MLMAVSFIFGPLRSVSAGSRIVIGISFGFLFYLLNEIFRPLSLVYGIPPILGAILPSSVF 346

Query: 348 ISLSILILLQKE 359
           + +S+ +LL++ 
Sbjct: 347 LFISVALLLKRR 358


>gi|163739704|ref|ZP_02147112.1| permease YjgP/YjgQ [Phaeobacter gallaeciensis BS107]
 gi|161386934|gb|EDQ11295.1| permease YjgP/YjgQ [Phaeobacter gallaeciensis BS107]
          Length = 376

 Score = 38.1 bits (87), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 16/138 (11%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVV----GSIL 111
           A  +P +++ ++P      ++ V   LN  SEL + RA G S WQ+  P +V     +++
Sbjct: 47  ALALPNLVRMVLPVAAFAASVWVTNRLNSESELTVLRATGTSPWQMAKPAMVFGLITAVM 106

Query: 112 LGIFT-VLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKIL 170
           + I T VL+   IAT        L Q+  +      + ++      +P + +     +I 
Sbjct: 107 MSILTHVLLPASIAT--------LEQRESEVARNVTAKLLSEGDFLHPARGVTFYIGRID 158

Query: 171 PENHIWEDFTSITIDKKN 188
           P+  + + F S   D++N
Sbjct: 159 PDGTLNDVFLS---DRRN 173


>gi|163743163|ref|ZP_02150545.1| hypothetical protein RG210_14720 [Phaeobacter gallaeciensis 2.10]
 gi|161383580|gb|EDQ07967.1| hypothetical protein RG210_14720 [Phaeobacter gallaeciensis 2.10]
          Length = 376

 Score = 38.1 bits (87), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 16/138 (11%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVV----GSIL 111
           A  +P +++ ++P      ++ V   LN  SEL + RA G S WQ+  P +V     +++
Sbjct: 47  ALALPNLVRMVLPVAAFAASVWVTNRLNSESELTVLRATGTSPWQMAKPALVFGLITAVM 106

Query: 112 LGIFT-VLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKIL 170
           + I T VL+   IAT        L Q+  +      + ++      +P + +     +I 
Sbjct: 107 MSILTHVLLPASIAT--------LEQRESEVARNVTAKLLSEGDFLHPARGVTFYIGRID 158

Query: 171 PENHIWEDFTSITIDKKN 188
           P+  + + F S   D++N
Sbjct: 159 PDGTLNDVFLS---DRRN 173


>gi|307294586|ref|ZP_07574428.1| permease YjgP/YjgQ family protein [Sphingobium chlorophenolicum
           L-1]
 gi|306879060|gb|EFN10278.1| permease YjgP/YjgQ family protein [Sphingobium chlorophenolicum
           L-1]
          Length = 367

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 7/101 (6%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL---AATRVP 60
           I W Y  + +L  T   L    +LV V+   ++  + G++  Y+ +  A L    A R P
Sbjct: 12  ISW-YMARLFLTRTFAVL---AMLVAVLQTLDLLGESGDILAYAGNGDAQLWHYVALRAP 67

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQL 101
            I+ + +PF  L+  +++  +LN+ SE++  +A G+S  Q+
Sbjct: 68  QIVARFLPFSVLLGTLIMLASLNQNSEIISMKAAGLSAHQI 108


>gi|254477380|ref|ZP_05090766.1| permease YjgP/YjgQ [Ruegeria sp. R11]
 gi|214031623|gb|EEB72458.1| permease YjgP/YjgQ [Ruegeria sp. R11]
          Length = 388

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 21/123 (17%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNE--------IQNQMGELPNYSISRGAVLAATR 58
           RY    YL   L+F   A+ILV V  +N         I +    L  +  +      A  
Sbjct: 6   RYVLSQYL---LFFGFFALILVAVFWINRAVVLFDRLIGDGQSALVFFEFT------ALS 56

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P +I+ ++P      ++ V   LN  SEL + RA G S WQ+  P    ++  GI T +
Sbjct: 57  LPNLIRMVLPVAAFASSVWVTNRLNSESELTVLRATGTSPWQMAKP----ALAFGIITAI 112

Query: 119 VIN 121
           +++
Sbjct: 113 MMS 115


>gi|325268898|ref|ZP_08135523.1| hypothetical protein HMPREF9141_0732 [Prevotella multiformis DSM
           16608]
 gi|324988870|gb|EGC20828.1| hypothetical protein HMPREF9141_0732 [Prevotella multiformis DSM
           16608]
          Length = 640

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%)

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +++ Q +P   L+ +++ + NL  +SEL   R+ GIS+ Q     +V S+L+   +    
Sbjct: 62  MMVPQALPLAILLSSLISYGNLGESSELTAIRSAGISLVQSFRGLIVISVLIACGSFYFQ 121

Query: 121 NPIATSGEK 129
           N +  S +K
Sbjct: 122 NNVGPSAQK 130


>gi|284049007|ref|YP_003399346.1| permease YjgP/YjgQ family protein [Acidaminococcus fermentans DSM
           20731]
 gi|283953228|gb|ADB48031.1| permease YjgP/YjgQ family protein [Acidaminococcus fermentans DSM
           20731]
          Length = 363

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 56/322 (17%), Positives = 129/322 (40%), Gaps = 37/322 (11%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P +I    P   L+  ++    L+  SE+   R+ G+S  ++  P +    ++ +F+V+
Sbjct: 58  MPEVINYTFPMSMLLAALLTMGQLSSNSEITAMRSGGLSFRRIAAPILAAGFVVSLFSVV 117

Query: 119 ----VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
               V+ P  +  E+I    ++  +D   + ++ ++   Q+S  Q      A+    +  
Sbjct: 118 WAEKVVPPAKSEYERI--IKVEIKRDTKPRTQNHVL-IKQVSKGQLVRLTYARTFDEKQG 174

Query: 175 IWEDFTSITIDK-KNKIIHRK------------DADLAIIYNDKVKLKKVVEYQYGRIPI 221
           + +D T    D  K   I R             +         K  + + + +    +PI
Sbjct: 175 MMKDITIEDWDNGKVARIQRTPQAKWTQGTWIMEGGTITDLTGKDGVARTMTFDKQVLPI 234

Query: 222 DKNSTTLNIPIKMDGFQKFSEQFA---SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLI 278
            +    + +       QK  +Q      + + +I+K+             + E + Y   
Sbjct: 235 SETPKAITLD------QKDPDQMTIGELKMYIDILKR-------QYMPTSKYEMEIYRRF 281

Query: 279 VIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA 338
            +PL      LI   + ++  R+    + + + +   F+ Y+I+T M   G+ G++ P+ 
Sbjct: 282 TVPLASFFFALIGVPLGVQSQRTGA-SMGLGFSVVIIFIYYSIMTFMTGLGQGGVIPPLL 340

Query: 339 AALIPVILTISLSILILLQKED 360
           AA  P +L  +    ++ +K++
Sbjct: 341 AAATPNLLCGAFGCWMIYKKDN 362


>gi|319941841|ref|ZP_08016163.1| hypothetical protein HMPREF9464_01382 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804774|gb|EFW01641.1| hypothetical protein HMPREF9464_01382 [Sutterella wadsworthensis
           3_1_45B]
          Length = 377

 Score = 38.1 bits (87), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 57/123 (46%), Gaps = 2/123 (1%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           R F K  L +T++ L+  + L    DL    + +G   +Y+I R  +  +  +P    ++
Sbjct: 6   RQFAKDILLSTIFVLIVLIALFAFFDLIGQLDDLGA--DYTIGRAFLTTSLTLPSRAYEV 63

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATS 126
           +P   L+ ++        TSE  + RA G S W+L    ++  ++  + T  +   +A +
Sbjct: 64  MPLAVLLASVYTMSKWASTSEFTVLRASGCSPWRLARSLLIPGVICVLATYGLGEIVAPA 123

Query: 127 GEK 129
            ++
Sbjct: 124 AQR 126


>gi|319637673|ref|ZP_07992439.1| hypothetical protein HMPREF0604_00062 [Neisseria mucosa C102]
 gi|317400828|gb|EFV81483.1| hypothetical protein HMPREF0604_00062 [Neisseria mucosa C102]
          Length = 356

 Score = 38.1 bits (87), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 78/382 (20%), Positives = 157/382 (41%), Gaps = 62/382 (16%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAA---TRVPLII 63
           RY  +      +Y LL  + L       EI N++G+L   S + GA L      ++P   
Sbjct: 6   RYIIRQMAVMAVYALLAFLALY---SFFEIINEVGDLGKGSYN-GAKLGQYVLMQMPARA 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P   L+  ++    L   SEL + +A G+S  +LL       ++L  F ++     
Sbjct: 62  YELMPLAVLIGGLISLSQLASGSELTVIKASGMSTKKLL-------LILSQFGLIFAIAT 114

Query: 124 ATSGEKIGIDLIQQWKD------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN---- 173
              GE +   L Q+ ++      NG     +   W++    +++  I  +++LP++    
Sbjct: 115 VALGEWVAPTLSQKAENIKAAAINGKISTGNTGLWLK----EKNSIINVREMLPDHTLLG 170

Query: 174 -HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKV-KLKKVVEYQYGRIPID-KNSTTLNI 230
             IW+       + KN++    +A+ A++  D   +LK +     G   ++   +   N 
Sbjct: 171 IKIWQR------NDKNELTQAAEAESAVLNPDGSWQLKNIRRSILGEDKVEVSTAAEENW 224

Query: 231 PIK-----MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL-----IVI 280
           PI      MD      +Q +       I  +  +N++         TQ Y +     +V 
Sbjct: 225 PISVKRNLMDVLLVKPDQMSVGELTTYIDHLEKNNQN---------TQVYAIAWWRKLVY 275

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL---PV 337
           P+    M L+A + + + +R     + +  GI  G + +    +   FG +  L    P 
Sbjct: 276 PVAAWVMALVAFAFTPQTTRHGNMGLKLFGGICLGLLFHFAGRL---FGFTSQLYGVPPF 332

Query: 338 AAALIPVILTISLSILILLQKE 359
            A  +P +L   L++ ++ ++E
Sbjct: 333 LAGALPTVLFALLAVYLIRRQE 354


>gi|304383499|ref|ZP_07365959.1| conserved hypothetical protein [Prevotella marshii DSM 16973]
 gi|304335309|gb|EFM01579.1| conserved hypothetical protein [Prevotella marshii DSM 16973]
          Length = 634

 Score = 38.1 bits (87), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 60/143 (41%), Gaps = 28/143 (19%)

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +++ Q +P   L+ +++VF NL  +SEL   +A GIS+ Q     ++ S L+ I +    
Sbjct: 62  MLVPQALPLAILLSSLIVFGNLGESSELTAIKAAGISLMQSFRSLILLSCLIAIGSFYFQ 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           N +          LIQ                M+  NP+ +I        PE   ++   
Sbjct: 122 NNVGPEANSRLNVLIQS---------------MRHKNPELEI--------PEGIFYD--- 155

Query: 181 SITIDKKNKIIHRKDADLAIIYN 203
              I + N  + +K+ D  ++Y 
Sbjct: 156 --GIPQSNLYVQKKNRDTGVLYG 176


>gi|118580061|ref|YP_901311.1| permease YjgP/YjgQ family protein [Pelobacter propionicus DSM 2379]
 gi|118502771|gb|ABK99253.1| permease YjgP/YjgQ family protein [Pelobacter propionicus DSM 2379]
          Length = 382

 Score = 37.7 bits (86), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 72/157 (45%), Gaps = 16/157 (10%)

Query: 17  TLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAA------TRVPLIIQQIIPFI 70
           T  FLLG  I   V+    +  +M +L    ISRG  LA         +P  +   IP  
Sbjct: 14  TSLFLLGLGIFTLVL----LMGRMIKLTEMVISRGVALADMGRMIICLMPSFLVYTIPMA 69

Query: 71  TLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL---LGIFTVLVINPIATSG 127
            L+  ++ F  L+  SE+ + +A GIS+ Q++ P ++ +++   LG++  +V  P     
Sbjct: 70  FLLAVLLTFGRLSADSEITVMKACGISLVQIMPPVLLCALVAATLGLYAGVVGVPWGNRA 129

Query: 128 -EKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQD 161
              +  D++ Q   +  ++K   D IP + +     D
Sbjct: 130 FAAMSFDMLSQNVSSTIREKVFWDDIPGIVLYTDHYD 166


>gi|262376977|ref|ZP_06070203.1| permease YjgP/YjgQ family protein [Acinetobacter lwoffii SH145]
 gi|262308015|gb|EEY89152.1| permease YjgP/YjgQ family protein [Acinetobacter lwoffii SH145]
          Length = 356

 Score = 37.7 bits (86), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV----PLIIQQI 66
           K+  +TT   +LGA  ++    L  +   +GEL +     GA  A   V    P  + +I
Sbjct: 9   KHVTQTTALAMLGATAVL--AGLQVLFTYLGELGSLKDGYGAWDALKYVLWGAPNYLYEI 66

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
           +P   L+  ++    L   SEL++ R++G+S+W+++   +  ++LL
Sbjct: 67  LPISALIGAVLGLGTLASNSELIVMRSVGVSLWRIVGWVIRSALLL 112


>gi|306835543|ref|ZP_07468557.1| cell division protein FtsX [Corynebacterium accolens ATCC 49726]
 gi|304568600|gb|EFM44151.1| cell division protein FtsX [Corynebacterium accolens ATCC 49726]
          Length = 300

 Score = 37.7 bits (86), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 33  LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISR 92
           + E+ +Q  E+   + +  ++  AT +  I+  I   I LV N+V     +RT E  I R
Sbjct: 152 VEEVVDQQEEVREAASNLDSIRTATFIVAIVMSIAA-IFLVANMVQIAAFHRTRETEIMR 210

Query: 93  AIGISIWQLLNPFVVGSILLGIFTVLV 119
            +G S W    PFVV ++L  +  V++
Sbjct: 211 MVGASRWMTQAPFVVEAVLASLIGVVL 237


>gi|255323773|ref|ZP_05364899.1| cell division protein FtsX [Corynebacterium tuberculostearicum
           SK141]
 gi|255298953|gb|EET78244.1| cell division protein FtsX [Corynebacterium tuberculostearicum
           SK141]
          Length = 300

 Score = 37.7 bits (86), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 33  LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISR 92
           + ++ +Q  E+ + + +  A+  AT V  I+  +   I LV N+V     +RT E  I R
Sbjct: 152 VEDVVDQQQEVRDAASNLDAIRNATFVLAIVMSVAA-IFLVANMVQIAAFHRTRETEIMR 210

Query: 93  AIGISIWQLLNPFVVGSILLGIFTVLV 119
            +G S W    PFVV ++L  +  V++
Sbjct: 211 MVGASRWMTQAPFVVEAVLASLIGVVL 237


>gi|300857999|ref|YP_003782982.1| cell division protein [Corynebacterium pseudotuberculosis FRC41]
 gi|300685453|gb|ADK28375.1| Cell division protein [Corynebacterium pseudotuberculosis FRC41]
 gi|302205726|gb|ADL10068.1| Putative cell division protein FtsX [Corynebacterium
           pseudotuberculosis C231]
 gi|302330280|gb|ADL20474.1| Putative cell division protein - FtsX [Corynebacterium
           pseudotuberculosis 1002]
 gi|308275963|gb|ADO25862.1| Putative cell division protein - FtsX [Corynebacterium
           pseudotuberculosis I19]
          Length = 300

 Score = 37.7 bits (86), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 33  LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISR 92
           ++ I +Q+ +L   + +  A+  AT +   IQ +   + L+VN+V     NR  E+ I R
Sbjct: 152 VSTIVDQVDDLRGATDNLDAIRNATFIFAAIQAVAA-VFLIVNMVQIAAFNRREEISIMR 210

Query: 93  AIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEK 129
            +G S W    PFV+ +++   F   V++ +A  G K
Sbjct: 211 MVGASRWYTQAPFVLEAVIAAFFGA-VLSGVALFGGK 246


>gi|329943109|ref|ZP_08291883.1| hypothetical protein G5Q_0788 [Chlamydophila psittaci Cal10]
 gi|332287691|ref|YP_004422592.1| conserved hypothetical membrane transport protein [Chlamydophila
           psittaci 6BC]
 gi|313848265|emb|CBY17266.1| conserved hypothetical membrane protein [Chlamydophila psittaci
           RD1]
 gi|325506677|gb|ADZ18315.1| conserved hypothetical membrane transport protein [Chlamydophila
           psittaci 6BC]
 gi|328814656|gb|EGF84646.1| hypothetical protein G5Q_0788 [Chlamydophila psittaci Cal10]
 gi|328914944|gb|AEB55777.1| YjgP/YjgQ family protein [Chlamydophila psittaci 6BC]
          Length = 367

 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 74/368 (20%), Positives = 156/368 (42%), Gaps = 49/368 (13%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELP--NYSISRGAVLAAT------RV 59
           Y +K Y+ T  +F L ++I++  +    I + +  +     S++ GA L  +      ++
Sbjct: 2   YIWKRYVLTKFWFSLVSLIVLAFVFYASIHHSLHTIKGNTTSLASGASLKLSILYYLSQI 61

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
            L  + +IP +  V   +  F++    E+++ +A G+S+  L  P +  S ++ +     
Sbjct: 62  ALKAEFLIPQLVAVATTITLFSMQNKREVLLLQASGLSLKSLTAPLIHSSFIITLLLYAN 121

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQK-SDIIPWMQISNPQQDIFIG-AKKILPENHIWE 177
              +    E+I I   ++  D G   K  D +P + + +    ++    +K L  N ++ 
Sbjct: 122 FQWLHPICEQISIT--KEHMDRGTLDKVHDKVPALYLKDQTVLLYSSIEQKTLTLNQVFW 179

Query: 178 -------------DFTSITIDKKNKIIHRKDADLAII----YNDKVKLKKVVEYQYGRIP 220
                         FT+ ++     +I   + +   I    Y+D  +  + +E+ +   P
Sbjct: 180 IKNPKTIYTMEKLAFTTPSLPIGLDVIRFSETESGSIELSEYSDMKEFPE-IEFGFYDNP 238

Query: 221 IDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVI 280
             K  T         G  + SE F +  +      +S +    I       + FY++++ 
Sbjct: 239 FSKIFTA-------GGKNRLSESFQAIPWNATGLGLSTTIPQRIL---SLLSTFYYMLIS 288

Query: 281 PLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA 340
           PL  ++  +I+A + L FSR   P + +AY +  G      I     F K+G++L  ++ 
Sbjct: 289 PLACISSMIISAYLCLRFSRV--PTVTLAYLVPLG-----TINTFFIFLKAGMVLSNSSV 341

Query: 341 L--IPVIL 346
           L  +PV+L
Sbjct: 342 LPILPVML 349


>gi|146283385|ref|YP_001173538.1| permease [Pseudomonas stutzeri A1501]
 gi|145571590|gb|ABP80696.1| predicted permease [Pseudomonas stutzeri A1501]
          Length = 353

 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/193 (18%), Positives = 80/193 (41%), Gaps = 11/193 (5%)

Query: 24  AMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLN 83
           A++  F+ +L ++Q       +Y +           P  + +++P   L+  ++    L 
Sbjct: 27  ALLFAFIDELGDVQG------SYGLGDALQYVLLTSPRRLYEMLPMAALIGCLIGLGTLA 80

Query: 84  RTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGD 143
            +SEL I RA G+S+ +++   +   ++L +  +L+   +A   E I        +  G+
Sbjct: 81  SSSELTIMRAAGVSLGRIVLSVMKPMLVLLVAGILIGEYVAPLSEDIAQARRSLAQGAGE 140

Query: 144 KQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYN 203
            Q S    W    + Q++ F+    + P   +    T    D++ +++    A  A    
Sbjct: 141 AQSSKRGLW----HRQENEFVHVNAVQP-GGVLVGVTRYRFDEERRLLSSSFARRASYQG 195

Query: 204 DKVKLKKVVEYQY 216
           D  +L+ +    +
Sbjct: 196 DHWRLENIATTHF 208


>gi|124514757|gb|EAY56269.1| putative permease, YjgP/YjgQ family [Leptospirillum rubarum]
          Length = 362

 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 62/302 (20%), Positives = 120/302 (39%), Gaps = 45/302 (14%)

Query: 83  NRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNG 142
           ++  EL   RA GIS+ +   PF+   +L+ + ++ +   +     ++  D I+  + + 
Sbjct: 81  SKNHELTAIRAAGISLVKATKPFLALGVLISLISIAMNYQLVPYAYQM-TDYIKDVRIDQ 139

Query: 143 DKQKSDIIP----WMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADL 198
            K  +        W +  N  QDI+ GA+ I    +  +      +D+   +  + DA  
Sbjct: 140 GKSGNVTFELNNVWFRHGN--QDIY-GARTIRDGGNELDKVVLYHLDRTFHLSWQVDA-- 194

Query: 199 AIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIP---IKMDGFQKFSEQFASR-------- 247
                      K + Y  G         T  +P   +K++ FQK       R        
Sbjct: 195 -----------KTLRYHQGLWSFQDGHLTRFLPDGSLKIESFQKMDTTLTRRPVDFTYEK 243

Query: 248 ------SFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
                 S+ E+ + ++   KS++    + E     +I  P+    M L+A    +   R 
Sbjct: 244 TRMTHLSYPELDRYIALLEKSHLPRE-KYEVTRDAMIAFPIAAFLMVLMAIPFGIREGR- 301

Query: 302 NQPRIIVAYGI--FSGFMLYTIITIMKSFGKSGILLPVAAALIP--VILTISLSILILLQ 357
            Q  I   +GI        +TI ++  + GK G+LLP  +A     ++  +S+S+ +LL 
Sbjct: 302 -QVGIAKGFGISLLLSMSYWTIYSLGLALGKGGVLLPWISAWFANMIVFFVSISLFLLLN 360

Query: 358 KE 359
           + 
Sbjct: 361 RS 362


>gi|121534980|ref|ZP_01666798.1| permease YjgP/YjgQ family protein [Thermosinus carboxydivorans
           Nor1]
 gi|121306393|gb|EAX47317.1| permease YjgP/YjgQ family protein [Thermosinus carboxydivorans
           Nor1]
          Length = 361

 Score = 37.7 bits (86), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 57/306 (18%), Positives = 132/306 (43%), Gaps = 30/306 (9%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P II    P   L+ +++ F  L+ +SE+   ++ G+S ++L  P  + + ++ I  V+
Sbjct: 58  LPGIIVLTFPMSMLLASLLAFGRLSASSEITAMKSGGLSFFRLAAPVFIAAFVVSIVAVI 117

Query: 119 VINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           +   +         ++++   +    +  + I    + + + +    A+K    +     
Sbjct: 118 LNEAVVPRANNAYQNVLRYEIEKSRPKTQEHIVIKDVKDGEIERLTYARKF---DEAANA 174

Query: 179 FTSITIDK--KNKIIHRKDADLAIIYNDK--------------VKLKKVVEYQYGRIPID 222
             ++T+ +  K +++  ++A+ AI  N +               +L++ + +    +P++
Sbjct: 175 MYAVTVQEFDKGRLVRVENAEKAIWDNGRWIMESGIIYDVAPEGQLQRTLRFDKQFMPVE 234

Query: 223 KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPL 282
           K+      P ++   QK  E+   +   + IK +    +         E + +  + IP 
Sbjct: 235 KS------PREIAREQKKPEEMTIKELKQHIKVL----QREYVKTSTYEVELHQRLAIPA 284

Query: 283 MLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALI 342
             +   LI   + L+  RS+   I +   I   F+ YTI+T+  + G+ G +  V AA I
Sbjct: 285 ASLVFALIGTPLGLQPHRSSS-SIGLGISIIIIFIYYTIMTVFTALGQGGAIPAVLAAWI 343

Query: 343 PVILTI 348
           P I+ I
Sbjct: 344 PNIVFI 349


>gi|241760405|ref|ZP_04758500.1| permease YjgP/YjgQ [Neisseria flavescens SK114]
 gi|241319283|gb|EER55761.1| permease YjgP/YjgQ [Neisseria flavescens SK114]
          Length = 356

 Score = 37.7 bits (86), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 75/381 (19%), Positives = 157/381 (41%), Gaps = 60/381 (15%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELP--NYSISRGAVLAATRVPLIIQ 64
           RY  +      +Y LL  + L       EI N++G+L   +Y+ ++       ++P    
Sbjct: 6   RYIIRQMAVMAVYALLAFLALY---SFFEIINEVGDLGKGSYNSAKLGQYVLMQMPARAY 62

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           +++P   L+  ++    L   SEL + +A G+S  +LL       ++L  F ++      
Sbjct: 63  ELMPLAVLIGGLISLSQLASGSELTVIKASGMSTKKLL-------LILSQFGLIFAIATV 115

Query: 125 TSGEKIGIDLIQQWKD------NGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN----- 173
             GE +   L Q+ ++      NG     +   W++    +++  I  +++LP++     
Sbjct: 116 ALGEWVAPTLSQKAENIKAAAINGKISTGNTGLWLK----EKNSIINVREMLPDHTLLGI 171

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKV-KLKKVVEYQYGRIPID-KNSTTLNIP 231
            IW+       + KN++    +A+ A++  D   +LK +     G   ++   +   N P
Sbjct: 172 KIWQR------NDKNELTQAAEAESAVLNPDGSWQLKNIRRSILGEDKVEVSTAAEENWP 225

Query: 232 IK-----MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFL-----IVIP 281
           I      MD      +Q +       I  +  +N++         TQ Y +     +V P
Sbjct: 226 ISVKRNLMDVLLVKPDQMSVGELTTYIDHLEKNNQN---------TQVYAIAWWRKLVYP 276

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILL---PVA 338
           +    M L+A + + + +R     + +  GI  G + +    +   FG +  L    P  
Sbjct: 277 VAAWVMALVAFAFTPQTTRHGNMGLKLFGGICLGLLFHFAGRL---FGFTSQLYGVPPFL 333

Query: 339 AALIPVILTISLSILILLQKE 359
           A  +P +L   L++ ++ ++E
Sbjct: 334 AGALPTVLFALLAVYLIRRQE 354


>gi|322435367|ref|YP_004217579.1| permease YjgP/YjgQ family protein [Acidobacterium sp. MP5ACTX9]
 gi|321163094|gb|ADW68799.1| permease YjgP/YjgQ family protein [Acidobacterium sp. MP5ACTX9]
          Length = 813

 Score = 37.7 bits (86), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVV 107
           +P I+  + P   LV  +V F +L +TSE    +A G+S+++++ P +V
Sbjct: 478 IPYILYNVTPLCVLVAVLVTFGSLAKTSEFTAMKASGVSLYRVVTPVLV 526


>gi|319789793|ref|YP_004151426.1| permease YjgP/YjgQ family protein [Thermovibrio ammonificans HB-1]
 gi|317114295|gb|ADU96785.1| permease YjgP/YjgQ family protein [Thermovibrio ammonificans HB-1]
          Length = 359

 Score = 37.7 bits (86), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 72/139 (51%), Gaps = 10/139 (7%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP-FVVGSI--LL 112
           A  +P  +  +IP   ++  ++VF  +N  +EL  +++ GIS+ +L  P F++G I  LL
Sbjct: 54  AKGLPAFLGIVIPMSFVLSVVIVFIGMNSNNELTAAKSCGISLKELSKPVFLLGLIFSLL 113

Query: 113 GIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
             ++++ + P      K  + + ++ ++   K+ +  I   + S+    +    +K+ PE
Sbjct: 114 SFYSLMFLAP------KSNVAMKRELEELLRKKITLSITEKRFSSNFPGVTFYVEKLYPE 167

Query: 173 NHIWEDFTSITIDKKNKII 191
             +  +F + ++ KK K++
Sbjct: 168 KGLLVNFMA-SLQKKEKLV 185


>gi|119383653|ref|YP_914709.1| permease YjgP/YjgQ family protein [Paracoccus denitrificans PD1222]
 gi|119373420|gb|ABL69013.1| permease YjgP/YjgQ family protein [Paracoccus denitrificans PD1222]
          Length = 382

 Score = 37.7 bits (86), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +PL+I  ++P      +      L+  SELV  +A G+S W++  P +V  +L+ +   L
Sbjct: 57  LPLVISVVLPIAAFAASAYGTNRLSSESELVAMQATGMSPWRMARPVLVFGVLVALMVAL 116

Query: 119 VINPI 123
           +++ +
Sbjct: 117 LVHAV 121


>gi|191169423|ref|ZP_03031162.1| putative permease, YjgP/YjgQ family [Escherichia coli B7A]
 gi|309794090|ref|ZP_07688515.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|190900537|gb|EDV60347.1| putative permease, YjgP/YjgQ family [Escherichia coli B7A]
 gi|308122497|gb|EFO59759.1| conserved hypothetical protein [Escherichia coli MS 145-7]
          Length = 359

 Score = 37.4 bits (85), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 135/335 (40%), Gaps = 46/335 (13%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y  ++  ++    +P  + ++ PFI L+  IV    L++ SEL   R++G SI+++   
Sbjct: 43  GYRWTQAVLVVLMTLPRTLVELSPFIALLGGIVGLGQLSKNSELTAIRSMGFSIFRIALV 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +V  IL                  + +  I +W  +  +Q++     +QI +      +
Sbjct: 103 ALVAGILW----------------TVSLGAIDEWVASPLQQQA-----LQIKSTATA--L 139

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII-YNDKVKLKKVVEYQYGRIPIDK 223
           G    +  N +W    +  +  K+     +   + I  Y D + L+  +  +   I  DK
Sbjct: 140 GEDDDITGNMLWARRGNEFVTVKSLNEQGQPVGVEIFHYRDDLSLESYIYARSATIKDDK 199

Query: 224 NSTTLNIPIK--MDGFQ--------KFSEQFASRSFYEI-IKKMSFSNKS-NIFHNYRAE 271
                 +  K  ++G +         +   F S +  E+ +   SFS +  N + NY  E
Sbjct: 200 TWILHGVNHKKWLNGKETLEILDNLAWQSTFTSMNLEELSMPGNSFSVRQLNHYINYLQE 259

Query: 272 T---------QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
           T           +  +  P++ +AM L+A   +    RS      +A G+  G + +   
Sbjct: 260 TGQPSSEYRLALWEKLGHPILTLAMILLAVPFTFSAPRSPGMGSRLAVGVIVGLLTWISY 319

Query: 323 TIMKSFGKS-GILLPVAAALIPVILTISLSILILL 356
            IM + G    +  PVAA  +P+   ++  IL+ L
Sbjct: 320 QIMVNLGLLFALSAPVAALGLPMAFVLAALILVYL 354


>gi|254465542|ref|ZP_05078953.1| permease YjgP/YjgQ [Rhodobacterales bacterium Y4I]
 gi|206686450|gb|EDZ46932.1| permease YjgP/YjgQ [Rhodobacterales bacterium Y4I]
          Length = 364

 Score = 37.4 bits (85), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 56  ATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
           A  +P +I+ ++P       + V   LN  SEL + RA G S WQ+  P    ++  GI 
Sbjct: 46  ALTLPNLIRMVLPIAAFGAAVWVTNRLNSESELTVLRATGTSPWQMARP----ALAFGII 101

Query: 116 TVLVINPI 123
           T L+++ +
Sbjct: 102 TALMMSAL 109


>gi|298291096|ref|YP_003693035.1| permease YjgP/YjgQ family protein [Starkeya novella DSM 506]
 gi|296927607|gb|ADH88416.1| permease YjgP/YjgQ family protein [Starkeya novella DSM 506]
          Length = 385

 Score = 37.4 bits (85), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG 113
           +P +I  + P    +      F +N  SE+V+S A GIS W+ L P V+ ++++ 
Sbjct: 57  LPALILGLAPAALFMAVAYTLFRMNSDSEIVVSSAAGISTWRFLRPLVILALIVA 111


>gi|238064524|ref|ZP_04609233.1| hypothetical protein MCAG_05490 [Micromonospora sp. ATCC 39149]
 gi|237886335|gb|EEP75163.1| hypothetical protein MCAG_05490 [Micromonospora sp. ATCC 39149]
          Length = 852

 Score = 37.4 bits (85), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 10/93 (10%)

Query: 73  VVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGI 132
           +VN +    L RT EL + RAIG+   Q +    V ++++ +F  L+   + T    +G 
Sbjct: 741 IVNTLALSVLERTRELGLLRAIGLRRAQTMRMITVEAVVISVFGALLGVAVGTG---LGA 797

Query: 133 DLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIG 165
            +++  KD G      ++PW Q+      IF+G
Sbjct: 798 AVVRALKDEGITDL--VLPWSQMG-----IFLG 823


>gi|103487658|ref|YP_617219.1| permease YjgP/YjgQ [Sphingopyxis alaskensis RB2256]
 gi|98977735|gb|ABF53886.1| permease YjgP/YjgQ [Sphingopyxis alaskensis RB2256]
          Length = 366

 Score = 37.4 bits (85), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%)

Query: 8   YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQII 67
           Y  + +L  T   L   ++++  +DL     ++  +P    S        R+P II+  +
Sbjct: 15  YVGRLFLFRTFAILFALVLILQTLDLLGESGKILAVPGNGDSDVWRYVGMRMPQIIETFL 74

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQ 100
           PF  L+  I+    LN+ SE+V  +A G+S  Q
Sbjct: 75  PFSVLLGTILTMVTLNQNSEVVAMKAAGMSAHQ 107


>gi|227502943|ref|ZP_03932992.1| cell division protein [Corynebacterium accolens ATCC 49725]
 gi|227076365|gb|EEI14328.1| cell division protein [Corynebacterium accolens ATCC 49725]
          Length = 300

 Score = 37.4 bits (85), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 33  LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISR 92
           + E+ +Q  E+   + +  ++  AT +  I+  I   I LV N+V     +RT E  I R
Sbjct: 152 VEEVVDQQEEVREAASNLDSIRTATFIVAIVMSIAA-IFLVANMVQIAAFHRTRETEIMR 210

Query: 93  AIGISIWQLLNPFVVGSILLGIFTVLV 119
            +G S W    PFVV ++L  +  V++
Sbjct: 211 MVGASRWMTQAPFVVEAVLASLIGVVL 237


>gi|225871810|ref|YP_002753264.1| permease, YjgP/YjgQ family [Acidobacterium capsulatum ATCC 51196]
 gi|225794430|gb|ACO34520.1| permease, YjgP/YjgQ family [Acidobacterium capsulatum ATCC 51196]
          Length = 772

 Score = 37.4 bits (85), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 35/56 (62%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI 114
            P +I  I P   L+  +VVF  +NR+SE+   +A GIS+++++ P +V + L+ +
Sbjct: 462 TPSMIYLITPLAVLIAVLVVFGLMNRSSEITAMKATGISLYRIVLPIMVIASLMAV 517


>gi|298529509|ref|ZP_07016912.1| permease YjgP/YjgQ family protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510945|gb|EFI34848.1| permease YjgP/YjgQ family protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 355

 Score = 37.4 bits (85), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 75/372 (20%), Positives = 152/372 (40%), Gaps = 44/372 (11%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV---- 59
           +L RY  +  L  T   L    ++  ++D     N M E         A L A +V    
Sbjct: 3   VLNRYLLRQNLFYTAVLLFSGTMVYLIVDFVGRMNAMVE---------AGLGALQVLEYF 53

Query: 60  ----PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
               PLI+ Q +P I ++  ++    ++R++ELV   +  IS ++    F +G  L+ +F
Sbjct: 54  VFKMPLIVAQTLPAIFMLGVLIQMAMMHRSNELVAMESSAIS-FRKPAVFFIGYALV-VF 111

Query: 116 TVLVI--NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPEN 173
            +L +    +   GE++     Q W  +   +++ +     +    +D  I  ++     
Sbjct: 112 MLLFVFSETLGVRGEQVT---RQIWNQDVRDREAAVEGLEDVWVKDRDYMIHIERAHINE 168

Query: 174 HIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIK 233
              +DFT+       KI     A    ++ +++ L+ V  ++   +   ++   + + +K
Sbjct: 169 GRGKDFTAYKKSDPGKIQEIIKAPEFEVHKNRLLLRDVTVFKPHSLE-RQSLQEMEMEVK 227

Query: 234 MDGFQKFS--------EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLV 285
           +D  + F+        + ++  +   ++ ++  S  S      +  T  +  I  P  LV
Sbjct: 228 ID-LRSFALVDSDLPYQAWSIFTLSALVNQLKESGAS----VEKISTALHSKIAYPFALV 282

Query: 286 AMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVI 345
            MTL+A ++   F+R      +V  G+   F  YT+     S+ + G+  P   A     
Sbjct: 283 VMTLLALAL---FTRIKNIYALVTLGLVIVFFYYTVYVFGVSYAEEGVTAPFVGAWTA-- 337

Query: 346 LTISLSILILLQ 357
             +   IL LLQ
Sbjct: 338 -NVFFGILSLLQ 348


>gi|282892297|ref|ZP_06300693.1| hypothetical protein pah_c221o031 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281497888|gb|EFB40239.1| hypothetical protein pah_c221o031 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 359

 Score = 37.4 bits (85), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 42/72 (58%)

Query: 57  TRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT 116
           +++P I+  +IP  +L+ ++++   L++T EL   RA G +I  +L P ++ +  + +  
Sbjct: 34  SQIPYILPIVIPISSLIASLLLIQRLSQTHELTALRASGWAIRDILYPILIAAAFIALLN 93

Query: 117 VLVINPIATSGE 128
             +++ +AT+  
Sbjct: 94  FYIVSELATNSH 105


>gi|149196258|ref|ZP_01873313.1| permease YjgP/YjgQ [Lentisphaera araneosa HTCC2155]
 gi|149140519|gb|EDM28917.1| permease YjgP/YjgQ [Lentisphaera araneosa HTCC2155]
          Length = 358

 Score = 37.4 bits (85), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI 114
           +P     I P   L+  I  F +LNR  E++  R+ G+S+ +L  P  + S+L+GI
Sbjct: 58  IPDKFTYIAPMSLLLATIYCFSSLNRNHEVIAMRSAGLSLTKLSAPIYLFSVLVGI 113


>gi|32266995|ref|NP_861027.1| hypothetical protein HH1496 [Helicobacter hepaticus ATCC 51449]
 gi|32263047|gb|AAP78093.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 359

 Score = 37.4 bits (85), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 76/358 (21%), Positives = 141/358 (39%), Gaps = 35/358 (9%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSI---SRGAVLAATRVP 60
           +++R+   YYLK      LG       ID+ +  +++ +  N  I       + A T   
Sbjct: 1   MIFRFVGVYYLKYFFIIFLGLEGFFLAIDMLKYVDELPDSANLLILFLFYNGIFALTYT- 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP-FVVGSILLGIFTVLV 119
                 +P   ++ +I+ +    ++S+L    A+G S  Q+L P  V+ S+ +G F  L 
Sbjct: 60  ------LPISLVLCSILFYMAFLKSSQLTALMALGYSKRQILAPLLVISSVFIGGFIGLN 113

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILP---ENHIW 176
               A + E     + QQ   N  +        + + +  Q IFI  +K+ P   E    
Sbjct: 114 TTSFAYAKEYAESIIYQQNTQNAREN-------LLLKSDNQYIFI--RKLYPLLNEQARA 164

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNI 230
           E     T+D ++K+ +  +A  A   N+   LK V   +       G   + K +T+  I
Sbjct: 165 EGIKVFTLDGEHKLKNYHEAQEAFFENNVWILKNVKSLEIASSLTLGEKAL-KITTSGEI 223

Query: 231 PIKMDGFQKFSEQFA----SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVA 286
            I  D   K  E  A    + S  + I  +  ++K N+  + +  +  Y L+VIP  +  
Sbjct: 224 EILKDFSSKVLETIAQDKPTASVIDAIASLRIAHKQNVSSD-KIRSILYALLVIPFFVPL 282

Query: 287 MTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPV 344
              I +       R      I    I     ++ +   +     +G++ P    L+P+
Sbjct: 283 CIAIISYYIPSLPRYGNLTFISFVCIIGALAVWGLFFSLSQLSVAGLIYPEIGLLLPM 340


>gi|215488305|ref|YP_002330736.1| predicted permease [Escherichia coli O127:H6 str. E2348/69]
 gi|215266377|emb|CAS10814.1| predicted permease [Escherichia coli O127:H6 str. E2348/69]
          Length = 359

 Score = 37.0 bits (84), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 69/325 (21%), Positives = 129/325 (39%), Gaps = 50/325 (15%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y  ++  ++    +P  + ++ PFI L+  IV    L++ SEL   R+ G SI+++   
Sbjct: 43  GYRWTQAVLVVLMTLPRTLVELSPFIALLGGIVGLGQLSKNSELTAIRSTGFSIFRIALV 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +V  IL                  + +  I +W  +  +Q++     +QI +      +
Sbjct: 103 ALVAGILW----------------TVSLGAIDEWVASPLQQQA-----LQIKSTATA--L 139

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII-YNDKVKLKKVVEYQYGRIPIDK 223
           G    +  N +W    +  +  K+     +  D+ I  Y D + L+  +  +   I  DK
Sbjct: 140 GEDDDITGNMLWARRGNEFVTVKSLNEQGQPVDVEIFHYRDDLSLESYIYARSATIEDDK 199

Query: 224 NSTTLNIPIK--MDG--FQKFSEQFASRSFYEIIKKMSFSNKSNIFH--------NYRAE 271
                 +  K  ++G   Q+ S+  A +S +  +     S   N F         +Y  E
Sbjct: 200 TWILHGVNHKKWLNGKETQETSDYLAWQSTFTSMNLEELSMPGNTFSVRQLNHYIHYLQE 259

Query: 272 T---------QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRI--IVAYGIFSGFMLYT 320
           T           +  +  P++ +AM L+A  V   FS    PR+   +A G+  G + + 
Sbjct: 260 TGQPSSEYRLALWEKLGQPILTLAMILLA--VPFTFSAPRSPRMGSRLAVGVIVGLLTWI 317

Query: 321 IITIMKSFGKS-GILLPVAAALIPV 344
              IM + G    +  PV A  +PV
Sbjct: 318 SYQIMVNLGLLFALSAPVTALGLPV 342


>gi|332296606|ref|YP_004438529.1| permease YjgP/YjgQ family protein [Thermodesulfobium narugense DSM
           14796]
 gi|332179709|gb|AEE15398.1| permease YjgP/YjgQ family protein [Thermodesulfobium narugense DSM
           14796]
          Length = 365

 Score = 37.0 bits (84), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 65/318 (20%), Positives = 126/318 (39%), Gaps = 20/318 (6%)

Query: 51  GAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSI 110
           GA LAA  +P  I    P  TL+  ++    ++   ELV  R+ G+SI++   PF++  I
Sbjct: 54  GAKLAACGLPYSIAFAFPMATLLGVLMAVSRISSNWELVALRSAGLSIFKFSLPFIIIGI 113

Query: 111 LLGIFTVLVINPIATS-GEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKI 169
           +    +      +A    +K    + +  K   + ++ +++  +   +PQ    I AK  
Sbjct: 114 IFSTVSFFTFEKLAYPLLDKSRYIIAKDLKKELNTERQNVLFKLPPDSPQPKFIIFAKDY 173

Query: 170 LPENHIWEDFTSITIDKKNKIIHRK--DADLAIIYNDKVKLKKVVEYQY-------GRIP 220
            P     +D      D  N+ + R    ++L+   N  V   K + Y++       GR+ 
Sbjct: 174 KPATMSLQDVYIQEFD--NEFLKRTIYSSELSFTGNRWVA-SKGLSYEFSKDGIIVGRLD 230

Query: 221 IDKNSTTLNI-PIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIV 279
            +K    L + P  +      +++    SF+E++  +  SN  +I          Y  + 
Sbjct: 231 FEKLIVPLGVLPQTVKALP--TKKPRDMSFFELLSYL--SNSKDIVDK-SLYVDLYNKLS 285

Query: 280 IPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           +P    A   I  +  +   R +   I     I +    Y I ++  + G    L P  A
Sbjct: 286 LPFACFAFACIGVAFGIASERKSS-AIGFGIAITTVLFYYLIFSLFTTLGYMSYLPPFIA 344

Query: 340 ALIPVILTISLSILILLQ 357
           +    IL     I ++++
Sbjct: 345 SFGADILITIFGIFMVVK 362


>gi|257465008|ref|ZP_05629379.1| permease, inner membrane protein yjgQ [Actinobacillus minor 202]
 gi|257450668|gb|EEV24711.1| permease, inner membrane protein yjgQ [Actinobacillus minor 202]
          Length = 360

 Score = 37.0 bits (84), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 269 RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF 328
           R E  F+  +  P+ +  M L+A S      RS+     +  GI +GFM Y    +  + 
Sbjct: 268 RFEITFWRKVYQPISMAVMMLLAISFIFGPLRSSTMGAKIVIGIVAGFMFYVANIVFGNM 327

Query: 329 GKSGILLPVA-AALIPVILTISLSILILLQKED 360
                 LPV+  ALIP ++ +S+   +L +K D
Sbjct: 328 SLIATWLPVSIGALIPSLICLSIVWWLLTKKRD 360


>gi|325853208|ref|ZP_08171296.1| permease, YjgP/YjgQ family [Prevotella denticola CRIS 18C-A]
 gi|325484384|gb|EGC87307.1| permease, YjgP/YjgQ family [Prevotella denticola CRIS 18C-A]
          Length = 703

 Score = 37.0 bits (84), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (53%)

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +++ Q +P   L+ +++ + NL  +SEL   ++ GIS+ Q     +V S+L+   +    
Sbjct: 121 MMVPQALPLAILLSSLISYGNLGESSELTAIKSAGISLVQSFRGLIVISVLIACGSFYFQ 180

Query: 121 NPIATSGEK 129
           N +  S +K
Sbjct: 181 NNVGPSAQK 189


>gi|326561252|gb|EGE11611.1| putative ABC transporter permease protein YjgP/YjgQ [Moraxella
           catarrhalis 46P47B1]
          Length = 120

 Score = 37.0 bits (84), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 58/113 (51%), Gaps = 11/113 (9%)

Query: 11  KYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPN----YSISRGAVLAATRVPLIIQQI 66
           KY +++ L  + GA++ ++++ +  +   + EL N    Y+++   +    R P  + Q 
Sbjct: 8   KYVIRSALLAMAGAVVGLWLVQM--VFAYLAELDNISETYTLTDALLFILYRSPYFLVQF 65

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISI-----WQLLNPFVVGSILLGI 114
           IP  TL+  ++    L   SEL++ RA G+SI     W +L   +  +I LG+
Sbjct: 66  IPTGTLLGAVIGLGLLANHSELIVMRAAGMSIYRIVSWAMLPAVIFVAISLGV 118


>gi|320539288|ref|ZP_08038958.1| putative conserved inner membrane protein [Serratia symbiotica str.
           Tucson]
 gi|320030680|gb|EFW12689.1| putative conserved inner membrane protein [Serratia symbiotica str.
           Tucson]
          Length = 356

 Score = 37.0 bits (84), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 79/380 (20%), Positives = 150/380 (39%), Gaps = 45/380 (11%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G+L RY  K    T +  L   + L  +I   +   ++G+  +Y++    +     VP
Sbjct: 1   MFGVLDRYIGKTIFNTIIMTLFMLVSLSGIIKFVDQLRRVGQ-GDYTVLGAGMFTLLSVP 59

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
             I+   P   L+  ++    L   SELV+ +A G +  Q+    +  +I L + T+ + 
Sbjct: 60  KDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRMQIAGSVMKTAIPLVLLTMAIG 119

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
             +A  G+++  D   Q    G    +    W +  N     FI  +++  E  +     
Sbjct: 120 EWVAPQGDQMAHDFRAQQMYGGSLLSTKSGLWAKDGND----FIYIERVSGEKEL----- 170

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKV-----VEYQYGRIPIDK-NSTTLNIPIKM 234
                    I H         +ND+ +L+ V       ++ G   + + +++ L     +
Sbjct: 171 -----AGVNIYH---------FNDRRRLETVRYAATASFEDGVWKLSQVDTSDLTNEELV 216

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKS---NIFHNY------------RAETQFYFLIV 279
            G Q  + ++ +    E +  ++    S      HNY            R +   +  I 
Sbjct: 217 TGTQTLTGEWKTNLTPEKLGVVALDPTSLSIKGLHNYVKYLKQSGQEANRYQLNMWNKIF 276

Query: 280 IPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
            PL +  M L+A S      RS    I V  GI  GF+ Y +  I         + PV  
Sbjct: 277 SPLSVAVMMLMALSFIFGPLRSVPMGIRVVTGISFGFLFYVLDQIFGQLSLVYNMPPVLG 336

Query: 340 ALIPVILTISLSILILLQKE 359
           AL+P ++ + +S+ +LL+++
Sbjct: 337 ALLPSMMFLLISMYMLLKRK 356


>gi|242761384|ref|XP_002340169.1| chromate ion transporter, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218723365|gb|EED22782.1| chromate ion transporter, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 521

 Score = 37.0 bits (84), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 17/116 (14%)

Query: 29  FVIDLNEIQNQMGELPNYSISRGAV-LAATRVPLIIQQI-------IPFITLVVNIVVFF 80
           F+I L  IQ   G   N+++  GA+ L A+R P ++  I       IP ITL V +  F+
Sbjct: 371 FLIGLAIIQAWPGPNFNFAVYLGALALRASRYPTVLGAILGFLGIFIPGITLAVAVQSFW 430

Query: 81  NLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN---PIATSGEKIGID 133
            + R ++ V+    G      LN   VG +   ++ +  I    P ATSG+ + +D
Sbjct: 431 RVLRKNKWVVDLLHG------LNATAVGLVFTAVYRLWNIGYLTPEATSGQSLALD 480


>gi|193062018|ref|ZP_03043114.1| putative permease, YjgP/YjgQ family [Escherichia coli E22]
 gi|300824069|ref|ZP_07104190.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|331669796|ref|ZP_08370641.1| putative permease [Escherichia coli TA271]
 gi|192932238|gb|EDV84836.1| putative permease, YjgP/YjgQ family [Escherichia coli E22]
 gi|300523459|gb|EFK44528.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|331062709|gb|EGI34623.1| putative permease [Escherichia coli TA271]
          Length = 359

 Score = 37.0 bits (84), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 134/335 (40%), Gaps = 46/335 (13%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y  ++  ++    +P  + ++ PFI L+  IV    L++ SEL   R+ G SI+++   
Sbjct: 43  GYRWTQAVLVVLMTLPRTLVELSPFIALLGGIVGLGQLSKNSELTAIRSTGFSIFRIALV 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +V  IL                  + +  I +W  +  +Q++     +QI +      +
Sbjct: 103 ALVAGILW----------------TVSLGAIDEWVASPLQQQA-----LQIKSTATA--L 139

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII-YNDKVKLKKVVEYQYGRIPIDK 223
           G    +  N +W    +  +  K+     +   + I  Y D + L+  +  +   I  DK
Sbjct: 140 GEDDDITGNMLWARRGNEFVTVKSLNEQGQPVGVEIFHYRDDLSLESYIYARSATIEDDK 199

Query: 224 NSTTLNIPIK--MDGFQ--------KFSEQFASRSFYEI-IKKMSFSNKS-NIFHNYRAE 271
                 +  K  ++G +         +   F S +  E+ +   SFS +  N + NY  E
Sbjct: 200 TWILHGVNHKKWLNGKETLEILDNLAWQSTFTSMNLEELSMPGNSFSVRQLNHYINYLQE 259

Query: 272 T---------QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
           T           +  +  P++ +AM L+A   +    RS      +A G+  G + +   
Sbjct: 260 TGQPSSEYRLALWEKLGHPILTLAMILLAVPFTFSAPRSPGMGSRLAVGVIVGLLTWISY 319

Query: 323 TIMKSFGKS-GILLPVAAALIPVILTISLSILILL 356
            IM + G    +  PVAA  +P+   ++  IL+ L
Sbjct: 320 QIMVNLGLLFALSAPVAALGLPMAFVLAALILVYL 354


>gi|240948567|ref|ZP_04752940.1| permease, inner membrane protein yjgQ [Actinobacillus minor NM305]
 gi|240297075|gb|EER47646.1| permease, inner membrane protein yjgQ [Actinobacillus minor NM305]
          Length = 360

 Score = 37.0 bits (84), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 269 RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSF 328
           R E  F+  +  P+ +  M L+A S      RS+     +  GI +GFM Y    +  + 
Sbjct: 268 RFEITFWRKVYQPISMAVMMLLAISFIFGPLRSSTMGAKIVIGIVAGFMFYVANIVFGNM 327

Query: 329 GKSGILLPVA-AALIPVILTISLSILILLQKED 360
                 LPV+  ALIP ++ +S+   +L +K D
Sbjct: 328 SLIATWLPVSIGALIPSLICLSIVWWLLTKKRD 360


>gi|293449327|ref|ZP_06663748.1| hypothetical protein ECCG_02358 [Escherichia coli B088]
 gi|291322417|gb|EFE61846.1| hypothetical protein ECCG_02358 [Escherichia coli B088]
          Length = 359

 Score = 37.0 bits (84), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 134/335 (40%), Gaps = 46/335 (13%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y  ++  ++    +P  + ++ PFI L+  IV    L++ SEL   R+ G SI+++   
Sbjct: 43  GYRWTQAVLVVLMTLPRTLVELSPFIALLGGIVGLGQLSKNSELTAIRSTGFSIFRIALV 102

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +V  IL                  + +  I +W  +  +Q++     +QI +      +
Sbjct: 103 ALVAGILW----------------TVSLGAIDEWVASPLQQQA-----LQIKSTATA--L 139

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII-YNDKVKLKKVVEYQYGRIPIDK 223
           G    +  N +W    +  +  K+     +   + I  Y D + L+  +  +   I  DK
Sbjct: 140 GEDDDITGNMLWARRGNEFVTVKSLNEQGQPVGVEIFHYRDDLSLESYIYARSATIEDDK 199

Query: 224 NSTTLNIPIK--MDGFQ--------KFSEQFASRSFYEI-IKKMSFSNKS-NIFHNYRAE 271
                 +  K  ++G +         +   F S +  E+ +   SFS +  N + NY  E
Sbjct: 200 TWILHGVNHKKWLNGKETLEILDNLAWQSTFTSMNLEELSMPGNSFSVRQLNHYINYLQE 259

Query: 272 T---------QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
           T           +  +  P++ +AM L+A   +    RS      +A G+  G + +   
Sbjct: 260 TGQPSSEYRLALWEKLGHPILTLAMILLAVPFTFSAPRSPGMGSRLAVGVIVGLLTWISY 319

Query: 323 TIMKSFGKS-GILLPVAAALIPVILTISLSILILL 356
            IM + G    +  PVAA  +P+   ++  IL+ L
Sbjct: 320 QIMVNLGLLFALSAPVAALGLPMAFVLAALILVYL 354


>gi|325279047|ref|YP_004251589.1| permease YjgP/YjgQ family protein [Odoribacter splanchnicus DSM
           20712]
 gi|324310856|gb|ADY31409.1| permease YjgP/YjgQ family protein [Odoribacter splanchnicus DSM
           20712]
          Length = 487

 Score = 36.6 bits (83), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 54  LAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG 113
           +A T VP+ +    P   L+ +I+ F +L    EL+  ++ GIS+++++ P ++  I L 
Sbjct: 56  VATTLVPMAL----PLAVLLSSIMTFGSLGENYELIALKSAGISLYRIMKPLIILIICLT 111

Query: 114 IFTVLVINPI 123
           +F  +  N I
Sbjct: 112 VFAFVFSNNI 121


>gi|82701537|ref|YP_411103.1| permease YjgP/YjgQ [Nitrosospira multiformis ATCC 25196]
 gi|82409602|gb|ABB73711.1| permease YjgP/YjgQ [Nitrosospira multiformis ATCC 25196]
          Length = 354

 Score = 36.6 bits (83), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQL-LN 103
            YS+    +  A  +P    Q+ PFI L+ N+     L   SEL   R  G+S   + L 
Sbjct: 43  TYSVKDAFLYTALLLPRRFIQLAPFIALMGNVTALGRLAVGSELTALRGAGVSPLGISLA 102

Query: 104 PFVVGSILLGIFTVL 118
           P VVG ILL   TVL
Sbjct: 103 PVVVGIILLLFITVL 117


>gi|33151746|ref|NP_873099.1| hypothetical protein HD0552 [Haemophilus ducreyi 35000HP]
 gi|33147967|gb|AAP95488.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 360

 Score = 36.6 bits (83), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 79/363 (21%), Positives = 150/363 (41%), Gaps = 16/363 (4%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RY  K  +      LL +  LVF+I L E    +GE  NY        A   +P  I
Sbjct: 8   ILERYIGKTIIMMMFAVLLMSSGLVFIIKLVEEFKNVGE-GNYDALTATYYALLMLPSDI 66

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           ++ +P + L+  ++   NL   SELV+ ++ G S +++    +  +I + I T+     I
Sbjct: 67  KEFVPVVLLIGGLLGLSNLASHSELVVMQSTGFSRFRIGLAVMKTAIPIIILTMSASEWI 126

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
               E+   ++    +  G    ++   W +  N     F+  + I  E+ +     +I+
Sbjct: 127 IPKVEQFARNMRSVAQSGGSMLSTNGGFWAKDGNN----FLYIRHIENEHQL----NNIS 178

Query: 184 IDK-KNKIIHRKDADLAIIYNDK----VKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
           I   +NK++       + ++N K      L+      +G     + +      I      
Sbjct: 179 IYHFENKVLTSVSQADSALFNGKDWTLQNLQTATITDHGIQTTHQANQNWQTTITPSKLG 238

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
             S +  S S   +   +SF  ++    + R +  F+  +  P+ +  M L+A S     
Sbjct: 239 IVSLKPESLSIAGLADYVSFLTETGQ-DSKRFQIAFWRKVYQPISMAVMMLLAISFIFGP 297

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVA-AALIPVILTISLSILILLQ 357
            RS+     +  GI +GF+ Y    +  +       LP+A  ALIP ++ +++   +L +
Sbjct: 298 LRSSAMGTKLFIGIIAGFIFYVSNIVFGNMTLVFSWLPIAIGALIPSLICLAIVWWLLTK 357

Query: 358 KED 360
           K D
Sbjct: 358 KRD 360


>gi|218696688|ref|YP_002404355.1| hypothetical protein EC55989_3395 [Escherichia coli 55989]
 gi|218353420|emb|CAU99485.1| conserved hypothetical protein; putative membrane protein
           [Escherichia coli 55989]
          Length = 386

 Score = 36.6 bits (83), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 134/335 (40%), Gaps = 46/335 (13%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y  ++  ++    +P  + ++ PFI L+  IV    L++ SEL   R+ G SI+++   
Sbjct: 70  GYRWTQAVLVVLMTLPRTLVELSPFIALLGGIVGLGQLSKNSELTAIRSTGFSIFRIALV 129

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +V  IL                  + +  I +W  +  +Q++     +QI +      +
Sbjct: 130 ALVAGILW----------------TVSLGAIDEWVASPLQQQA-----LQIKSTATA--L 166

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII-YNDKVKLKKVVEYQYGRIPIDK 223
           G    +  N +W    +  +  K+     +   + I  Y D + L+  +  +   I  DK
Sbjct: 167 GEDDDITGNMLWARRGNEFVTVKSLNEQGQPVGVEIFHYRDDLSLESYIYARSATIEDDK 226

Query: 224 NSTTLNIPIK--MDGFQ--------KFSEQFASRSFYEI-IKKMSFSNKS-NIFHNYRAE 271
                 +  K  ++G +         +   F S +  E+ +   SFS +  N + NY  E
Sbjct: 227 TWILHGVNHKKWLNGKETLEILDNLAWQSTFTSMNLEELSMPGNSFSVRQLNHYINYLQE 286

Query: 272 T---------QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
           T           +  +  P++ +AM L+A   +    RS      +A G+  G + +   
Sbjct: 287 TGQPSSEYRLALWEKLGHPILTLAMILLAVPFTFSAPRSPGMGSRLAVGVIVGLLTWISY 346

Query: 323 TIMKSFGKS-GILLPVAAALIPVILTISLSILILL 356
            IM + G    +  PVAA  +P+   ++  IL+ L
Sbjct: 347 QIMVNLGLLFALSAPVAALGLPMAFVLAALILVYL 381


>gi|327314112|ref|YP_004329549.1| permease [Prevotella denticola F0289]
 gi|326944181|gb|AEA20066.1| permease, YjgP/YjgQ family [Prevotella denticola F0289]
          Length = 645

 Score = 36.6 bits (83), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (53%)

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +++ Q +P   L+ +++ + NL  +SEL   ++ GIS+ Q     +V S+L+   +    
Sbjct: 63  MMVPQALPLAILLSSLISYGNLGESSELTAIKSAGISLVQSFRGLIVISVLIACGSFYFQ 122

Query: 121 NPIATSGEK 129
           N +  S +K
Sbjct: 123 NNVGPSAQK 131


>gi|317486218|ref|ZP_07945052.1| permease YjgP/YjgQ family protein [Bilophila wadsworthia 3_1_6]
 gi|316922517|gb|EFV43769.1| permease YjgP/YjgQ family protein [Bilophila wadsworthia 3_1_6]
          Length = 357

 Score = 36.6 bits (83), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 72/366 (19%), Positives = 146/366 (39%), Gaps = 27/366 (7%)

Query: 9   FFKYYLKTTLYFLLGAMIL-VFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPLIIQQ 65
            F+Y  K     LL  + + + +  L ++  ++       +S G VL     ++PL+I Q
Sbjct: 4   LFRYLTKNNAMILLPTLAVGIGLYVLTDLFERLDNFIEAGLSVGMVLTYFVVKMPLVISQ 63

Query: 66  IIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIAT 125
           I+P I L+  ++    + R+ EL   +A GIS+  + N  ++  I  G   +     +  
Sbjct: 64  ILPVIFLLSTVIQLCIMARSRELTALQAGGISLGVVANSMILCGIFWGGVQLGFSEYLGV 123

Query: 126 SGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITID 185
           +GE+   +  + W++   K+         +     D  +    + P+ H    F+   + 
Sbjct: 124 AGER---ESARIWQEEVRKKNLAATVLKDVWFTDGDWIVSLGTLDPQAHG-TGFSGYELS 179

Query: 186 KKNKIIHR-KDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD--GFQKFS- 241
                I R   A       +   L+ V  Y       ++    + +P++ D   F+  S 
Sbjct: 180 DDGLSIKRIVQASTFTAEPNHWALQDVRVYTPDTFTQEQEPDFV-LPLRQDPETFRLVST 238

Query: 242 ----EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
               +Q       + I ++  S+ SN+       T ++  +     ++ M  +A ++   
Sbjct: 239 GTKPQQLPLWQLGDAISQLK-SSGSNV---EALRTAWHAKLAYAASILVMAFVATAI--- 291

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAA----LIPVILTISLSIL 353
            S  +   I V   +   F+ + + T+  + G+ GIL P  AA    LI +       I 
Sbjct: 292 VSWKDNIYIAVTVALLCTFLYFAVYTLGTTLGQRGILHPFLAAWTANLIALFFAFWRLIP 351

Query: 354 ILLQKE 359
           +LL++E
Sbjct: 352 LLLRRE 357


>gi|13476526|ref|NP_108096.1| hypothetical protein mll7866 [Mesorhizobium loti MAFF303099]
 gi|14027287|dbj|BAB54241.1| mll7866 [Mesorhizobium loti MAFF303099]
          Length = 400

 Score = 36.6 bits (83), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%)

Query: 54  LAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG 113
           +AA  +P II  ++PF  +V        +N  SELV+  A G S W ++ P ++ ++   
Sbjct: 52  VAALILPSIIPIVVPFALVVAVAQTLSVMNSDSELVVVNAAGASRWTIVRPIMLLALAAS 111

Query: 114 IFTVLVINPIATSGEKIGIDLIQQ 137
           +F+  V N I     +    L+ Q
Sbjct: 112 VFSFAVDNGIDPYARQKNRALVAQ 135


>gi|126441903|ref|YP_001058063.1| hypothetical protein BURPS668_1013 [Burkholderia pseudomallei 668]
 gi|126221396|gb|ABN84902.1| putative membrane protein [Burkholderia pseudomallei 668]
          Length = 383

 Score = 36.6 bits (83), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 8/116 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYF +    T ++ L     L F  DL    N +G   NY      +  A + P    +I
Sbjct: 6   RYFARQIYVTFIFVLFAFSGLFFFFDLISELNSVGH-GNYKFGYAVLRVALQAPSRFYEI 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLN-------PFVVGSILLGIF 115
           IP   L+  I VF  +   SE  I R  G++  Q L        P V+ + L+G F
Sbjct: 65  IPVAALISAIYVFAQMAANSEFTIFRVSGLATNQALRSLVKIGVPIVIATYLIGEF 120


>gi|331679053|ref|ZP_08379725.1| putative permease [Escherichia coli H591]
 gi|331073118|gb|EGI44441.1| putative permease [Escherichia coli H591]
          Length = 386

 Score = 36.6 bits (83), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 134/335 (40%), Gaps = 46/335 (13%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP 104
            Y  ++  ++    +P  + ++ PFI L+  IV    L++ SEL   R+ G SI+++   
Sbjct: 70  GYRWTQAVLVVLMTLPRTLVELSPFIALLGGIVGLGQLSKNSELTAIRSTGFSIFRIALV 129

Query: 105 FVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI 164
            +V  IL                  + +  I +W  +  +Q++     +QI +      +
Sbjct: 130 ALVAGILW----------------TVSLGAIDEWVASPLQQQA-----LQIKSTATA--L 166

Query: 165 GAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAII-YNDKVKLKKVVEYQYGRIPIDK 223
           G    +  N +W    +  +  K+     +   + I  Y D + L+  +  +   I  DK
Sbjct: 167 GEDDDITGNMLWARRGNEFVTVKSLNEQGQPVGVEIFHYRDDLSLESYIYARSATIEDDK 226

Query: 224 NSTTLNIPIK--MDGFQ--------KFSEQFASRSFYEI-IKKMSFSNKS-NIFHNYRAE 271
                 +  K  ++G +         +   F S +  E+ +   SFS +  N + NY  E
Sbjct: 227 TWILHGVNHKKWLNGKETLEILDNLAWQSTFTSMNLEELSMPGNSFSVRQLNHYINYLQE 286

Query: 272 T---------QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
           T           +  +  P++ +AM L+A   +    RS      +A G+  G + +   
Sbjct: 287 TGQPSSEYRLALWEKLGHPILTLAMILLAVPFTFSAPRSPGMGSRLAVGVIVGLLTWISY 346

Query: 323 TIMKSFGKS-GILLPVAAALIPVILTISLSILILL 356
            IM + G    +  PVAA  +P+   ++  IL+ L
Sbjct: 347 QIMVNLGLLFALSAPVAALGLPMAFVLAALILVYL 381


>gi|53718605|ref|YP_107591.1| putative permease [Burkholderia pseudomallei K96243]
 gi|167814687|ref|ZP_02446367.1| putative permease protein [Burkholderia pseudomallei 91]
 gi|167909936|ref|ZP_02497027.1| putative permease protein [Burkholderia pseudomallei 112]
 gi|52209019|emb|CAH34959.1| putative permease protein [Burkholderia pseudomallei K96243]
          Length = 383

 Score = 36.6 bits (83), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 8/116 (6%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYF +    T ++ L     L F  DL    N +G   NY      +  A + P    +I
Sbjct: 6   RYFARQIYVTFIFVLFAFSGLFFFFDLISELNSVGH-GNYKFGYAVLRVALQAPSRFYEI 64

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLN-------PFVVGSILLGIF 115
           IP   L+  I VF  +   SE  I R  G++  Q L        P V+ + L+G F
Sbjct: 65  IPVAALISAIYVFAQMAANSEFTIFRVSGLATNQALRSLVKIGVPIVIATYLIGEF 120


>gi|332535155|ref|ZP_08410964.1| putative permease [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035425|gb|EGI71924.1| putative permease [Pseudoalteromonas haloplanktis ANT/505]
          Length = 370

 Score = 36.6 bits (83), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 61/323 (18%), Positives = 133/323 (41%), Gaps = 22/323 (6%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPL 61
           +++RY     LK+ +   L  M +     L  I   +G+    SI    VL+  A ++P 
Sbjct: 2   LIFRYLTAEVLKSQVAVFLTLMTIFLSQKLVGI---LGDASEGSIPAKLVLSMIALKLPQ 58

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
           +   I+P    +  I+ +  +   SE+ + +A G+S W ++   ++ S+ L I    +  
Sbjct: 59  LASLILPLSIFLGIILAYSRIYADSEMTVLKACGVSEWYVVRVTLISSVGLAILAAALTM 118

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFI-----GAKKILPENHIW 176
            IA    +    L +Q K +          + +  N +  +FI     G K++   N ++
Sbjct: 119 YIAPWASEQEYQLKEQAKADAGLSALRAGRFQETGNEKAVVFIHNIEKGGKEL---NKVF 175

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG 236
                +   +K  +     A+  ++       +++V     R   D  +  LN    +  
Sbjct: 176 --VAQLPDSEKGNLARLVYAEQGVVVEAVNGEQQLVLTDGKRYETDGTTPALN----LTE 229

Query: 237 FQKFSEQFASRSFYEIIKKMSF--SNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
           F  +S Q   +      +K+    +N+    +   +  Q+ + + IPL +  +TL+A  +
Sbjct: 230 FDGYSVQIREQEIEHQRRKLEAVPTNQLLAINTPESIAQWQWRLAIPLSIPLLTLLAVPL 289

Query: 295 SLEFSRSNQ-PRIIVAYGIFSGF 316
           S+   R  +  +++ A  ++ G+
Sbjct: 290 SVVNPRQGKFAKLVPAISLYLGY 312


>gi|153007032|ref|YP_001381357.1| permease YjgP/YjgQ family protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030605|gb|ABS28373.1| permease YjgP/YjgQ family protein [Anaeromyxobacter sp. Fw109-5]
          Length = 358

 Score = 36.6 bits (83), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%)

Query: 54  LAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLG 113
           L A +  ++++Q+ P   ++   +      RT E    RA+G+  W+L  P    ++L G
Sbjct: 50  LYANKTAVVVRQVAPAAMVLGAAIAVSTFRRTREYTAMRALGLGPWRLAGPVAAVTLLAG 109

Query: 114 IFTVLV 119
              V+V
Sbjct: 110 AALVVV 115


>gi|332292438|ref|YP_004431047.1| permease YjgP/YjgQ family protein [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332170524|gb|AEE19779.1| permease YjgP/YjgQ family protein [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 358

 Score = 36.6 bits (83), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 57/290 (19%), Positives = 120/290 (41%), Gaps = 32/290 (11%)

Query: 82  LNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQW--K 139
           L   +E++   + G+S ++ L P+++G+ ++ +    +   +A    K   + I ++  K
Sbjct: 80  LANNTEVIAFLSSGVSFYRFLRPYLIGATIVCVGAFFLGTYLAPRANKGYNEFIFEYLKK 139

Query: 140 DNGDKQKSDIIPWMQISNPQQDIFIGA---KKILPENHIWEDFTSITIDKKNKIIHRKDA 196
           +  D++  ++  + QI      I++ +   +     N  WE F      + NK+ ++  A
Sbjct: 140 NKKDRETQNV--YRQIDTGDY-IYVSSFTPRTKTGRNFTWEHF------EGNKMTYKMSA 190

Query: 197 DLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF-----------SEQFA 245
            + I YN++     +  ++  +  I +N   L    K+D    F           +E  +
Sbjct: 191 -IRIRYNEEDTTYTLNSFK--KRTITENGDILESKAKLDTVFNFDMDDLTPVEYIAETLS 247

Query: 246 SRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPR 305
           +    + I K   S  S+    Y    Q  +   +P+    +T+IA +VS    R     
Sbjct: 248 TPELRKFIAKEK-SRGSSYISRYEVTLQKRY--SLPVAAYILTIIAVAVS-AMKRRGGMG 303

Query: 306 IIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           I +A+GI   F+      +  +  +     P+ A   P IL   L++ +L
Sbjct: 304 INLAFGIVLAFVFIFFDKVFGTLAEQSDFPPLVAVWTPNILFAILAVYLL 353


>gi|172036942|ref|YP_001803443.1| putative permease YjgP/YjgQ [Cyanothece sp. ATCC 51142]
 gi|171698396|gb|ACB51377.1| putative permease YjgP/YjgQ [Cyanothece sp. ATCC 51142]
          Length = 394

 Score = 36.6 bits (83), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 54/313 (17%), Positives = 131/313 (41%), Gaps = 36/313 (11%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           ++P  +    P   L+  ++ +  L+  SE++  R++G+S+++L+ P ++  +++     
Sbjct: 76  KMPGFVSLAFPMAMLLAALMAYSRLSSDSEIIALRSLGVSVYRLIIPVILFGLVVTGCAF 135

Query: 118 LV---INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ--QDIFIGAKKILPE 172
           +V   I P AT    + +      +    K+++ + P  +    +  Q + +  +    E
Sbjct: 136 IVNDWIAPAATHEAAVTLQRAVNQERPDFKERNIVYPEYKTVQEEDGQQVTVLTRLFYAE 195

Query: 173 NHIWEDFTSITI-----DKKNKIIHRKDADLAI------IYNDKVKL-------KKVVEY 214
            +  +    +TI     +  N+I+  + A   I       +N  + L       + +V +
Sbjct: 196 EYNGDKMQGLTILDRTQEGVNQIVTSESATWNISSNTWDFFNGTIYLIAPDGSYRNIVRF 255

Query: 215 QYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQF 274
           Q+ ++ + +    L      +  Q F+E   +++  E +K M  S         +   Q 
Sbjct: 256 QHQQLALPRAPLDL-----ANRRQNFTEMTIAQT-QEYLKAMQLSGNEKRVRKVKVRLQE 309

Query: 275 YFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG--FMLYTIITIMKSFGKSG 332
            +   +P + +   ++ A++ +    +N+     ++G+  G  F  Y +  +  S G  G
Sbjct: 310 KY--AMPFVCLIFGVVGAAIGVRPQNTNKA---TSFGVCVGLIFGYYLLAFMSTSLGIWG 364

Query: 333 ILLPVAAALIPVI 345
           +L P   A +P I
Sbjct: 365 VLTPFLGAWLPNI 377


>gi|311739766|ref|ZP_07713600.1| probable cell division protein [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304839|gb|EFQ80908.1| probable cell division protein [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 300

 Score = 36.6 bits (83), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 33  LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISR 92
           + ++ +Q  E+ + + +  ++  AT V  I+  +   I LV N+V     +RT E  I R
Sbjct: 152 VEDVVDQQQEVRDAASNLDSIRNATFVLAIVMSVAA-IFLVANMVQIAAFHRTRETEIMR 210

Query: 93  AIGISIWQLLNPFVVGSILLGIFTVLV 119
            +G S W    PFVV ++L  +  V++
Sbjct: 211 MVGASRWMTQAPFVVEAVLASLIGVVL 237


>gi|162148705|ref|YP_001603166.1| permease [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545528|ref|YP_002277757.1| permease YjgP/YjgQ family protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787282|emb|CAP56876.1| putative permease [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533205|gb|ACI53142.1| permease YjgP/YjgQ family protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 377

 Score = 36.6 bits (83), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 12/140 (8%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAV-LAATRVPL 61
           G+L RY  +      L    GA++L  +  L  ++     L  +   RGA+   A   PL
Sbjct: 15  GVLTRYLTRELAGRILTA--GAILLALMEILALLEQLTPILERHQGLRGALYFMALHAPL 72

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGI---SIWQLLNPFVVGSILLGIFTVL 118
           ++  I P   L+ ++V+  ++   SE+ I RA G+   ++ +L+ P V+G   LG+   L
Sbjct: 73  LLGSIFPLAVLIGSLVMLVHMTTASEIAILRAAGLTTPALVRLMLPAVLG---LGLAATL 129

Query: 119 VINPIATSGEKIGIDLIQQW 138
           + + +    E   + L + W
Sbjct: 130 IDDQVTPRAE---LALARWW 146


>gi|226227979|ref|YP_002762085.1| hypothetical protein GAU_2573 [Gemmatimonas aurantiaca T-27]
 gi|226091170|dbj|BAH39615.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 362

 Score = 36.6 bits (83), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGE--LPNYSISRGAVLAATRVPLI 62
           L RY    + +     +LG  +LVFVIDL +   +  E  LP  ++   A+     +P  
Sbjct: 9   LDRYIATEFTRIFGVTILGFPVLVFVIDLVDNLRKYTERKLPAKAV---ALSYFYWIPDT 65

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNP-FVVGSILLGIFTVLVIN 121
           +  ++P   L   +       R SE+  ++A GIS ++ + P  V+ ++ LG+   L   
Sbjct: 66  LFMVLPAAVLFATVFSIGTFTRYSEITAAKASGISFYRFIAPILVMATLALGL--DLAFG 123

Query: 122 PIATSGEKIGIDLIQ 136
            IA     I +DL++
Sbjct: 124 EIAPPANAIRLDLLE 138


>gi|71908693|ref|YP_286280.1| permease YjgP/YjgQ [Dechloromonas aromatica RCB]
 gi|71848314|gb|AAZ47810.1| permease YjgP/YjgQ [Dechloromonas aromatica RCB]
          Length = 362

 Score = 36.6 bits (83), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%)

Query: 45  NYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLL 102
            YS+   A+  A  +P ++ ++IP  TL+  +     L R SE+ + RA G++   LL
Sbjct: 47  GYSVVHAALFVALSMPGLVYELIPIATLIGTLYALSTLARHSEITVLRASGLATSDLL 104


>gi|170723396|ref|YP_001751084.1| permease YjgP/YjgQ family protein [Pseudomonas putida W619]
 gi|169761399|gb|ACA74715.1| permease YjgP/YjgQ family protein [Pseudomonas putida W619]
          Length = 353

 Score = 36.6 bits (83), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 74/179 (41%), Gaps = 14/179 (7%)

Query: 38  NQMGELPN-YSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGI 96
           ++M +L + Y++           P  +  ++P   L+  ++   +L  +SEL I RA G+
Sbjct: 34  DEMSDLSDTYTVMDAGWFTLLTAPRRLYDMLPMAALIGCLIGLGSLASSSELTIMRAAGV 93

Query: 97  SI----WQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPW 152
           SI    W ++ P +V  ++  +    V  PI+ +  +    L Q     G+ Q S    W
Sbjct: 94  SIGRIVWAVMKPMLVLMLVGLLIGEYV-APISENKAQADRSLAQ---GGGEAQSSKRGMW 149

Query: 153 MQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKV 211
            +    Q D F+    + P N +    T    D + KI+    A  A   ND   L  V
Sbjct: 150 HR----QGDEFVHINSVQP-NGLLLGVTRYRFDDERKIVTSSFARRARYENDHWVLSDV 203


>gi|297171743|gb|ADI22735.1| predicted permeases [uncultured verrucomicrobium HF0500_27H16]
          Length = 412

 Score = 36.2 bits (82), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 69/357 (19%), Positives = 135/357 (37%), Gaps = 57/357 (15%)

Query: 23  GAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV--PLIIQQIIPFITLVVNIVVFF 80
           GA++ +F I    + + +G+L  +      +L    +  P ++  ++P   LV  +  + 
Sbjct: 67  GAILGLFYI--QNLYDNLGDLLEHGAGAAEILQYYLILTPALLSPVLPLSVLVATLFSYG 124

Query: 81  NLNRTSELVISRAIGISIWQLL--NPFVVG--SILLGIFTVLVINPIATSGEKIGIDLIQ 136
           +L+R  E+   R++G S+W L+  N F+    S+ L +     ++  A    +   +L+Q
Sbjct: 125 SLHRNQEITAMRSMGRSVWSLMRVNMFLAALLSVGLFLLGNGGLSKSAEKSREFYEELMQ 184

Query: 137 QWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH---------------IWEDFTS 181
              D    + +  I  +   N          +  P  H                 E FTS
Sbjct: 185 PPFDPASAEVA-TIKHLTFENASSHRLWVMNRYDPSKHKGHGVYLYLRYVSGKARERFTS 243

Query: 182 ITID----------KKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIP 231
            T +          ++ + +   +A L++ + D  +LK                  L  P
Sbjct: 244 RTAEFMPETATWVFREGRQVFFDEAGLSLRFVDFEELKM---------------EGLESP 288

Query: 232 IKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIA 291
           + +   QK   + +  S  E+ +    S         R   +++  +  P   +   L+ 
Sbjct: 289 LTLLARQK---KLSDLSLRELRELAEVSQGGQGSEARRYGVRYHQALAGPFNCMLALLVG 345

Query: 292 ASVSLEFSRSNQPRIIV--AYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVIL 346
              ++  +R N P +    A GIF G+ L    + M   G+ GIL P  A  +P+ L
Sbjct: 346 VPFAIAGTRVN-PMVGATKAIGIFVGYFLLGGASRM--LGQQGILEPAVAGWLPMGL 399


>gi|218961270|ref|YP_001741045.1| putative Permease YjgP/YjgQ [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729927|emb|CAO80839.1| putative Permease YjgP/YjgQ [Candidatus Cloacamonas
           acidaminovorans]
          Length = 442

 Score = 36.2 bits (82), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 5/111 (4%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPL 61
           IL RY  K ++     F +  M++ FV+  + I + M  +    +    V       +P 
Sbjct: 3   ILKRYLLKEHIAP---FFIALMVVTFVLLSDRIIDLMNLIIEKKLPWQTVFEVFGLSLPY 59

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL 112
           ++   IP   LV  I+ F  ++   E+   ++ GI+++ L+ P V+ ++LL
Sbjct: 60  MLALSIPMAVLVATILAFGRMSVDREITAIKSSGINVYSLIGPLVIAALLL 110


>gi|297620917|ref|YP_003709054.1| putative permease, YjgP/YjgQ family [Waddlia chondrophila WSU
           86-1044]
 gi|297376218|gb|ADI38048.1| putative permease, YjgP/YjgQ family [Waddlia chondrophila WSU
           86-1044]
          Length = 359

 Score = 36.2 bits (82), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 58/144 (40%), Gaps = 7/144 (4%)

Query: 7   RYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQI 66
           RYF K  LKT  +       L  +ID                S      A    L    +
Sbjct: 8   RYFIKETLKTFFFISFCFYGLYVLIDYASHSGARHHQSMMEWSELIKFYANEWILRADVL 67

Query: 67  IPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF-----TVLVIN 121
           +PF  ++  I    +LN  +ELV  +A GIS+ ++L PF+   +L  +        L+ N
Sbjct: 68  VPFALMIATIRTLCDLNIHNELVALQASGISLKKILRPFIFLGLLFTLLIYANTEFLLPN 127

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQ 145
            +A S        IQ  K+N +K+
Sbjct: 128 AMAASRHLRNQKEIQ--KNNKNKK 149


>gi|255535566|ref|YP_003095937.1| hypothetical protein FIC_01427 [Flavobacteriaceae bacterium
           3519-10]
 gi|255341762|gb|ACU07875.1| membrane protein, putative [Flavobacteriaceae bacterium 3519-10]
          Length = 484

 Score = 36.2 bits (82), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 20  FLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRVPLIIQQIIPFITLVVNIV 77
           FL    +L F+  +N I  Q+ +     +S   +L   A     ++Q ++P   L+ +I+
Sbjct: 17  FLFIFSVLFFIFVVNIIWIQLAQFTGKGLSYWEILKLLAYLSVKVVQLVLPLTILLSSIM 76

Query: 78  VFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            F +     EL   +A GIS+ +++ P  V SI L  F  L  N +
Sbjct: 77  TFGDFGERYELAAMKAAGISLTRIMMPLFVVSIALSFFLFLFSNNV 122


>gi|308272621|emb|CBX29225.1| hypothetical protein N47_J02060 [uncultured Desulfobacterium sp.]
          Length = 409

 Score = 36.2 bits (82), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 77/379 (20%), Positives = 159/379 (41%), Gaps = 36/379 (9%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSIS--RGAVLAATRVPL 61
           I+ RY FK  L     F +  +   F+  + +I      + NY++S  +  ++    +P 
Sbjct: 21  IVSRYLFKEILSP---FAINTLFFTFLFLMAKILFITNLVVNYNMSLPKIGLMLLYIIPN 77

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFV----VGSILLGIFTV 117
            +  +IP   ++  ++ F   +  +E++  +  GISI+ LL P +    +G IL  + ++
Sbjct: 78  FLVFVIPMSVMMAILLTFLRFSSDNEIIALKTGGISIYGLLPPVLIFCFIGCILTFLISL 137

Query: 118 LVINPIATSGEKIGIDLIQQWKDNGDKQKS------DIIPWMQISNPQQDIFIGAKKILP 171
             I     S EK+ +++ Q   + G K+++      DI+ ++   + ++D  I    +  
Sbjct: 138 YAIPWGRLSIEKLTMEIAQSNFEIGLKERTFNDNFKDIMLYVNKVDLKKDELI---DVFV 194

Query: 172 ENHIWEDFTSITIDKK-------NKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKN 224
           E+   ED  S  I  K       N++  R      +I     K K V       I  D  
Sbjct: 195 EDGRSEDMASTIIAPKGVLLFEENRLSFRLRLYDGVINQVNTKNKSV-----NSIGFDTY 249

Query: 225 STTLNIPIKMDGFQKFSEQFASRS--FYEIIKKM-SFSNKSNIFHNYRAETQFYFLIVIP 281
              L++       +K  ++   +   FYE++  + SF  K++ ++N   E    F +   
Sbjct: 250 DINLDLKNAFSEMEKTGQRKNEKKMYFYELLDYIDSFKIKNSRYYNALFELHKKFSVPFA 309

Query: 282 LMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAL 341
             ++ +  +A    L   +S      +  G+    + Y I+++  + G++G   P     
Sbjct: 310 CFVLGILSVALGTQL---KSATRSFGLGLGLIFFLLYYLILSVGYALGETGFYPPFIGMW 366

Query: 342 IPVILTISLSILILLQKED 360
            P IL  S+ I + ++  +
Sbjct: 367 APNILIGSIGIYLFIRTAN 385


>gi|312142844|ref|YP_003994290.1| permease YjgP/YjgQ family protein [Halanaerobium sp. 'sapolanicus']
 gi|311903495|gb|ADQ13936.1| permease YjgP/YjgQ family protein [Halanaerobium sp. 'sapolanicus']
          Length = 1063

 Score = 36.2 bits (82), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 58  RVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTV 117
           R+P ++ +  P   L   +     LNR +E+   R  G+SI++L+ P  +  +L+  FT 
Sbjct: 58  RLPGVMVETFPIAVLFATMTAINRLNRENEITALRMGGVSIFRLVLPLFILGLLISSFTF 117

Query: 118 LV 119
           L+
Sbjct: 118 LL 119


>gi|296118847|ref|ZP_06837423.1| cell division protein FtsX [Corynebacterium ammoniagenes DSM 20306]
 gi|295968336|gb|EFG81585.1| cell division protein FtsX [Corynebacterium ammoniagenes DSM 20306]
          Length = 300

 Score = 36.2 bits (82), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           Q I  I L+ N+V     NR++E+ I R +G S W    PFV+ ++L  +  V++
Sbjct: 183 QAIAAIFLIANMVQIAAFNRSTEIGIMRMVGASRWITQAPFVLEAVLASVIGVIL 237


>gi|294341187|emb|CAZ89588.1| putative permease YjgP/YjgQ [Thiomonas sp. 3As]
          Length = 365

 Score = 36.2 bits (82), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 7  RYFFKYYLKTTLYFLLGAMILVFVID-LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQ 65
          R+   + L       L  + L+F ID LN++ N +G+ P +S+S   +  A  +P    +
Sbjct: 6  RFLLLHVLSAVGLVTLAFLALLFFIDMLNDLSN-LGK-PGFSLSGTLLHVALSMPSRAYE 63

Query: 66 IIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
          ++P  TLV  +    +L  +SE  I R  G+S
Sbjct: 64 VLPIATLVGGVFALASLAASSEFTILRISGLS 95


>gi|296137010|ref|YP_003644252.1| permease YjgP/YjgQ family protein [Thiomonas intermedia K12]
 gi|295797132|gb|ADG31922.1| permease YjgP/YjgQ family protein [Thiomonas intermedia K12]
          Length = 365

 Score = 36.2 bits (82), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 7  RYFFKYYLKTTLYFLLGAMILVFVID-LNEIQNQMGELPNYSISRGAVLAATRVPLIIQQ 65
          R+   + L       L  + L+F ID LN++ N +G+ P +S+S   +  A  +P    +
Sbjct: 6  RFLLLHVLSAVGLVTLAFLALLFFIDMLNDLSN-LGK-PGFSLSGTLLHVALSMPSRAYE 63

Query: 66 IIPFITLVVNIVVFFNLNRTSELVISRAIGIS 97
          ++P  TLV  +    +L  +SE  I R  G+S
Sbjct: 64 VLPIATLVGGVFALASLAASSEFTILRISGLS 95


>gi|154246777|ref|YP_001417735.1| permease YjgP/YjgQ family protein [Xanthobacter autotrophicus Py2]
 gi|154160862|gb|ABS68078.1| permease YjgP/YjgQ family protein [Xanthobacter autotrophicus Py2]
          Length = 405

 Score = 36.2 bits (82), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 31/61 (50%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVL 118
           +P ++  I P    +        LN  SE+V+  + G+  W+LL P ++ ++L+  F  L
Sbjct: 57  MPTLVLVIAPAALFIATAYTLLKLNGDSEIVVMASAGMGPWRLLRPLIILALLVSAFCAL 116

Query: 119 V 119
           +
Sbjct: 117 L 117


>gi|83952306|ref|ZP_00961038.1| Predicted permease [Roseovarius nubinhibens ISM]
 gi|83837312|gb|EAP76609.1| Predicted permease [Roseovarius nubinhibens ISM]
          Length = 372

 Score = 36.2 bits (82), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 66/154 (42%), Gaps = 15/154 (9%)

Query: 54  LAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVV-GSILL 112
           L A  +P +I  ++P       + V   L+  SEL + +A G S W+L  P ++ G I+ 
Sbjct: 45  LTALTLPGVIAVVLPIAGFAGAVYVTNRLSTESELTVMQATGYSPWRLARPVLIYGVIVA 104

Query: 113 GIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPE 172
            + ++L    + TS  ++     +  ++   K  ++     +  +P   +    ++I PE
Sbjct: 105 AMMSLLTHVLVPTSLHRLETRKAEVSRNVTAKLLTE----GEFLHPAGGVTFYIREITPE 160

Query: 173 NHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKV 206
             + + F S           R+D    +IY  K+
Sbjct: 161 GELRDVFLS----------DRRDIQAPVIYTSKM 184


>gi|222054621|ref|YP_002536983.1| permease YjgP/YjgQ family protein [Geobacter sp. FRC-32]
 gi|221563910|gb|ACM19882.1| permease YjgP/YjgQ family protein [Geobacter sp. FRC-32]
          Length = 389

 Score = 35.8 bits (81), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 85/390 (21%), Positives = 164/390 (42%), Gaps = 74/390 (18%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATR-- 58
           M   L+RY FK   +    F LG     FV+    +  ++  L +  +++G  L      
Sbjct: 1   MNSTLYRYIFK---EIPPPFFLGVATFTFVL----LMGRLLRLTDMVVTKGVPLGDVLRM 53

Query: 59  ----VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGI 114
               +P  +   IP   L+  ++ F  L+  SE++  +A GIS++ LL P         +
Sbjct: 54  ILYLLPSFLLVTIPMAFLLAILLAFGRLSGDSEIIAMKASGISLYGLLPP---------V 104

Query: 115 FTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENH 174
           F++ VI  +A  G  I I  + +    G+    D++    ++  +  + +G K    E  
Sbjct: 105 FSLAVITYLA--GAFITIYAVPK----GNSAFKDLL----VTVVENRVSLGVK----EKV 150

Query: 175 IWEDFTSITI-----DKKNKIIHRKDADLAIIYNDKVKLK-KVVEYQYGRIPIDKNSTTL 228
              DF  I I     D++ +++        II +++  L+   +   +G I  D  S ++
Sbjct: 151 FNGDFPGIVIYCDGYDERTQVMSG-----IIIQDERDPLEPSTIMAGHGTINADHASRSV 205

Query: 229 NIPIK---------MDGFQ--KFSE-------QFASRSFYEIIKKMSFSN-----KSNIF 265
            + +           +G++  +FS+         AS++     + MS +       SN F
Sbjct: 206 RLHLASGSIHRTAGREGYRLVQFSDYDLHINLSQASQAVKRDERDMSLAELRTNWNSNHF 265

Query: 266 HNY-RAET--QFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTII 322
            N  R E   +++    +P   +  TL+   + ++  RS +     A  IF   + Y I+
Sbjct: 266 DNKGRLEMRLEYHRRFSLPFACLIFTLVGMPLGIQNQRSGKAAGF-AISIFLLLLYYIIL 324

Query: 323 TIMKSFGKSGILLPVAAALIPVILTISLSI 352
           +  K+ G+  +L P  AA +P +L ++  I
Sbjct: 325 SACKTLGEKELLNPFLAAWVPNMLFVAFGI 354


>gi|282915635|ref|ZP_06323406.1| concentrative nucleoside transporter [Staphylococcus aureus subsp.
           aureus D139]
 gi|282320451|gb|EFB50790.1| concentrative nucleoside transporter [Staphylococcus aureus subsp.
           aureus D139]
          Length = 406

 Score = 35.8 bits (81), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 15/143 (10%)

Query: 31  IDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVI 90
           I +N+I  +MG L +Y     A+     V L I+ IIP ++        + +  +    I
Sbjct: 122 ITINKI-TRMGRLESYFAISTAMFGQPEVYLTIKDIIPKLSRAK----LYTIATSGMSAI 176

Query: 91  SRAIGISIWQLLNP-FVVGSILLGIFTVL----VINPIATSGEKIGIDLIQQWKD----N 141
           S A+  S  Q++ P FVV +++L IF+ L    VINP  +    + ID + +  +    N
Sbjct: 177 SMAMLGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDTDVEIDNLTKSTETKTLN 236

Query: 142 GDKQKSDIIPWMQ-ISNPQQDIF 163
           G   K   + + Q I +   D F
Sbjct: 237 GKTGKPKKVAFFQMIGDSAMDGF 259


>gi|254424599|ref|ZP_05038317.1| putative permease, YjgP/YjgQ family [Synechococcus sp. PCC 7335]
 gi|196192088|gb|EDX87052.1| putative permease, YjgP/YjgQ family [Synechococcus sp. PCC 7335]
          Length = 397

 Score = 35.8 bits (81), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 68/319 (21%), Positives = 127/319 (39%), Gaps = 65/319 (20%)

Query: 68  PFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILL-GI-FTV-LVINPIA 124
           P  TL+  ++ +   +  SEL+  R  G+SI +++ P V+ S+L+ G+ F+V  +I P +
Sbjct: 89  PMSTLLATMMTYSRFSSDSELIAMRGCGVSINRIVAPAVILSLLVTGLSFSVNEIIAPAS 148

Query: 125 TSGE---------------KIGIDLIQQWKDNGDKQKSDIIPWMQISN------------ 157
           T                  + G  + QQ +   D    +++ +    N            
Sbjct: 149 TERAALLLARALDDEKPPFREGNIVFQQQEPAADGSGDELVRFFYARNFDGTTMRDITVV 208

Query: 158 --PQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLA---IIYNDKVKLKKVV 212
              Q+D   G K+I+  +    DFT    +  N  I+      +   II  DK  L    
Sbjct: 209 DFSQEDSEDGLKQIVSADAATWDFTRNLWEFTNGTIYAVSPTGSFRQIIRFDKQDL---- 264

Query: 213 EYQYGRIPID-KNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAE 271
             Q  R P+D  N T     + +   +++          + ++K++ +    I   Y   
Sbjct: 265 --QLPRTPLDLANRTKKQEEMNIAETKEYLTILQQTGDEKAVRKLAVA----IQRKY--- 315

Query: 272 TQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGI----FSGFMLYTIITIMKS 327
                   IP   V   L+ A+V +   R+ +     ++GI      G+ L + IT   +
Sbjct: 316 -------AIPFACVVFGLVGAAVGVRPQRTGK---ATSFGISVVIIFGYYLLSFIT--SA 363

Query: 328 FGKSGILLPVAAALIPVIL 346
            G+SG++ P  A  +P+ +
Sbjct: 364 MGESGVITPFLAGWVPLFI 382


>gi|114768924|ref|ZP_01446550.1| Predicted permease [alpha proteobacterium HTCC2255]
 gi|114549841|gb|EAU52722.1| Predicted permease [alpha proteobacterium HTCC2255]
          Length = 407

 Score = 35.8 bits (81), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 95/224 (42%), Gaps = 37/224 (16%)

Query: 5   LWRYFFKYYLKTTLYFLL---GAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPL 61
           L RY FK  +    +F     G ++L   + + +I  + G+ P Y +   + L   +V +
Sbjct: 36  LDRYLFKQLIGPFAFFCFIISGILLLNQALGIIDIVTENGQ-PAYIVFELSFLILPKVLI 94

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI- 120
               I  FI  V+ I   +N     EL++  +IG S  +L  PF++  IL+     LV+ 
Sbjct: 95  TAISISGFIASVLIINRLYN---EEELLVMMSIGRSFIELSKPFLLFGILIASLLFLVVH 151

Query: 121 --NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDI--------FIGAK--- 167
             NP A S          ++ +  ++ K + +   QI  P Q I        F G K   
Sbjct: 152 NLNPYAHS----------KFIEAQERIKKEYVT--QIIKPDQFISYQNKYTFFFGDKGNN 199

Query: 168 ----KILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVK 207
               +IL E  I  D T   I K  ++I  KD++  ++ N   +
Sbjct: 200 GELSEILIEEQITPDTTLTHIAKNGQVIANKDSNALLLRNGSTQ 243


>gi|269121333|ref|YP_003309510.1| permease YjgP/YjgQ family protein [Sebaldella termitidis ATCC
           33386]
 gi|268615211|gb|ACZ09579.1| permease YjgP/YjgQ family protein [Sebaldella termitidis ATCC
           33386]
          Length = 364

 Score = 35.8 bits (81), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 59  VPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSIL---LGIF 115
           VP ++ Q IP    +  ++ + N + T+E++   + G S++++  P ++  IL   LG+F
Sbjct: 57  VPGVLTQTIPMGAFLGVMLTYGNFSETNEIIAIESAGTSLFRITRPAIIFGILLTVLGLF 116

Query: 116 TVLVINPIA 124
             + +NP A
Sbjct: 117 MEIEVNPRA 125


>gi|332991780|gb|AEF01835.1| permease YjgP/YjgQ [Alteromonas sp. SN2]
          Length = 366

 Score = 35.8 bits (81), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 129/321 (40%), Gaps = 62/321 (19%)

Query: 4   ILWRYFFKYYLKTTL--YFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLA--ATRV 59
           +++RY  K  LK+ L  +F+L A+ +            +G+  +  I  G VL       
Sbjct: 2   LIFRYLLKETLKSQLAIFFILMAIFVTL-----RFVRVLGDASDGDIPAGLVLGFLGLYA 56

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFT--- 116
           P++   ++P    +  ++    L   SE+ + RA GIS W +    +  S+L+ I T   
Sbjct: 57  PILASLVLPISAYLGIMLAHGRLYVDSEMTVMRACGISEWYITRVMLFLSVLIMIVTGAI 116

Query: 117 VLVINPIATSGEKIGIDLIQQWKDNGDKQK--SDIIP--WMQISNPQQDIFIGAKKILPE 172
            L   P+A   E        Q ++    +   S IIP  + Q  N +  IF+    I  +
Sbjct: 117 TLYFAPMAAENE-------YQLREKARNEAGLSAIIPGRFQQTGNAKAVIFV--HDIDTD 167

Query: 173 NHIWEDFTS--ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST---T 227
           + +   F S   T + +N++                   +VV  Q G++  + + T    
Sbjct: 168 DQLRRVFLSQNKTENGENQV-------------------QVVYAQTGQVASNPDGTRNLV 208

Query: 228 LNIPIKMDG-----------FQKFSEQFASRSFYEIIKKMSFSNKSNIF--HNYRAETQF 274
           L   ++ +G           F ++  Q A +   E  +K+S    + ++   +  A  + 
Sbjct: 209 LKQGVQYEGQQSQKSYRKVEFDEYQIQIADKPAEEARRKVSVLPTTELWGDESIEARAEL 268

Query: 275 YFLIVIPLMLVAMTLIAASVS 295
            + I IPL L  + LIA  +S
Sbjct: 269 QWRIAIPLSLPFLILIAVPLS 289


Searching..................................................done


Results from round 2




>gi|255764469|ref|YP_003064807.2| putative permease protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254547820|gb|ACT56867.2| putative permease protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 361

 Score =  411 bits (1058), Expect = e-113,   Method: Composition-based stats.
 Identities = 361/361 (100%), Positives = 361/361 (100%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP
Sbjct: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI
Sbjct: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT
Sbjct: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
           SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF
Sbjct: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
           SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR
Sbjct: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
           SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED
Sbjct: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360

Query: 361 G 361
           G
Sbjct: 361 G 361


>gi|15964906|ref|NP_385259.1| hypothetical protein SMc00583 [Sinorhizobium meliloti 1021]
 gi|307300976|ref|ZP_07580745.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti BL225C]
 gi|307317711|ref|ZP_07597149.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti AK83]
 gi|15074085|emb|CAC45732.1| Hypothetical, transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306896473|gb|EFN27221.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti AK83]
 gi|306903931|gb|EFN34517.1| permease YjgP/YjgQ family protein [Sinorhizobium meliloti BL225C]
          Length = 360

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/361 (39%), Positives = 216/361 (59%), Gaps = 2/361 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYFFK Y +TT +FL+G   L+F+ID +E+ ++M  LP+Y++S   ++   R+P
Sbjct: 2   IFNTLGRYFFKRYARTTFWFLVGIFALIFIIDFSELTSRMSNLPHYTVSGALLMTTFRIP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            I+QQ +PF+ L   +    +LNR  ELV++RA GIS+WQ L PFVVG++L G+  V+VI
Sbjct: 62  TILQQTVPFVALFAAMAALISLNRRYELVVTRAAGISVWQFLRPFVVGALLFGVLAVVVI 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           NP+A  G K    L  +W  +     ++ IPW++      D  IGA+ +        + T
Sbjct: 122 NPLAAWGTKKAEALEAEW-GSTRSAAANSIPWLRQIYDGTDTIIGARSVQNGGTELINVT 180

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
            I  D +  I  R+DA  A + +    L  VVE + GR+P    +  L   +K D  Q+ 
Sbjct: 181 VIHFDPQGAITLRQDAKSAKLEDGYWLLNGVVETEVGRLPRRMETAQLRTNLKPDFVQER 240

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
             +  S  F+++ +K+  + +S  F     ETQF+ L+ +PL+LVAMTLIAA VSL+FSR
Sbjct: 241 LAKADSIQFFDLPRKIEVA-RSFGFSTNGLETQFHSLMSLPLLLVAMTLIAACVSLKFSR 299

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
            NQ R ++  GI SGF+LY +  ++K+FG SGI+ P  AA +PV++ ++L   ILL +ED
Sbjct: 300 FNQSRSVILGGILSGFVLYVVTVLVKAFGSSGIVPPFVAAWLPVVVAMALGSTILLHQED 359

Query: 361 G 361
           G
Sbjct: 360 G 360


>gi|150395988|ref|YP_001326455.1| permease YjgP/YjgQ family protein [Sinorhizobium medicae WSM419]
 gi|150027503|gb|ABR59620.1| permease YjgP/YjgQ family protein [Sinorhizobium medicae WSM419]
          Length = 360

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 140/361 (38%), Positives = 215/361 (59%), Gaps = 2/361 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYFFK Y +TT +FL+G   L+F+ID +E+ ++M  LP+Y++S   ++   R+P
Sbjct: 2   IFNTLGRYFFKRYARTTFWFLIGIFALIFIIDFSELTSRMSNLPHYTVSGALLMTTFRIP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            I+QQ +PF+ L   +    +LNR  ELV++RA GIS+WQ L PFVVG+++ G   V+VI
Sbjct: 62  TILQQTVPFVALFAAMAALISLNRRYELVVTRAAGISVWQFLRPFVVGALIFGALAVVVI 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           NP+A  G K    L  +W  +     ++ IPW++      D  IGA+ +        + T
Sbjct: 122 NPLAAWGTKKAEALEAEW-GSTRSAAANSIPWLRQIYDGTDTIIGARSVQNGGTELINVT 180

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
            I  D +  I  R+DA  A + +    L  VVE + GR+P    +  L   ++ D  Q+ 
Sbjct: 181 VIHFDPQGAITLRQDAKSAKLEDGYWLLNGVVETEVGRLPRRMETAQLRTNLRPDFVQER 240

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
             +  S  F+++ +K+  + +S  F     ETQF+ L+ +PL+LVAMTLIAA VSL+FSR
Sbjct: 241 LAKADSIQFFDLPRKIEVA-RSFGFSTNGLETQFHSLMSLPLLLVAMTLIAACVSLKFSR 299

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
            NQ R ++  GI SGF+LY +  ++K+FG SGI+ P  AA +PV++ ++L   ILL +ED
Sbjct: 300 FNQSRSVILGGILSGFVLYVVTVLIKAFGSSGIVPPFVAAWLPVVVAMALGSTILLHQED 359

Query: 361 G 361
           G
Sbjct: 360 G 360


>gi|222085452|ref|YP_002543982.1| permease protein [Agrobacterium radiobacter K84]
 gi|221722900|gb|ACM26056.1| permease protein [Agrobacterium radiobacter K84]
          Length = 361

 Score =  361 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 143/361 (39%), Positives = 215/361 (59%), Gaps = 1/361 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYFF  Y+ TTL+F LG   LV++ID +E   ++  LP Y++  G ++ A R+P
Sbjct: 2   IFSTLGRYFFTRYIITTLWFFLGVTSLVYLIDFSETAGRLAGLPGYTVKIGLLMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            I+QQ +PFI L V + V   LNR  ELVI+RA GIS+WQ + PFVVG+  +G+ T+L +
Sbjct: 62  FIMQQTVPFIALFVGMTVLIALNRRRELVIARAAGISVWQFMTPFVVGAFCVGLLTMLAL 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           NP+A  G++    +    + +   + +  IPW++ S+ + DI IGAK +L       +  
Sbjct: 122 NPVAAWGQRQAETMEADLRGDPSYRNTLSIPWLRQSDGKSDIIIGAKAVLDNGTTLMNVV 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
            I  D +  II R+DA  A + N    L  VVE   G IP  K++T +   +K D   + 
Sbjct: 182 FIHFDSQGNIILRQDAQSAKLENGYWLLNSVVERAPGEIPAHKSTTQVRTNLKQDFVSER 241

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
             Q  + +FY++  +++ + KS        ETQF+ L+  P +LVAMTLIAA+VSL+FSR
Sbjct: 242 LAQPETIAFYDLSNRIAIA-KSFGISTKALETQFHSLLSQPFLLVAMTLIAATVSLKFSR 300

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
            NQ R ++  GI SGF+LY +  ++K+FG SG++ P  A  IPVI+ ++    ILL +ED
Sbjct: 301 FNQSRSVILGGILSGFVLYVVTVLVKAFGSSGVVPPFVATWIPVIVALAFGATILLHQED 360

Query: 361 G 361
           G
Sbjct: 361 G 361


>gi|325292486|ref|YP_004278350.1| permease protein [Agrobacterium sp. H13-3]
 gi|325060339|gb|ADY64030.1| putative permease protein [Agrobacterium sp. H13-3]
          Length = 362

 Score =  359 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 142/362 (39%), Positives = 220/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYF K YL T ++FLLG   ++++ D +E   +M  +P YS+     L A R+P
Sbjct: 2   IFSTLARYFLKRYLITAIWFLLGVSAIIYLADFSETARRMSSVPGYSVPGALGLTALRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPFI L V +    +LNR  ELV++RA G+S WQ + PFV+G++ LGI +VLV+
Sbjct: 62  LILQQTIPFIALFVGMTTLISLNRRYELVVTRAAGVSAWQFILPFVLGAVFLGILSVLVL 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGD-KQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NPIA  G+   + +   W++ G   ++ DIIPWM+ S+  QD  IGAK       +  D 
Sbjct: 122 NPIAAWGQNRSLSMEAGWRNEGSGGRQQDIIPWMRQSSGGQDTIIGAKSFEDNGTMLLDV 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I +DK   I+ R+DA  A + +    L  V E + G +P+ + ST ++  ++ +  Q+
Sbjct: 182 VLIHLDKDGNIVSRQDAKSAKLEDGYWLLNGVAETRAGHVPVRQESTRISTNLRREFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
              Q  + +F+++  K+  + KS    +   ETQ++FL+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RMTQTETVAFFDLSHKIEVA-KSFGLSSKALETQYHFLLSTPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R  Q R ++  GI SGF+LY +  ++++FG  G++ P  A  +PVI+ ++L   ILL +E
Sbjct: 301 RFAQSRSVILGGIVSGFVLYVVTVLVRAFGSGGVVPPTVAVWVPVIVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|218460846|ref|ZP_03500937.1| putative permease protein [Rhizobium etli Kim 5]
          Length = 362

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 148/362 (40%), Positives = 218/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTAWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PFV GS+ LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFVAGSLALGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLVDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVIMRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|86357091|ref|YP_468983.1| putative permease protein [Rhizobium etli CFN 42]
 gi|86281193|gb|ABC90256.1| putative permease protein [Rhizobium etli CFN 42]
          Length = 362

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 147/362 (40%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTGWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PF+ GS++LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLVLGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|327188011|gb|EGE55241.1| putative permease protein [Rhizobium etli CNPAF512]
          Length = 362

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 147/362 (40%), Positives = 218/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTGWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|190891135|ref|YP_001977677.1| permease [Rhizobium etli CIAT 652]
 gi|190696414|gb|ACE90499.1| putative permease protein [Rhizobium etli CIAT 652]
          Length = 362

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 146/362 (40%), Positives = 218/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ Y+ TT +FL+GA  + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYVATTGWFLIGASAIAFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPF+ L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T   +
Sbjct: 62  LILQQTIPFVALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGVLTTTAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|241203948|ref|YP_002975044.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857838|gb|ACS55505.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 362

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 144/362 (39%), Positives = 218/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+G   + F++D +E   +M  LP Y+I  G ++ A R+P
Sbjct: 2   MFGTLSRYFFRRYLVTTGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGVLMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS++LG+ T+  +
Sbjct: 62  LILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLVLGLLTMAAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQESGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGQVILRQDAATAKLEDGYWQLNNVVERKPGEIPVRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMT IAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTFIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|116251334|ref|YP_767172.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255982|emb|CAK07063.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 362

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 144/362 (39%), Positives = 217/362 (59%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+G   + F++D +E   +M  LP Y+I  G ++ A R+P
Sbjct: 2   MFGTLSRYFFRRYLVTTGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGVLMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T+  +
Sbjct: 62  LILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGLLTMAAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGQVILRQDAATAKLEDGYWQLNTVVERKPGEIPVRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMT IAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTFIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IPV++ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPVVVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|15888447|ref|NP_354128.1| hypothetical protein Atu1107 [Agrobacterium tumefaciens str. C58]
 gi|15156139|gb|AAK86913.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 362

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 139/362 (38%), Positives = 219/362 (60%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYF K YL TT++F+LG   ++++ D +E   +M  LP YS+     L A R+P
Sbjct: 2   IFNTLARYFLKRYLMTTIWFVLGVSSIIYLADFSETARRMSGLPGYSVPAALGLTALRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ +PFI L V +    +LNR  ELV++RA GIS WQ + PFV+G++ +GI +V+V+
Sbjct: 62  LILQQTVPFIALFVGMTTLISLNRRYELVVTRAAGISAWQFILPFVLGAVFIGILSVMVL 121

Query: 121 NPIATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NPIA  G+   + +    + D G  ++ +IIPWM+ S+  +D  IGAK       +  D 
Sbjct: 122 NPIAAWGQNKSLAMEAGLRNDAGGGRQQEIIPWMRQSSGGKDTIIGAKSFEDNGTMLLDV 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I +DK   I+ RKDA  A + +    L  V E + G +P+ + S  ++  ++ +  Q+
Sbjct: 182 VLIDVDKDGNIVSRKDAKSAKLEDGYWLLNGVSETRAGHVPVRQESMQISTNLRREFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
              Q  + +F+++  K+  + KS    +   ETQ++FL+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RMTQTETVAFFDLSHKIEVA-KSFGLSSKALETQYHFLLSTPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R  Q R ++  GI SGF+LY +  ++++FG  G++ P  A  +PVI+ ++L   ILL +E
Sbjct: 301 RFAQSRSVILGGIVSGFVLYVVTVLVRAFGSGGVVPPTVAVWVPVIVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|209548670|ref|YP_002280587.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534426|gb|ACI54361.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 362

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 142/362 (39%), Positives = 216/362 (59%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ Y+ T  +FL+G   + F++D +E   +M  LP Y+I  G ++ A R+P
Sbjct: 2   MFGTLSRYFFRRYMVTMGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGILMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS++LG+ T+  +
Sbjct: 62  LILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLILGLLTMTAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA  +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAHTVQENGTKLIDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGQVILRQDAATAKLEDGYWQLNNVVERKPGEIPMRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMT IAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTFIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A  IP+I+ ++L   ILL +E
Sbjct: 301 RFNQSRSVILGGILSGFMLYVITVLVKAFGSSGVVPPFVATWIPMIVALALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|319408319|emb|CBI81972.1| conserved membrane hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 363

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 123/364 (33%), Positives = 199/364 (54%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y+KTT YF+L   IL  +ID  E   ++  LP+Y+     +++A RV
Sbjct: 1   MIGWTLGRYFFVRYIKTTCYFVLSIFILALLIDFTENSGRLASLPHYTAKGALLISALRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+ PFI L   + +  +LN+  ELV++R+IG+S WQ L P  +G+ L G+F++L 
Sbjct: 61  PFIMQQLFPFIALFSAMTMLISLNKKFELVVARSIGVSAWQFLIPACLGAFLFGLFSILF 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           INP+A  G      +I +W+ N  +     + IPW+          IGA+ I  +     
Sbjct: 121 INPLAAWGSSQAEKMIAEWRSNNVQTSINKNRIPWLTQHTNLGTTTIGARSITQQGLSLI 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D T +  +    + +   A  A + ND   L     Y+ G +P       +   +K +  
Sbjct: 181 DATFVQYNDNATVKNWIHAKQATLTNDAWLLTNGTIYKTGYVPEKFTEFRIKTNLKPEFL 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            ++    A+  FY++ +K+S + +S  +   + +     LI +P +LVAMTLIAA+VSL+
Sbjct: 241 TEYLADPATIPFYKLPRKIS-AARSFGYSANKFDMYLQSLIALPALLVAMTLIAATVSLK 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F+R  Q + ++  G+ +GFMLY I  ++++FG +G + PV AA  PV++ +   +  LL 
Sbjct: 300 FTRFGQSKALILGGVIAGFMLYVISVLVQAFGNAGYIPPVIAAWTPVVIALFFGVSFLLH 359

Query: 358 KEDG 361
           KEDG
Sbjct: 360 KEDG 363


>gi|49474100|ref|YP_032142.1| hypothetical protein BQ04620 [Bartonella quintana str. Toulouse]
 gi|49239604|emb|CAF25961.1| Hypothetical transmembrane protein [Bartonella quintana str.
           Toulouse]
          Length = 364

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 120/365 (32%), Positives = 190/365 (52%), Gaps = 5/365 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  YLK T YF     +L F+ID  E  +++  LP+Y+     +++  R+
Sbjct: 1   MIGWTLGRYFFVRYLKMTCYFFGSIFVLAFLIDFTENSSRLSYLPSYTAKDAFLISVLRI 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPFI L   + +  +LNR  ELV++R+IG+S WQ L P   G+ L G+F++L+
Sbjct: 61  PFIMQQLIPFIALFSAMAMLISLNRKCELVVTRSIGVSAWQFLMPACFGAFLFGLFSILL 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQK---SDIIPWMQISNPQQDIFIGAKKILPENHIW 176
           +NP+A  G      +  +W+ N        + IIPW+          IGAK I  +    
Sbjct: 121 VNPLAAWGFSQAEKMTTEWRSNNVLTSFHNTRIIPWLTQRTNSDRTTIGAKSITDQGLSL 180

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG 236
            D T +  +    + +  +   A + N    L     Y+ G  P       +   +K + 
Sbjct: 181 IDATFVQYNDNATVKNWINTRKATLTNGVWLLTNGTIYKIGHPPEKFTEFQIKTNLKPEF 240

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
             +     A+  FY++ KK+  + +S  +     +     LI +P +L+AMTLIAA+VSL
Sbjct: 241 LTERLANPATIPFYQLPKKIMIA-RSFGYSANNFDMYLQSLIALPALLIAMTLIAATVSL 299

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
            F+R  Q   ++  G+ +GF LY I  ++++FG +G + P+ AA  PVI+ + L I  LL
Sbjct: 300 NFTRFGQSGTLIFGGVIAGFTLYVISVLVQAFGNAGYMPPIIAAWTPVIIALFLGISFLL 359

Query: 357 QKEDG 361
            KEDG
Sbjct: 360 HKEDG 364


>gi|222148152|ref|YP_002549109.1| hypothetical protein Avi_1542 [Agrobacterium vitis S4]
 gi|221735140|gb|ACM36103.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 362

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 136/362 (37%), Positives = 210/362 (58%), Gaps = 2/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M   L RYF K Y  T  +F++G   ++F+ID +E+  +  +    S+    +L   R+P
Sbjct: 2   MLNTLSRYFLKRYAITVFWFVIGVAAIIFLIDFSEVSGRFSDNEQSSLFGVFLLTLMRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           L++QQ +PFI L   +V    LNR SELVI+RA GIS+WQ + PF++G+ +LG  T L+I
Sbjct: 62  LLLQQTVPFIALFSGMVTLITLNRRSELVIARAAGISVWQFMFPFLLGAFMLGCATSLLI 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKS-DIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G+K    L  ++ D G    + + +PWM+    ++D  IGA  +L +  +    
Sbjct: 122 NPLAALGQKQAATLEAEYSDPGKASNNKNSVPWMRQITGKEDTIIGATSVLEDGTLLMQA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D + +I  R+DA  A + +    LK VVE + G  P  + S  ++  +K +  Q+
Sbjct: 182 VFIHFDGQGRITSRQDARTAKLQDGYWLLKDVVETKPGETPKRETSAQVSTNLKQEFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
              Q  + +FYE+ +K++ + KS        ETQF+ L+  P + VAMTLIAA+VSL+FS
Sbjct: 242 RLAQPDTVAFYELSQKIAVA-KSYGVSTKNLETQFHTLLSTPFLFVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R NQ R ++  GI SGF+LY    ++K+FG SG++ P  A  +PVI+  +L   ILL +E
Sbjct: 301 RFNQSRSVILGGIISGFVLYVATVLVKAFGSSGVVPPFVATWVPVIVATALGATILLHQE 360

Query: 360 DG 361
           DG
Sbjct: 361 DG 362


>gi|240850231|ref|YP_002971624.1| putative permease, YjgP/YjgQ family [Bartonella grahamii as4aup]
 gi|240267354|gb|ACS50942.1| putative permease, YjgP/YjgQ family [Bartonella grahamii as4aup]
          Length = 363

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 120/364 (32%), Positives = 190/364 (52%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  YLK T YF     +L  +ID  E   ++  +P+++      L+  R+
Sbjct: 1   MIGWTLGRYFFIRYLKITCYFWGSIFVLALLIDFTENSGRLSSIPHHTAKDAFFLSVLRI 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPFI L   +    +LN+  ELV++R+IG+S WQ L P  +G+ LLG+F++L+
Sbjct: 61  PFIMQQLIPFIALFSAMATLISLNKKLELVVTRSIGVSAWQFLMPACLGAFLLGLFSILL 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQ--KSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           INP+A  G       + +W++N       +  I W+          IGAK I  +     
Sbjct: 121 INPLAAWGFSQAEKKMTEWRNNNVLTPLHNTDIHWLTQRTNLGRTTIGAKFITDQGLSLL 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D T +  +    + +  +   A + N    L     Y+ G  P       +   +K +  
Sbjct: 181 DATFVQYNDNATVKNWINTPKATLTNGSWLLTNGTIYKIGHPPEKFTVLQIKTNLKPEFL 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            +     A+  FY++ KK+  + +S  +     +  F  LI +P +LVAMTLIAA+VSL 
Sbjct: 241 TERLANPATIPFYQLPKKIMIA-RSFGYSANNFDMYFQSLIALPALLVAMTLIAATVSLN 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F+R  Q R ++  G+ +GFMLY I  ++++FG +G + P+ AA  PV++ + L I  LL 
Sbjct: 300 FTRFGQSRTLILGGVIAGFMLYVISVLVQAFGNAGYIPPIIAAWTPVVIALFLGISFLLH 359

Query: 358 KEDG 361
           KEDG
Sbjct: 360 KEDG 363


>gi|39936125|ref|NP_948401.1| permease YjgP/YjgQ [Rhodopseudomonas palustris CGA009]
 gi|39649979|emb|CAE28503.1| predicted permease [Rhodopseudomonas palustris CGA009]
          Length = 361

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 92/360 (25%), Positives = 170/360 (47%), Gaps = 3/360 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF + ++  +L    G  +L+  +D  ++  + G L   S    A  +  RVP +
Sbjct: 4   NTLGRYFARRFVIASLGVFFGLFVLLVFVDYVDLLRRAGGLA-VSAFYVAQASFCRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELV++RA G+S W+ ++P +  +I +GIF   V NP
Sbjct: 63  LERLLPFCILIGGMTCYLALSRSLELVVARAAGLSAWEFISPALWSAIAIGIFATTVFNP 122

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDI-IPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++   ++    +  +          D    WM   +P     I A +   +  +    T 
Sbjct: 123 LSAHMQERAKQMEAEMFGENTGGLQDANGFWMNQVSPDGQAIINAARSQQQGAVLTGITV 182

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              +   +   R +A  A++      LK V  Y     P+D+++  L   + +   +   
Sbjct: 183 FRFEPDFQFKDRIEAREAVLEPGHWLLKNVRRYTMDGAPVDQDTLELPTSLTLAQVRNSF 242

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVSL F R 
Sbjct: 243 ATPESVSFWQLPTYIKSSENSG-FATAGYRLQYHKLLAKPFLLAAMVMLAASVSLRFFRF 301

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +EDG
Sbjct: 302 GGVQKMVLSGVAAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLYQEDG 361


>gi|192291843|ref|YP_001992448.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris
           TIE-1]
 gi|192285592|gb|ACF01973.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris
           TIE-1]
          Length = 362

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 92/360 (25%), Positives = 170/360 (47%), Gaps = 3/360 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF + ++  +L    G  +L+  +D  ++  + G L   S    A  +  RVP +
Sbjct: 5   NTLGRYFARRFVIASLGVFFGLFVLLVFVDYVDLLRRAGGLA-VSAFYVAQASFCRVPQL 63

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELV++RA G+S W+ ++P +  +I +GIF   V NP
Sbjct: 64  LERLLPFCILIGGMTCYLALSRSLELVVARAAGLSAWEFISPALWSAIAIGIFATTVFNP 123

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDI-IPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++   ++    +  +          D    WM   +P     I A +   +  +    T 
Sbjct: 124 LSAHMQERAKQMEAEMFGENTGGLQDANGFWMNQVSPDGQAIINAARSQQQGAVLTGITV 183

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              +   +   R +A  A++      LK V  Y     P+D+++  L   + +   +   
Sbjct: 184 FRFEPDFQFKDRIEAREAVLEPGHWLLKNVRRYTMDGAPVDQDTLELPTSLTLAQVRNSF 243

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVSL F R 
Sbjct: 244 ATPESVSFWQLPTYIKSSENSG-FATAGYRLQYHKLLAKPFLLAAMVMLAASVSLRFFRF 302

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +EDG
Sbjct: 303 GGVQKMVLSGVAAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLYQEDG 362


>gi|163868027|ref|YP_001609231.1| hypothetical protein Btr_0826 [Bartonella tribocorum CIP 105476]
 gi|161017678|emb|CAK01236.1| hypothetical transmembrane protein [Bartonella tribocorum CIP
           105476]
          Length = 363

 Score =  346 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 120/364 (32%), Positives = 191/364 (52%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  YLK T YF     +L  +ID  E   ++  LP+Y+     +L+  R+
Sbjct: 1   MIGWTLGRYFFIRYLKITCYFWGSIFVLALLIDFTENSGRLPSLPHYTAKDAFLLSVLRI 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPFI L   +    +LN+  ELV++R+IG+S WQ L P  +G+ LLG+F++L+
Sbjct: 61  PFIMQQLIPFIALFSAMTTLISLNKKLELVVTRSIGVSAWQFLMPACLGAFLLGLFSILL 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           INP+A  G      ++ +W++N       +  I W+          IGAK I  +     
Sbjct: 121 INPLAAWGFSQAEKMMTEWRNNNVLTSLHNTRIHWLTQRTDLGRTTIGAKFITDQGFSLL 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D T +       + +  +   A + +    L     Y+ G  P       +   +K +  
Sbjct: 181 DATFVQYKDDATVKNWINTPKATLTHGAWFLTNGTIYKIGHPPEKFTVLKIKTNLKPEFL 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            +     A+  FY++ KK+  + +S  +  +  +     LI +P +LVAMTLIAA+VSL 
Sbjct: 241 TERLVNPATIPFYQLPKKIMIA-RSFGYSAHNFDMYLQSLIALPALLVAMTLIAATVSLN 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F+R  Q R ++  G+ +GFMLY I  ++++FG +G + P+ AA  PV++ + L I  LL 
Sbjct: 300 FTRFGQSRTLILGGVIAGFMLYVISVLVQAFGNAGYIPPIIAAWTPVVIALFLGISFLLH 359

Query: 358 KEDG 361
           KEDG
Sbjct: 360 KEDG 363


>gi|316933707|ref|YP_004108689.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris DX-1]
 gi|315601421|gb|ADU43956.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris DX-1]
          Length = 361

 Score =  345 bits (885), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 92/360 (25%), Positives = 168/360 (46%), Gaps = 3/360 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF + ++  +L    G  +L+  +D  ++  + G L   S    A  +  RVP +
Sbjct: 4   NTLGRYFARRFVVASLGVFFGLFVLLVFVDYVDLLRRAGGLA-VSAFYVAQASFCRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELV++RA G+S W+ ++P +  +I +GI    + NP
Sbjct: 63  LERLLPFCILIGGMTCYLALSRSLELVVARAAGLSAWEFISPALWSAIAIGIVATTIFNP 122

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDI-IPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++   ++    +  +          D    WM   NP     I A +   +  +    T 
Sbjct: 123 LSAHMQERAKQMEAEMFGENTGGLQDANGFWMNQVNPDGQAIINAARSQQQGAVLTGITI 182

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              D   +   R +A  A++      LK V  Y     P D+++  L   + +   +   
Sbjct: 183 FRFDPNFQFRDRIEAREAVLEPGHWLLKSVRRYTLDSAPTDQDTMELPTSLTLAQVRNSF 242

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S SF+++   +  S  S  F       Q++ L+  P +L AM ++AASVSL F R 
Sbjct: 243 ATPESVSFWQLPAYIKSSENSG-FATAGYRLQYHKLLAKPFLLAAMVMLAASVSLRFFRF 301

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +EDG
Sbjct: 302 GGVQKMVLSGVAAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLYQEDG 361


>gi|209885475|ref|YP_002289332.1| permease YjgP/YjgQ [Oligotropha carboxidovorans OM5]
 gi|209873671|gb|ACI93467.1| permease YjgP/YjgQ [Oligotropha carboxidovorans OM5]
          Length = 364

 Score =  344 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 91/358 (25%), Positives = 171/358 (47%), Gaps = 2/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RYF + ++  +    LG  +L+ ++D  E+  +   +P  S    A  +  RVP ++
Sbjct: 9   TLARYFARRFIVASCAVFLGIFLLLVLVDYIEMVRRTSSIPTASAFMVAQTSLFRVPQLL 68

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           ++++PF  L+  +  +  L+R+ ELV++RA GIS WQ + P +V ++++GI   +  NPI
Sbjct: 69  ERLMPFCILIGAMSCYLALSRSLELVVARAAGISAWQFITPALVSALVMGILATVAYNPI 128

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           + + ++   ++  Q   NG  Q      W+     +    I A     +       T   
Sbjct: 129 SAAMQERSKEMEAQLFSNGGVQDVAQS-WINQVTSEGQSIISAALSQNQGTRLSGVTVFR 187

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            +       R DA  A +   + +L     Y     PI  +S  L+  +     +     
Sbjct: 188 FNPDGSFRDRIDARDANLEPGQWRLGGARIYSMTAAPIPHDSFLLSTNLTPSQVRNSFAT 247

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             + SF+++ + +  S++S+         Q+  L+  P +L +M L+AA+VSL F R   
Sbjct: 248 PETVSFWQLPEYIR-SSQSSGLATAGYRLQYQKLLARPFLLASMVLVAAAVSLRFFRFGG 306

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +   +  L LL +EDG
Sbjct: 307 VQKMVLSGVAAGFLLYVLSKVTEDLSKAELMHPLAAAWLPVCVGGLIGFLALLHQEDG 364


>gi|75675870|ref|YP_318291.1| permease YjgP/YjgQ [Nitrobacter winogradskyi Nb-255]
 gi|74420740|gb|ABA04939.1| permease YjgP/YjgQ [Nitrobacter winogradskyi Nb-255]
          Length = 365

 Score =  344 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 90/363 (24%), Positives = 166/363 (45%), Gaps = 3/363 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYF   ++   L       +L+ ++D  E+  +   L + S    A  +  RVP
Sbjct: 4   LTNTLGRYFAGRFMVAALGVFASIFLLLVLVDYIEMVRRTSGLASASALMVAETSLFRVP 63

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            +++++ PF  L+  +  +  L+R  ELV++RA G+S WQ ++P +  +I LG+F   V 
Sbjct: 64  QLLEKLTPFCVLIGAMTCYLALSRKLELVVARAAGVSAWQFISPTLACAIALGVFATTVY 123

Query: 121 NPIATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           NP++++  ++   +  +      G         W+          I A     +      
Sbjct: 124 NPLSSNLRELSKRMEAEMFGGASGGGLHDASGFWINQVTDDGQAIINAALSEQQGVRLTG 183

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T    D  ++   R +A  A + + +   K V  +     P+++ +  L   +     Q
Sbjct: 184 LTVFRFDPDSRFRERIEAREAALEDGRWLFKGVRRFTLDNPPVEQETFVLPTSLTPAQVQ 243

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
                  + SF+++   +  S  S+ F       Q++ LI  P +L AM ++AASVSL F
Sbjct: 244 NSFSTPETVSFWQLPDYIRSSE-SSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLRF 302

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R    + +V  G+ SGF+LY +  + +   K+ ++ P+AAA +PV +      L+LL +
Sbjct: 303 FRFGGVQKMVLSGVGSGFLLYVLSKVTEDLSKAELMNPIAAAWLPVCVGGLTGFLVLLHQ 362

Query: 359 EDG 361
           EDG
Sbjct: 363 EDG 365


>gi|319898730|ref|YP_004158823.1| hypothetical protein BARCL_0559 [Bartonella clarridgeiae 73]
 gi|319402694|emb|CBI76240.1| conserved membrane protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 363

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 120/364 (32%), Positives = 194/364 (53%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  YLK   YFLLG  IL  +ID  E  +++  LP+Y++    +++  R+
Sbjct: 1   MIGWTLGRYFFVLYLKKICYFLLGVFILTLLIDFTENSSRLELLPHYTVKGAFLISLLRI 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+ PFI L   + +  +LN+  ELV++R+IGIS WQ L P   G+ LLG+F++L 
Sbjct: 61  PFIMQQLFPFIALFSAMTMLISLNQKLELVVARSIGISAWQFLMPACFGAFLLGLFSILF 120

Query: 120 INPIATSGEKIGIDLIQQWKDNG--DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           +NP+A         +I  W+ N       +  IPW+          IGAK I  +     
Sbjct: 121 VNPLAAWSSSQAEKMIAAWRSNNIEISTSNTRIPWLTQQTNLGRTTIGAKSITHQGLSLI 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D   +  ++   + +  +   A + N    L     Y+ G+ P       L   +K +  
Sbjct: 181 DAIFVQYNENATVKNWINTKKATLTNGAWLLTNGTIYKIGQTPEKFTELRLKTHLKPEFL 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            +      +  FY++ +K++ + +S  +   + +     LI  P++LVAMTLIAA+VSL+
Sbjct: 241 TEHLADPVTIPFYKLPEKIAVA-RSFGYSANKFDMHLQSLIASPILLVAMTLIAATVSLK 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
           F+R  Q R ++  G+ +GF+LY I  +++SFG +G + P+ AA +PV++ +S  I  LL 
Sbjct: 300 FTRFGQSRTLILGGVIAGFILYVISVLVRSFGNAGYIPPIIAAWVPVVVALSFGISFLLH 359

Query: 358 KEDG 361
            EDG
Sbjct: 360 TEDG 363


>gi|90423815|ref|YP_532185.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB18]
 gi|90105829|gb|ABD87866.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB18]
          Length = 362

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 87/360 (24%), Positives = 166/360 (46%), Gaps = 2/360 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF   ++   L    G  +L+  +D  ++  + G  P+ S       +  RVP +
Sbjct: 4   NTLSRYFAGRFVTAALAVFAGLFVLLVFVDYIDLLRRAGGRPSISALLIVQTSVYRVPQL 63

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R  ELV++RA GIS WQ + P +  ++ LG+F  +V NP
Sbjct: 64  LERLMPFCILIGAMTCYLALSRRLELVVARAAGISAWQFMAPALWSALALGVFATVVFNP 123

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSD-IIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++ + ++    +  +   +      D    W+     +    I A +   +  +    + 
Sbjct: 124 MSANMQERAKQMEAEMFGDSSGSLQDASGFWINQVTTEGQAIINAARSQQQGALLTGLSV 183

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              +       R +A  A +     + K +  Y     P+D++   L   + +   +   
Sbjct: 184 FRFEPDFSFSERIEAREATLEPGFWRFKNLRRYTLDGPPVDQDVFLLPTTLTLAQVRNSF 243

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               + SF+++   +  S  S+ F       QF+ L+  P +L AM ++AASVSL F R 
Sbjct: 244 STPETVSFWQLPGYIRSSE-SSGFATAGYRLQFHKLLARPFLLAAMVMLAASVSLRFFRF 302

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +EDG
Sbjct: 303 GGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGSLAGFLALLHQEDG 362


>gi|225627183|ref|ZP_03785221.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225618018|gb|EEH15062.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 397

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 118/363 (32%), Positives = 199/363 (54%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RV
Sbjct: 36  MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRV 95

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ +
Sbjct: 96  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFI 155

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP+A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 156 LNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLAD 215

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D++  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +
Sbjct: 216 ATFIQFDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE 275

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 276 EKLASPETIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 334

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL K
Sbjct: 335 VRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLLHK 394

Query: 359 EDG 361
           EDG
Sbjct: 395 EDG 397


>gi|227821475|ref|YP_002825445.1| permease YjgP/YjgQ family protein [Sinorhizobium fredii NGR234]
 gi|227340474|gb|ACP24692.1| permease YjgP/YjgQ family protein [Sinorhizobium fredii NGR234]
          Length = 360

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 138/361 (38%), Positives = 211/361 (58%), Gaps = 2/361 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYFFK Y+ TT +FL+G   L+F+ID +E+ ++M  LP+Y++S   ++   R+P
Sbjct: 2   ILSTLGRYFFKRYIVTTFWFLVGIFALIFIIDFSELASRMSALPHYTVSGALLMTTFRIP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            I+QQ +PF+ L   +    +LNR  ELV++RA GIS+WQ L PFV+G+ L+G+  V+ +
Sbjct: 62  TILQQTVPFVALFSAMAALISLNRRYELVVTRAAGISVWQFLRPFVLGAFLVGVLAVVAL 121

Query: 121 NPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           NP+A  G K    L  +W  +    +S  IPW++      D  IGA+ +        + T
Sbjct: 122 NPLAAWGTKRAEALEAEW-GSSRSAQSSSIPWLRQIYDGTDTIIGARSVQNGGTELINVT 180

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
            I  D +  I  R+DA  A + +    L  V E   GR+P    +  L   +K D  Q+ 
Sbjct: 181 VIHFDPQGTITLRQDAKSAKLEDGYWLLNGVTESGNGRLPRRLETVQLRTNLKADFVQER 240

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
             +  S  F+++  K+  + +S  F     ETQ + L+ +PL+LVAMTLIAA VSL+FSR
Sbjct: 241 LAKADSIQFFDLPHKIEVA-RSFGFSTDAMETQLHSLLSLPLLLVAMTLIAACVSLKFSR 299

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
            NQ R ++  GI SGF+LY +  ++K+FG SGI+ P  AA +PV++ ++L   ILL +ED
Sbjct: 300 FNQSRSVILGGILSGFVLYVVTVLVKAFGSSGIVPPFVAAWLPVVVAMALGSTILLHQED 359

Query: 361 G 361
           G
Sbjct: 360 G 360


>gi|92117864|ref|YP_577593.1| permease YjgP/YjgQ [Nitrobacter hamburgensis X14]
 gi|91800758|gb|ABE63133.1| permease YjgP/YjgQ [Nitrobacter hamburgensis X14]
          Length = 365

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 87/363 (23%), Positives = 166/363 (45%), Gaps = 3/363 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYF   ++   L       +L+ ++D  E+  +   L + S    A  +  RVP
Sbjct: 4   LTNTLGRYFASRFVVAALGVFASIFLLLVLVDYIEMVRRTSGLASASAIMVAETSLFRVP 63

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            +++++ PF  L+  +  +  L+R  ELV++RA GIS WQ ++P +  +++LG+      
Sbjct: 64  QLLEKLTPFCVLIGAMTCYLALSRRLELVVARAAGISAWQFISPALACALVLGVLATTAY 123

Query: 121 NPIATSGEKIGIDLIQQWKD--NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           NP++ +  ++   +  +     +G   +     W+          I A +   +      
Sbjct: 124 NPMSANLRELSKKMEAELFGSVSGGGLQEASGFWINQVTDDGQAIINAARSEQQGVRLTG 183

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T    D  +    R +A  A + + +   K V  +     P+++ +  L   +     +
Sbjct: 184 LTVFRFDPDSTFRERIEAREATLEDGRWLFKGVRRFTLDSPPVEQETFVLPTSLTAAQVR 243

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
                  + SF+++   +  S  S+ F       Q++ LI  P +L AM ++AASVSL F
Sbjct: 244 NSFSTPETVSFWQLPGYIRSSE-SSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLRF 302

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R    + +V  G+ SGF+LY +  + +   K+ ++ P+AAA +PV +      L+LL +
Sbjct: 303 FRFGGVQKMVLSGVGSGFLLYVLSKVTEDLSKAELMNPIAAAWLPVCVGGLAGFLVLLHQ 362

Query: 359 EDG 361
           EDG
Sbjct: 363 EDG 365


>gi|85716330|ref|ZP_01047303.1| permease YjgP/YjgQ [Nitrobacter sp. Nb-311A]
 gi|85696846|gb|EAQ34731.1| permease YjgP/YjgQ [Nitrobacter sp. Nb-311A]
          Length = 365

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 89/363 (24%), Positives = 168/363 (46%), Gaps = 3/363 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYF   +L   L   +   +L+ ++D  E+  +   L + S    A  +  RVP
Sbjct: 4   LTNTLGRYFAGRFLVAALGVFVSIFLLLVLVDYIEMVRRTSGLASASALVVAETSLFRVP 63

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            +++++ PF  L+  +  +  L+R  ELV++RA G+S WQ ++P +  +I+LG     V 
Sbjct: 64  QLLEKLTPFCVLIGAMTCYLALSRQLELVVARAAGVSAWQFISPALACAIVLGALATTVY 123

Query: 121 NPIATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           NP++ +  ++   +  +      G   +     W+          I A +   +      
Sbjct: 124 NPLSANLRELSKRMEAELFGGVSGGGLQDASGFWINQVTDDGQAIINAARSEQQGVRLTG 183

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T    +  ++   R +A  A + + +   K V  +     P+++ +  L+  +     Q
Sbjct: 184 LTVFRFNPHSRFEERIEAREAALEDGRWLFKGVRRFTLDNPPVEQETFVLSTSLTPAQVQ 243

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
                  + SF+++   +  S  S+ F       Q++ LI  P +L AM ++AASVSL F
Sbjct: 244 NSFSTPETVSFWQLPGYIKSSE-SSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLRF 302

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R    + +V  G+ SGF+LY +  + +   K+ ++ P+AAA +PV +      L+LL +
Sbjct: 303 FRFGGVQKMVLSGVGSGFLLYVLSKVTEDLSKAELMNPIAAAWLPVCVGGLTGFLVLLYQ 362

Query: 359 EDG 361
           EDG
Sbjct: 363 EDG 365


>gi|121601841|ref|YP_988822.1| YjgP/YjgQ permease [Bartonella bacilliformis KC583]
 gi|120614018|gb|ABM44619.1| putative permease, YjgP/YjgQ family [Bartonella bacilliformis
           KC583]
          Length = 363

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 127/360 (35%), Positives = 195/360 (54%), Gaps = 3/360 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYFF  YL+ T YFLLGA IL F+ID  E  +++  LP+Y+     +++  R+PLI+
Sbjct: 5   ILGRYFFIQYLRITCYFLLGAFILAFLIDFIENSSRLTSLPHYTTKGALLISFLRIPLIM 64

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           QQ+ PFI L   I +  +LNR  ELVI+R+IG+S WQ L P   G+  LG+  + + NP 
Sbjct: 65  QQLFPFIALFSAITMLISLNRKFELVIARSIGVSAWQFLMPACFGAFFLGLVAIFLFNPF 124

Query: 124 ATSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           A  G      +I +W  N  +    +  IPW           IGAK I  E     +   
Sbjct: 125 AAWGYSQAEKIIAEWHSNNVQTSLNNHRIPWFTQHTDLGTTTIGAKSITDEGLSLINAIF 184

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
           +  ++   I +   A  A + N    L     Y+ G IP       +   +K +   ++ 
Sbjct: 185 VQYNEDATIKNWIHAQKATLTNSAWFLTHGTIYKTGHIPEKFAEFWIETNLKPEFLTEYL 244

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
              A+ SFY++ KK++ + +S  +   + +     LI +P +LVAMTLIAA+VSL+F+R 
Sbjct: 245 ADPATTSFYKLPKKIAVA-RSFGYSANKFDMYLQSLIALPALLVAMTLIAATVSLKFTRL 303

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            Q   ++  G+ +GF+LY I  ++++FG +G + P+ AA +PVI+ + L I  LL KEDG
Sbjct: 304 EQSGKLILSGVIAGFVLYVISVLVRAFGNAGYIPPIIAAWVPVIIALFLGISFLLHKEDG 363


>gi|158425948|ref|YP_001527240.1| permease precursor [Azorhizobium caulinodans ORS 571]
 gi|158332837|dbj|BAF90322.1| permease precursor [Azorhizobium caulinodans ORS 571]
          Length = 363

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 91/364 (25%), Positives = 163/364 (44%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L  YF + +  +        + L+ ++D  E+  +  +    S    A+L   R 
Sbjct: 1   MIGRTLGFYFARRFFASVTMIFFSCVGLIMLVDFLEMARRTADRDTVSAVTVALLTIYRT 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P   +Q++PF  L   +  F  L+R  ELV++RA+G+S+WQ  +P ++ + L+G+F   V
Sbjct: 61  PAFTEQLLPFAVLFGGMATFVTLSRKLELVVARAVGLSVWQFTSPALLVAFLIGVFATCV 120

Query: 120 INPIATSGEKIGIDLIQQWKD--NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
            NP++   ++    +  +  +  +G   +     W++  +      I A           
Sbjct: 121 FNPVSADFKERANRMEAEIFNTASGVFTQGTSGFWIRQQSVDGQAIIQAAASQQGGRQLT 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
             T    D+  K+  R +A  AI+ +    +K+      G       +  L   +     
Sbjct: 181 GVTVFEFDRNGKLTDRVEAKSAILGDGYWTMKEARVLVPGSDQQTFETYLLATKLDPKQI 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
           Q+      + SF+++   +S + +S  F   R   Q   L+  P +LVAM LIAA V L 
Sbjct: 241 QESLVSPETVSFWQLPDAISNAEQSG-FGAARYRLQLQSLLARPFLLVAMVLIAAVVGLR 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
             R       +  G+ +GF+LY    + +  G +G++ P+AAA  P +  I + +LILL 
Sbjct: 300 VFRFGGVGQTILGGVLAGFLLYLGTKLAEDLGDAGVVHPIAAAWFPALAGIFMGVLILLH 359

Query: 358 KEDG 361
           +EDG
Sbjct: 360 REDG 363


>gi|299133713|ref|ZP_07026907.1| permease YjgP/YjgQ family protein [Afipia sp. 1NLS2]
 gi|298591549|gb|EFI51750.1| permease YjgP/YjgQ family protein [Afipia sp. 1NLS2]
          Length = 360

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 89/358 (24%), Positives = 171/358 (47%), Gaps = 2/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RYF + ++  +L   LG  +L+ ++D  E+  +   +P  S    A  +  RVP ++
Sbjct: 5   TLARYFARRFIIASLAVFLGIFLLLVLVDYIEMVRRTSSIPTASAIMVAETSLFRVPQLL 64

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           ++++PF  L+  +  +  L+R+ ELV++RA GIS WQ + P +V ++L+G+   +V NPI
Sbjct: 65  EKLMPFCILIGAMSCYLALSRSLELVVARAAGISAWQFITPALVAALLMGVLATVVYNPI 124

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           + + ++   ++  +   NG  Q  +   W+     +    I A     +       T   
Sbjct: 125 SAAMQERSKEMEAKLFSNGGVQNVEQS-WINQVTSEGQSIISAALSQNQGTRLSGVTVFR 183

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            +       R DA+ A +   + +L     +     P+ +++  L   +     +     
Sbjct: 184 FNPDGSFRDRIDANEANLEPGEWRLGGARIHSMTAAPVIQDNLLLKTNLTPAQVRNSFAT 243

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             + SF+++   +  S  S +        Q+  L+  P +L +M L+AA+VSL F R   
Sbjct: 244 PETVSFWQLPGYIQSSASSGL-ATAGYRLQYQKLLARPFLLASMVLVAAAVSLRFFRFGG 302

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
            + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +EDG
Sbjct: 303 VQKMVLSGVAAGFLLYVLSKVTEDLSKAELMYPLAAAWLPVCVGGLTGFLALLHQEDG 360


>gi|62289648|ref|YP_221441.1| hypothetical protein BruAb1_0705 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699576|ref|YP_414150.1| YjgP/YjgQ permease [Brucella melitensis biovar Abortus 2308]
 gi|189023898|ref|YP_001934666.1| permease [Brucella abortus S19]
 gi|254688958|ref|ZP_05152212.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 6
           str. 870]
 gi|254697092|ref|ZP_05158920.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254729988|ref|ZP_05188566.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 4
           str. 292]
 gi|256257206|ref|ZP_05462742.1| Predicted permease YjgP/YjgQ family protein [Brucella abortus bv. 9
           str. C68]
 gi|260545600|ref|ZP_05821341.1| permease YjgP/YjgQ family protein [Brucella abortus NCTC 8038]
 gi|260754447|ref|ZP_05866795.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 6 str. 870]
 gi|260757666|ref|ZP_05870014.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 4 str. 292]
 gi|260761493|ref|ZP_05873836.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883476|ref|ZP_05895090.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 9 str. C68]
 gi|297248056|ref|ZP_06931774.1| YjgP/YjgQ family permease [Brucella abortus bv. 5 str. B3196]
 gi|62195780|gb|AAX74080.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615677|emb|CAJ10664.1| Predicted permease YjgP/YjgQ family [Brucella melitensis biovar
           Abortus 2308]
 gi|189019470|gb|ACD72192.1| Predicted permease YjgP/YjgQ family [Brucella abortus S19]
 gi|260097007|gb|EEW80882.1| permease YjgP/YjgQ family protein [Brucella abortus NCTC 8038]
 gi|260667984|gb|EEX54924.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 4 str. 292]
 gi|260671925|gb|EEX58746.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674555|gb|EEX61376.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 6 str. 870]
 gi|260873004|gb|EEX80073.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 9 str. C68]
 gi|297175225|gb|EFH34572.1| YjgP/YjgQ family permease [Brucella abortus bv. 5 str. B3196]
          Length = 362

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 119/363 (32%), Positives = 199/363 (54%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ TLYFLLG   L  ++D  E  N++  LP Y++     L+A RV
Sbjct: 1   MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENANRLANLPAYTVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP+A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D++  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +
Sbjct: 181 ATFIQFDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 241 EKLASPETIPFTQLCHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|90419501|ref|ZP_01227411.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336438|gb|EAS50179.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 360

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 110/358 (30%), Positives = 182/358 (50%), Gaps = 2/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RYFF+ Y+ + L  LL    L+++IDL E+  +     +      A+ +  RVP  I
Sbjct: 5   TLNRYFFRLYVVSFLSTLLTVFALIYLIDLIEVSRR-SRFEDLGFGATALFSLLRVPSFI 63

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            Q  PFI L  +I     LNR  ELV++RA G+SIWQ+L PFVVGS L+GI    V NP+
Sbjct: 64  GQAFPFIVLFSSIYTLLTLNRRLELVVARASGVSIWQILLPFVVGSFLIGIVATFVYNPL 123

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
               + +  D+       GD   SD +PW++         +GAK +     +  D T+  
Sbjct: 124 TAYTKTLSEDMQTTMTAGGDVSSSDRVPWLRQEGDGIQSILGAKTVARSGTVLGDITAFV 183

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
           ++ +  +  R DA  A++ ++   L+K    + G  P       L   ++ +  ++    
Sbjct: 184 MNDEGIVKERIDAARAVLNDEYWLLEKPRVTRVGYRPEFPQEYKLPTSLRPEYVEQRIAD 243

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             + S +++  K+  +  S  F+      Q++ L+  P + +AMTL+AA+V+  FSR+ Q
Sbjct: 244 PEAISIWQLGSKIDVAA-SLGFNTDAFRMQYHTLVAQPALFIAMTLLAATVATRFSRTGQ 302

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
               +A G+ +GF+LY +  + K+ G + ++ PV AA  PV+      + ILL +EDG
Sbjct: 303 SGRTIAGGVMAGFVLYVVTFLAKALGSNDVVPPVMAAWFPVLAAGLSGVTILLHQEDG 360


>gi|49475338|ref|YP_033379.1| hypothetical protein BH05440 [Bartonella henselae str. Houston-1]
 gi|49238144|emb|CAF27352.1| Hypothetical transmembrane protein [Bartonella henselae str.
           Houston-1]
          Length = 365

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 119/366 (32%), Positives = 190/366 (51%), Gaps = 6/366 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L +YFF  YLK T YFL G  +L  +ID  E   ++  LP Y+     +++  R+
Sbjct: 1   MIGWTLGQYFFIRYLKMTCYFLGGIFVLALLIDFTENSGRLSSLPRYTAKDAFLISVLRI 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPFI L   + +  +LNR SELV++R+IGIS WQ L P   G+ L G+F++L+
Sbjct: 61  PFIMQQLIPFIALFSAMAMLISLNRKSELVVTRSIGISAWQFLMPACFGAFLFGLFSILL 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGD----KQKSDIIPWMQISNPQQDIFIGAKKILPENHI 175
           +NP+A  G      ++ +W+   +       +  I W+          IGAK I  +   
Sbjct: 121 VNPLAAWGFSQAERMMTEWRSKNNNVLTSLHNTRILWLTQRTHSGRTTIGAKSITDQGLS 180

Query: 176 WEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
             D T +  +    I +  ++  A + N    L     Y+ G  P   +   +   +K +
Sbjct: 181 LIDATFVQYNDNATIKNWINSRKATLINGAWLLTDGTIYKIGHPPEKFSELQIQTTLKPE 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
              +     A+  FY++  K+  + +S  +     +     LI +P +L+AMTLIAA VS
Sbjct: 241 FLTERLVNPATIPFYQLPTKIMIA-RSFGYSANNFDMYLQSLIALPALLIAMTLIAAVVS 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           L F+R  Q +I++  G+ +GF LY I  ++++FG +G + P+ AA  PV + + L I  L
Sbjct: 300 LNFTRFGQSKILILGGVIAGFSLYVISILVQAFGNAGYIPPIIAAWTPVFIALFLGISFL 359

Query: 356 LQKEDG 361
           L KEDG
Sbjct: 360 LHKEDG 365


>gi|86749599|ref|YP_486095.1| permease YjgP/YjgQ [Rhodopseudomonas palustris HaA2]
 gi|86572627|gb|ABD07184.1| permease YjgP/YjgQ [Rhodopseudomonas palustris HaA2]
          Length = 361

 Score =  337 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 92/361 (25%), Positives = 169/361 (46%), Gaps = 3/361 (0%)

Query: 2   PGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPL 61
              L RYF   ++ + L    G  +L+  +D  ++  + G L   S    A  +  RVP 
Sbjct: 3   LNTLGRYFAARFVSSALGVFFGLFVLLVFVDYIDLLRRAGGLS-VSAFVIAQASFFRVPQ 61

Query: 62  IIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVIN 121
           ++++++PF  L+  +  +  L+R  ELVI+RA G+S WQ + P +  ++ LG+F   V N
Sbjct: 62  LLERLLPFCILIGGMTCYLALSRRLELVIARAAGLSAWQFIAPALWSALALGVFASAVFN 121

Query: 122 PIATSGEKIGIDLIQQWKDNGDKQKSDI-IPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           P++   ++    +  +    G     D    WM   +P+    I A +   +  +    +
Sbjct: 122 PMSAYMQERAKQMEAELFGQGSGSLQDANGFWMNQVSPEGQSIINAARSQQQGAVLSGIS 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
               +   +   R +A  A++      LK V +Y     P ++ +  L   + +   +  
Sbjct: 182 VFRFEPDFQFKDRIEAREAVLEPGYWLLKDVRKYTLDSAPEEQATLRLPTALTLAQVRNS 241

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
                S SF+++   +  S  S+ F       Q++ L+  P +L AM ++AASVSL F R
Sbjct: 242 FATPESVSFWQLPSYIKASE-SSGFATAGYRLQYHKLLAKPFLLAAMVMLAASVSLRFFR 300

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
               + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +ED
Sbjct: 301 FGGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLYQED 360

Query: 361 G 361
           G
Sbjct: 361 G 361


>gi|91977435|ref|YP_570094.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB5]
 gi|91683891|gb|ABE40193.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisB5]
          Length = 361

 Score =  337 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 90/360 (25%), Positives = 171/360 (47%), Gaps = 3/360 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF   ++ + L    G  +L+  +D  ++  + G L   S    A  +  RVP +
Sbjct: 4   NTLGRYFAARFVTSALGVFFGLFVLLVFVDYIDLLRRAGGLA-VSALVIAQASFYRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R+ ELVI+RA G+S W+ ++P +  ++ LG+F   V NP
Sbjct: 63  LERLMPFCILIGGMTCYLALSRSLELVIARAAGLSAWEFVSPALWSALALGVFASAVFNP 122

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSD-IIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++   ++    +  +    G     D    WM   +P+    I A +   +  +    + 
Sbjct: 123 MSAYMQERAKQMEAELFGQGSGSLQDASGFWMNQVSPEGQSIINAARSQQQGAVLSGISV 182

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              +   +   R +A  A++      L+ V  Y     P+ +++  L   + +   +   
Sbjct: 183 FRFEPDFQFKDRIEAREAVLEPGHWLLRDVRRYTLDSAPVQEDTFRLPTALTLAQVRNSF 242

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S SF+++   +  S  S+ F       Q++ L+  P +L AM ++AASVSL F R 
Sbjct: 243 ATPESVSFWQLPSYIRASE-SSGFATSGYRLQYHKLLAKPFLLAAMVMLAASVSLRFFRF 301

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      L LL +EDG
Sbjct: 302 GGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVCVGGLAGFLALLYQEDG 361


>gi|319404055|emb|CBI77643.1| conserved membrane hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 363

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 122/364 (33%), Positives = 200/364 (54%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  YLKT  +FLLG  ILV +ID  E  +++  LP+Y+     +++  R+
Sbjct: 1   MIGLTLGRYFFMLYLKTVCFFLLGVFILVLLIDFTENSSKLALLPHYTAKGAFLISLLRI 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           PLI+QQ+ PFI L   I +  +LN+  ELV++R+IGIS WQ L P   G+ L G+F++L 
Sbjct: 61  PLIMQQLFPFIALFSAITMLISLNKKLELVVARSIGISAWQFLAPACFGAFLFGLFSILF 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           INP+A         +I +W+ N  +  +    IPW+        I +GAK I+ ++    
Sbjct: 121 INPLAAWSSSQAKKMIAEWRSNSAQISTTDTRIPWLTQHTNLGRITVGAKSIIYQDLSLI 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D T +  ++   + +  +   A + +    L     Y+ G+ P       +   +K +  
Sbjct: 181 DATFVQYNENATVKNWINTKKATLTDGAWLLTNGTIYKIGQTPEKFTELRIKTHLKPEFL 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            ++     +  FY + KK++ + +S  +   + +     LI +P++LVAMTLIAA+VSL+
Sbjct: 241 TEYLTDPITIPFYTLPKKIAVA-RSLGYSANKFDMHLQSLIALPMLLVAMTLIAATVSLK 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
             R  Q R ++  G+ +GF+LY I  +++SFG +G + P+ AA +PVI+ +  +I  LL 
Sbjct: 300 IPRFGQSRTLILGGVIAGFILYVISMLVQSFGNAGYIPPIIAAWVPVIVALFFAISFLLY 359

Query: 358 KEDG 361
            EDG
Sbjct: 360 TEDG 363


>gi|319784424|ref|YP_004143900.1| permease YjgP/YjgQ family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170312|gb|ADV13850.1| permease YjgP/YjgQ family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 360

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 116/362 (32%), Positives = 193/362 (53%), Gaps = 3/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M   L RYFF  Y+  T++F +G + LVF+ID  E+  +   LP ++      ++  R+P
Sbjct: 1   MGWTLGRYFFFRYVTITIWFFIGLLALVFLIDFTELSGRTTGLPGFTYGTAVAISGLRMP 60

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +I+ Q +PF+ L   +    +LNR  ELVI+R+ G+S WQ L P  +G++L G+ +V VI
Sbjct: 61  MIMLQTVPFVGLFSAMATLVSLNRRYELVIARSAGVSAWQFLLPCCIGALLFGVLSVGVI 120

Query: 121 NPIATSGEKIGIDLIQQWKDN-GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A         +  Q +    +   +D  PW++      D  IGA+ IL +     D 
Sbjct: 121 NPLAAHAFSWSEQIETQLRSGKSNTVSADAAPWIRQKTSSGDTIIGARAILNQGLEMADV 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
               +D +  I+ RKDA  A + +   +L+ V  +Q G I     +  +   +K +  Q+
Sbjct: 181 VFFILDPQGNIVERKDAARAFLRDGYWELQDVKTFQNGTI-QASATDRVPTNLKPEFVQE 239

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
              +  +  FY++  K+  + +S          QF  L+ +P +LVAMTLIAA+VS+ F+
Sbjct: 240 RLARPETIPFYDLPGKIEVA-RSFGLKANAFAMQFDSLVALPFLLVAMTLIAATVSMRFA 298

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R  Q   ++  GI +GF+LY +  ++K+FG +G +  V AA +PV++ +   +  LL KE
Sbjct: 299 RMGQSATMILGGIIAGFLLYVVSVLVKAFGVAGFVPTVVAAWVPVMVAMFFGVTFLLYKE 358

Query: 360 DG 361
           DG
Sbjct: 359 DG 360


>gi|17987546|ref|NP_540180.1| putative permeases [Brucella melitensis bv. 1 str. 16M]
 gi|225852206|ref|YP_002732439.1| permease YjgP/YjgQ family protein [Brucella melitensis ATCC 23457]
 gi|254693440|ref|ZP_05155268.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|256044379|ref|ZP_05447283.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113222|ref|ZP_05454090.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264286|ref|ZP_05466818.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563731|ref|ZP_05834217.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           16M]
 gi|261213693|ref|ZP_05927974.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|265990797|ref|ZP_06103354.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994633|ref|ZP_06107190.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983249|gb|AAL52444.1| putative permeases [Brucella melitensis bv. 1 str. 16M]
 gi|225640571|gb|ACO00485.1| permease YjgP/YjgQ family protein [Brucella melitensis ATCC 23457]
 gi|260153747|gb|EEW88839.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260915300|gb|EEX82161.1| permease YjgP/YjgQ family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|262765746|gb|EEZ11535.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001581|gb|EEZ14156.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094546|gb|EEZ18355.1| permease YjgP/YjgQ family protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408705|gb|ADZ65770.1| permease YjgP/YjgQ family protein [Brucella melitensis M28]
 gi|326538429|gb|ADZ86644.1| permease YjgP/YjgQ family protein [Brucella melitensis M5-90]
          Length = 362

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 119/363 (32%), Positives = 199/363 (54%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ TLYFLLG   L  ++D  E  N++  LP Y++     L+A RV
Sbjct: 1   MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENANRLANLPAYTVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP+A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D++  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +
Sbjct: 181 ATFIQFDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 241 EKLASPETIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|239831520|ref|ZP_04679849.1| permease YjgP/YjgQ family protein [Ochrobactrum intermedium LMG
           3301]
 gi|239823787|gb|EEQ95355.1| permease YjgP/YjgQ family protein [Ochrobactrum intermedium LMG
           3301]
          Length = 362

 Score =  336 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 122/363 (33%), Positives = 194/363 (53%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ T YFLLG   L  ++D  E  +++  LP+YS+     L+A RV
Sbjct: 1   MIGWTLGRYFFIRYVQITFYFLLGIFALSLLLDFTENASKLSNLPDYSVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G+ L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGAFLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPFAAYGFAKADEIASTWKTGKTTDVSALRDPWLRQKTDEGETIIGAKSILDQGATLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D+K  I  R DA  A + +   +L  V  +  G  P    S  +   ++ +  +
Sbjct: 181 ATFIQFDEKKNIRERFDARRAQLRDGHWELTDVTRFARGEEPQKMASFQIETQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 241 EKLATPDTIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GFMLY +  ++K+FG +G + P  AA +PVI+     +  LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFMLYVVSVLVKAFGNAGFVPPFVAAWVPVIIATFFGVSFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|319407067|emb|CBI80704.1| conserved membrane hypothetical protein [Bartonella sp. 1-1C]
          Length = 363

 Score =  336 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 122/364 (33%), Positives = 199/364 (54%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  YLKT  +FLLG  ILV +ID  E  +++  LP+Y+     +++  R+
Sbjct: 1   MIGLTLGRYFFMLYLKTVCFFLLGVFILVLLIDFTENSSKLAFLPHYTAKGAFLISLLRI 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           PLI+QQ+ PFI L   I +  +LN+  ELV++R+IGIS WQ L P   G+ L G+F++L 
Sbjct: 61  PLIMQQLFPFIALFSAITMLISLNKKLELVVARSIGISAWQFLAPACFGAFLFGLFSILF 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQK--SDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           INP+A         +I +W+ N  +       IPW+        I +GAK I+ ++    
Sbjct: 121 INPLAAWSSFQAEKMIAEWRSNNAQTSITGTRIPWLTQHTNLGRITVGAKSIIYQDLSLI 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D T +  ++   + +  +   A + +    L     Y+ G+ P       +   +K +  
Sbjct: 181 DATFVQYNENATVKNWINTKKATLTDGAWLLTNGTIYKIGQTPEKFTELRIKTHLKPEFL 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            ++     +  FY + KK++ + +S  +   + +     LI +P++LVAMTLIAA+VSL+
Sbjct: 241 TEYLTDPITIPFYNLPKKIAVA-RSLGYSANKFDMHLQSLIALPMLLVAMTLIAATVSLK 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
             R  Q R ++  G+ +GF+LY I  +++SFG +G + P+ AA +PVI+ +  +I  LL 
Sbjct: 300 IPRFGQSRTLILGGVIAGFILYVISMLVRSFGNAGYIPPIIAAWVPVIVALFFAISFLLY 359

Query: 358 KEDG 361
            EDG
Sbjct: 360 TEDG 363


>gi|153009929|ref|YP_001371144.1| permease YjgP/YjgQ family protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561817|gb|ABS15315.1| permease YjgP/YjgQ family protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 362

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 121/363 (33%), Positives = 194/363 (53%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ T YFLLG   L  ++D  E  +++  LP+YS+     L+A RV
Sbjct: 1   MIGWTLGRYFFIRYVQITFYFLLGIFALSLLLDFTENASKLSNLPDYSVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G+ L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGAFLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPFAAYGFAKADEIASTWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILDQGATLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D+K  I  R DA  A + +   +L  V  +  G  P    S  +   ++ +  +
Sbjct: 181 ATFIQFDEKKNIKVRYDARTAQLKDGHWELTDVTRFARGEEPQKMASFQIETQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 241 EKLATPDTIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GFMLY +  ++K+FG +G + P  AA +PV++     +  LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFMLYVVSVLVKAFGNAGFVPPFVAAWVPVVIATFFGVSFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|148560142|ref|YP_001258668.1| hypothetical protein BOV_0678 [Brucella ovis ATCC 25840]
 gi|148371399|gb|ABQ61378.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 362

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 117/363 (32%), Positives = 199/363 (54%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RV
Sbjct: 1   MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP+A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D++  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +
Sbjct: 181 ATFIQFDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+A+TLIAA+VSL+F
Sbjct: 241 EKLASPETIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAITLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|23501573|ref|NP_697700.1| hypothetical protein BR0686 [Brucella suis 1330]
 gi|161618655|ref|YP_001592542.1| permease YjgP/YjgQ family protein [Brucella canis ATCC 23365]
 gi|163842956|ref|YP_001627360.1| permease YjgP/YjgQ family protein [Brucella suis ATCC 23445]
 gi|254701469|ref|ZP_05163297.1| hypothetical protein Bsuib55_11506 [Brucella suis bv. 5 str. 513]
 gi|254704016|ref|ZP_05165844.1| hypothetical protein Bsuib36_08824 [Brucella suis bv. 3 str. 686]
 gi|254707610|ref|ZP_05169438.1| hypothetical protein BpinM_11731 [Brucella pinnipedialis
           M163/99/10]
 gi|254709807|ref|ZP_05171618.1| hypothetical protein BpinB_05956 [Brucella pinnipedialis B2/94]
 gi|256031298|ref|ZP_05444912.1| hypothetical protein BpinM2_11713 [Brucella pinnipedialis
           M292/94/1]
 gi|256060811|ref|ZP_05450971.1| hypothetical protein Bneo5_10662 [Brucella neotomae 5K33]
 gi|256159412|ref|ZP_05457190.1| hypothetical protein BcetM4_10688 [Brucella ceti M490/95/1]
 gi|256254706|ref|ZP_05460242.1| hypothetical protein BcetB_10505 [Brucella ceti B1/94]
 gi|256369121|ref|YP_003106629.1| permease YjgP/YjgQ family protein [Brucella microti CCM 4915]
 gi|260168437|ref|ZP_05755248.1| hypothetical protein BruF5_08723 [Brucella sp. F5/99]
 gi|260566735|ref|ZP_05837205.1| permease YjgP/YjgQ family protein [Brucella suis bv. 4 str. 40]
 gi|261221886|ref|ZP_05936167.1| permease YjgP/YjgQ family protein [Brucella ceti B1/94]
 gi|261315100|ref|ZP_05954297.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M163/99/10]
 gi|261317345|ref|ZP_05956542.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis B2/94]
 gi|261324803|ref|ZP_05964000.1| permease YjgP/YjgQ family protein [Brucella neotomae 5K33]
 gi|261752012|ref|ZP_05995721.1| permease YjgP/YjgQ family protein [Brucella suis bv. 5 str. 513]
 gi|261754671|ref|ZP_05998380.1| permease YjgP/YjgQ family protein [Brucella suis bv. 3 str. 686]
 gi|261757899|ref|ZP_06001608.1| permease YjgP/YjgQ family protein [Brucella sp. F5/99]
 gi|265988383|ref|ZP_06100940.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M292/94/1]
 gi|265997849|ref|ZP_06110406.1| permease YjgP/YjgQ family protein [Brucella ceti M490/95/1]
 gi|294852048|ref|ZP_06792721.1| hypothetical protein BAZG_00964 [Brucella sp. NVSL 07-0026]
 gi|306845287|ref|ZP_07477863.1| hypothetical protein BIBO1_1972 [Brucella sp. BO1]
 gi|23347486|gb|AAN29615.1| conserved hypothetical protein [Brucella suis 1330]
 gi|161335466|gb|ABX61771.1| permease YjgP/YjgQ family protein [Brucella canis ATCC 23365]
 gi|163673679|gb|ABY37790.1| permease YjgP/YjgQ family protein [Brucella suis ATCC 23445]
 gi|255999281|gb|ACU47680.1| permease YjgP/YjgQ family protein [Brucella microti CCM 4915]
 gi|260156253|gb|EEW91333.1| permease YjgP/YjgQ family protein [Brucella suis bv. 4 str. 40]
 gi|260920470|gb|EEX87123.1| permease YjgP/YjgQ family protein [Brucella ceti B1/94]
 gi|261296568|gb|EEY00065.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis B2/94]
 gi|261300783|gb|EEY04280.1| permease YjgP/YjgQ family protein [Brucella neotomae 5K33]
 gi|261304126|gb|EEY07623.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M163/99/10]
 gi|261737883|gb|EEY25879.1| permease YjgP/YjgQ family protein [Brucella sp. F5/99]
 gi|261741765|gb|EEY29691.1| permease YjgP/YjgQ family protein [Brucella suis bv. 5 str. 513]
 gi|261744424|gb|EEY32350.1| permease YjgP/YjgQ family protein [Brucella suis bv. 3 str. 686]
 gi|262552317|gb|EEZ08307.1| permease YjgP/YjgQ family protein [Brucella ceti M490/95/1]
 gi|264660580|gb|EEZ30841.1| permease YjgP/YjgQ family protein [Brucella pinnipedialis
           M292/94/1]
 gi|294820637|gb|EFG37636.1| hypothetical protein BAZG_00964 [Brucella sp. NVSL 07-0026]
 gi|306274446|gb|EFM56253.1| hypothetical protein BIBO1_1972 [Brucella sp. BO1]
          Length = 362

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 118/363 (32%), Positives = 199/363 (54%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RV
Sbjct: 1   MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP+A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D++  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +
Sbjct: 181 ATFIQFDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 241 EKLASPETIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++     +  LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGVSFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|163746449|ref|ZP_02153807.1| permease YjgP/YjgQ family, putative [Oceanibulbus indolifex HEL-45]
 gi|161380334|gb|EDQ04745.1| permease YjgP/YjgQ family, putative [Oceanibulbus indolifex HEL-45]
          Length = 365

 Score =  335 bits (860), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 82/366 (22%), Positives = 162/366 (44%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + +  + +        LV ++D  +   +  +  +    +   +    +P  I
Sbjct: 2   ILHFYFARRFFTSFMVITAVLAALVMLVDGVDQARRFAD-DDVGWDQVLGMTLLNMPQTI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  + +F  L R+SE+V++RA G S  + L   VV ++++G   V V+NPI
Sbjct: 61  NMILPLIMILATVALFIGLARSSEMVVTRAAGRSALRALVAPVVVALIIGTLAVAVLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  +    L Q+++ NG      SD   W++    +    I A +   +  +  + T 
Sbjct: 121 VAATSERSEQLTQKYRSNGSSALSVSDEGLWLRQGTEEGQSVIRAWRTNSDASVLYNVTI 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR------IPIDKNSTTLNIPIKMD 235
           I+ D +   I R +A+ A +     +L     +             +  + T+   + ++
Sbjct: 181 ISYDAEKGPIRRIEAESAQLSGGDWQLTGAKIWPLEAGVNAEGAAEEHETLTIPSSLTVE 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             ++   + A+ S YE+ + +    ++  F   + E      +  P  LVAM L+A++ +
Sbjct: 241 RIRESIARVAAVSIYELPEFIRQLEQAG-FSTRQHEVWLQAELARPFFLVAMVLVASAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   I  GF LY I +  +  G++G +    AA  P +  I L++ +L
Sbjct: 300 MRHTRFGGTGVAVLASILLGFGLYFIRSFAQILGENGQIPVTLAAWAPPVAAIFLALGLL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHAEDG 365


>gi|319405492|emb|CBI79111.1| conserved membrane hypothetical protein [Bartonella sp. AR 15-3]
          Length = 363

 Score =  335 bits (859), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 125/364 (34%), Positives = 200/364 (54%), Gaps = 4/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  YLKTT  FLLG  ILV +ID  E  +++  LP Y+     +++  R 
Sbjct: 1   MIGLTLGRYFFMLYLKTTCCFLLGVFILVLLIDFTENFSKLALLPYYTAKGAFLISLLRT 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           PLIIQQ+ PFI L   I +  +LN+  ELVI+R+IGIS WQ L P   G+ L G+F++L 
Sbjct: 61  PLIIQQLFPFIALFSAITMLISLNKRLELVIARSIGISAWQFLTPACFGAFLFGLFSILF 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
           INP+A         ++  W+ N ++    +  IPW+          IGAK I+ ++    
Sbjct: 121 INPLAAWSSSQSEKIVAAWRSNNNQISISNTRIPWLTQHTNLGRTTIGAKSIIHKDLSLI 180

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D T +  ++   + +  +   A++ +    L     Y+ G+ P   +   +   +K +  
Sbjct: 181 DATFVQYNENATVKNWINTKKAMLTDGAWLLINGTIYKIGQPPKKFSELRIKTHLKPEFL 240

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
            ++  +  +  FYE+ KK++ + +S  +   + +     LI +P++LVAMTLIAA+VSL+
Sbjct: 241 TEYLAEPVTIPFYELPKKIAVA-RSFGYSANKFDMHLQSLIALPMLLVAMTLIAATVSLK 299

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
             R  Q + ++  GI +GF+LY I  +++SFG +G + P+ AA +PVI+ +   I  LL 
Sbjct: 300 IPRFGQSKTLILGGIIAGFILYVISMLVRSFGNAGYIPPIIAAWVPVIVALFFGISFLLY 359

Query: 358 KEDG 361
            EDG
Sbjct: 360 TEDG 363


>gi|13476525|ref|NP_108095.1| hypothetical protein mll7865 [Mesorhizobium loti MAFF303099]
 gi|14027286|dbj|BAB54240.1| mll7865 [Mesorhizobium loti MAFF303099]
          Length = 360

 Score =  335 bits (859), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 114/362 (31%), Positives = 193/362 (53%), Gaps = 3/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M   L RYFF  Y+  T++F LG + LVF+ID  E+  +   LP ++      ++  R+P
Sbjct: 1   MGWTLGRYFFFRYVTITIWFFLGLLALVFLIDFTELSGRTTGLPGFTYGTAVAISGLRMP 60

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +I+ Q +PF+ L   +    +LNR  ELVI+R+ G+S WQ L P  +G++L G  +V +I
Sbjct: 61  MIMLQTVPFVGLFSAMATLVSLNRRYELVIARSAGVSAWQFLLPCCIGALLFGFVSVGLI 120

Query: 121 NPIATSGEKIGIDLIQQWKDN-GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A     +   +  Q +    +   +D  PW++      D  IGA+ IL +     D 
Sbjct: 121 NPLAAHAFSLSEQIETQLRSGKSNTVSADAAPWIRQKTSTGDTIIGARAILNQGLEMSDA 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
               +D++  I+ RKDA  A + +   +L+ V  ++ G I     S  +   +K +  Q+
Sbjct: 181 VFFVLDQQGNIVERKDAAHAYLRDGYWELQDVKTFRNGTI-QPSASDRVPTNLKPEFVQE 239

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
              +  +  FY++  K+  + +S          QF  L+ +P +LVAMTLIAA+VS+ F+
Sbjct: 240 RLARPETIPFYDLPGKIEVA-RSFGLKANAFAMQFDSLVALPFLLVAMTLIAATVSMRFA 298

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R  Q   ++  G+ +GF+LY +  ++K+FG +G +    AA +PV++ +   +  LL KE
Sbjct: 299 RMGQSATMILGGVVAGFLLYVVSVLVKAFGVAGFVPTAIAAWVPVVVAMFFGVTFLLYKE 358

Query: 360 DG 361
           DG
Sbjct: 359 DG 360


>gi|254713811|ref|ZP_05175622.1| hypothetical protein BcetM6_10740 [Brucella ceti M644/93/1]
 gi|254717131|ref|ZP_05178942.1| hypothetical protein BcetM_12059 [Brucella ceti M13/05/1]
 gi|261218946|ref|ZP_05933227.1| permease YjgP/YjgQ family protein [Brucella ceti M13/05/1]
 gi|261321555|ref|ZP_05960752.1| permease YjgP/YjgQ family protein [Brucella ceti M644/93/1]
 gi|260924035|gb|EEX90603.1| permease YjgP/YjgQ family protein [Brucella ceti M13/05/1]
 gi|261294245|gb|EEX97741.1| permease YjgP/YjgQ family protein [Brucella ceti M644/93/1]
          Length = 362

 Score =  334 bits (858), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 118/363 (32%), Positives = 198/363 (54%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RV
Sbjct: 1   MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP+A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  D++  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +
Sbjct: 181 ATFIQFDEQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 241 EKLASPETIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GF+LY +  ++K+FG +G + P  AA +PV++        LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGFVPPFVAAWVPVVIATFFGASFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|254718822|ref|ZP_05180633.1| hypothetical protein Bru83_04670 [Brucella sp. 83/13]
 gi|265983807|ref|ZP_06096542.1| permease YjgP/YjgQ family protein [Brucella sp. 83/13]
 gi|306838744|ref|ZP_07471578.1| permease YjgP/YjgQ family protein [Brucella sp. NF 2653]
 gi|264662399|gb|EEZ32660.1| permease YjgP/YjgQ family protein [Brucella sp. 83/13]
 gi|306406146|gb|EFM62391.1| permease YjgP/YjgQ family protein [Brucella sp. NF 2653]
          Length = 362

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 118/363 (32%), Positives = 198/363 (54%), Gaps = 3/363 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYFF  Y++ TLYFLLG   L  ++D  E  +++  LP Y++     L+A RV
Sbjct: 1   MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANLPAYTVWAALGLSAMRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P I+QQ+IPF+ L   +    +LNR  ELV++R++G+S WQ L P   G++L G+ T+ +
Sbjct: 61  PFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQFLLPACFGALLFGLATIFI 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDII-PWMQISNPQQDIFIGAKKILPENHIWED 178
           +NP+A  G     ++   WK       S +  PW++    + +  IGAK IL +     D
Sbjct: 121 LNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTDEGETIIGAKSILNQGTTLAD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T I  DK+  I  R DA  A + +   +L  V+ +  G+ P    +  ++  ++ +  +
Sbjct: 181 ATFIQFDKQKNIKDRYDARTATLQDGYWELTDVMRFARGQEPQKLETFRISTQLRPEYVE 240

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
           +      +  F ++  K+  + +S  +     + Q+  L+ +P +L+AMTLIAA+VSL+F
Sbjct: 241 EKLASPETIPFTQLRHKIEVA-RSFGYSANAFDMQYQSLLALPALLMAMTLIAATVSLKF 299

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  Q   ++  G+ +GF+LY +  ++K+F  +G + P  AA +PV++     +  LL K
Sbjct: 300 VRFGQSGAMILGGVIAGFVLYVVSVLVKAFSDAGFVPPFVAAWVPVVIATFFGVSFLLHK 359

Query: 359 EDG 361
           EDG
Sbjct: 360 EDG 362


>gi|118590093|ref|ZP_01547496.1| permease YjgP/YjgQ [Stappia aggregata IAM 12614]
 gi|118437065|gb|EAV43703.1| permease YjgP/YjgQ [Stappia aggregata IAM 12614]
          Length = 364

 Score =  332 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 109/360 (30%), Positives = 184/360 (51%), Gaps = 3/360 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  YF   +LK  L   L A +L+++ D+ E+  + G+   +S+ R A+++A RVPL++
Sbjct: 6   TLSLYFSGRFLKAILGLFLFAAVLIYLFDVLELVRRGGDREGFSVLRVAMISALRVPLLL 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +Q+IPF  L   I  F  L+R  ELV++RA GIS+WQ   P ++  I+LGI ++ V NP 
Sbjct: 66  EQVIPFTVLFGAIAAFVTLSRALELVVARASGISVWQFSLPAILVGIILGILSITVYNPA 125

Query: 124 ATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           A   ++   ++       +     +S    W++      +  + AK++L    +    T 
Sbjct: 126 AVWFQQKSDEVAAGLFGSEQSFLLQSSNDVWVRQDGLDGESVLLAKQLLEGGTLLRGVTI 185

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
            T DK      R +AD A + +    L+  + Y   + P       ++  +     ++  
Sbjct: 186 FTFDKDGTFRERIEADEARLGDQIWYLENAIVYTTEQDPQPYGQYQISTFLTATEVRESI 245

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S SF+ + + +  + ++     YR   Q+  L+  PL+LVAM LIAA+VSL+ SR 
Sbjct: 246 GSPESISFWNLPRFIELA-RNAGLPAYRYNLQYQTLLARPLLLVAMILIAAAVSLKVSRF 304

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
                ++  GI SGF+LY +  + K FG +GI+ P+ AA  P I  + + + ILL +EDG
Sbjct: 305 GGLGSMILGGILSGFVLYVLTELAKDFGGAGIVPPLVAAWAPGIFGVLMGLTILLNQEDG 364


>gi|148255227|ref|YP_001239812.1| putative permease [Bradyrhizobium sp. BTAi1]
 gi|146407400|gb|ABQ35906.1| putative permease [Bradyrhizobium sp. BTAi1]
          Length = 365

 Score =  332 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 87/361 (24%), Positives = 167/361 (46%), Gaps = 3/361 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF   +L + +       +L+ ++D  E+  +   L + S    A  +  RVP +
Sbjct: 6   NTLGRYFAGRFLVSAVGVFASIFVLLVLVDYIEMVRKTSGLASASALMVAETSLFRVPQL 65

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R  ELV++RA G+S WQ + P +  +I+LG+    + NP
Sbjct: 66  LEKMMPFCVLIGAMTCYLALSRRLELVVARAAGVSAWQFIAPALASAIVLGLMATTLYNP 125

Query: 123 IATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           ++ +  ++   +  +      G   +     W+   NP   + I A +   +       T
Sbjct: 126 MSANLRELSKRMEAELFGAAPGGGVQDASGFWLNQINPDGSVIINAARSEQQGVRLTGLT 185

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
               D +     R +A  A + + +   K V  +     P+D+ +  L   +     +  
Sbjct: 186 LFRFDTEKHFKDRIEAREATLEDGQWVFKSVRRFSLDAPPVDEPTFILPTSLTPAQVRNS 245

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
                + SF+++   +  S  S+ F       Q++ LI  P +L AM ++AASVSL F R
Sbjct: 246 FSTPETVSFWQLPSYIRSSE-SSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLRFFR 304

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
               + +V  G+ +GF+LY +  + +   K+ ++ P+ AA +PV +      + LL +ED
Sbjct: 305 MGGVQKMVLSGVGAGFLLYVLSKVTEDLSKAALMDPIVAAWLPVFVGGLTGFMALLYQED 364

Query: 361 G 361
           G
Sbjct: 365 G 365


>gi|254503227|ref|ZP_05115378.1| putative permease, YjgP/YjgQ family [Labrenzia alexandrii DFL-11]
 gi|222439298|gb|EEE45977.1| putative permease, YjgP/YjgQ family [Labrenzia alexandrii DFL-11]
          Length = 364

 Score =  332 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 180/364 (49%), Gaps = 7/364 (1%)

Query: 4   ILWR----YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           IL R    YF   ++K  L   L A +L+F+ D+ E+  +  +   +++ R A ++  RV
Sbjct: 2   ILGRTLSVYFSGRFIKAILGLFLFAAVLLFLFDVLELVRRGSDREGFTVMRVAYISLLRV 61

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           PL+++Q+IPF  L   I  F  L+R  ELV++RA GIS+WQ   P V+  + LGIF++ V
Sbjct: 62  PLLLEQVIPFTVLFGAIAAFVTLSRALELVVTRAAGISVWQFSTPAVLVGLFLGIFSITV 121

Query: 120 INPIATSGEKIGIDLIQQWK--DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
            NP A   ++   +        D     +S    W++      +  + A ++L       
Sbjct: 122 YNPAAVYLQQKSEEAAAGLFGADQTFLLQSSGEVWVRQDGLDGESVLRASQLLDNGTRLL 181

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
             T  T D+      R +A+ A + N+   L   + Y     P   +   ++  +     
Sbjct: 182 RVTVFTFDEDGTFRERIEAEQARLGNETWYLDNAIVYTTENDPQSYSVYQISTFLTATEV 241

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
           ++      S SF+ + + +  + ++     YR   Q+  L+  PL+L+AM LIAA+VSL+
Sbjct: 242 RESIGSPESISFWNLPRFIDLA-RNAGLPAYRYNLQYQSLLARPLLLIAMILIAAAVSLK 300

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
            SR      ++  GI SGF+LY +  + K FG +GI+ P+ AA  P I  + + + ILL 
Sbjct: 301 VSRFGGLGRMILGGILSGFVLYVLTELAKDFGGAGIVPPLVAAWAPGIFGVLMGLTILLH 360

Query: 358 KEDG 361
           +EDG
Sbjct: 361 QEDG 364


>gi|146340303|ref|YP_001205351.1| putative permease [Bradyrhizobium sp. ORS278]
 gi|146193109|emb|CAL77120.1| putative permease [Bradyrhizobium sp. ORS278]
          Length = 365

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 90/361 (24%), Positives = 171/361 (47%), Gaps = 3/361 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF   +L + +       +L+ ++D  E+  +   L + S    A  +  RVP +
Sbjct: 6   NTLGRYFAGRFLVSAVGVFASIFLLLVLVDYIEMVRRTSGLASASALMVAETSLFRVPQL 65

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R  ELV++RA G+S WQ + P +  +I+LG+    + NP
Sbjct: 66  LEKMMPFCVLIGAMTCYLALSRRLELVVARAAGVSAWQFIAPALASAIVLGLMATTLYNP 125

Query: 123 IATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           ++ +  ++   +  +   +  G   +     W+   NP   + I A +   +       T
Sbjct: 126 MSANLRELSKRMEAELFGSAPGGGVQDASGFWLNQLNPDGSVIINAARSEQQGVRLTGLT 185

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
               D KN+   R +A  A + + +   K V  +     P+D+ +  L   +     +  
Sbjct: 186 LFRFDTKNRFKDRIEAREASLEDGQWVFKSVRRFSLDAPPVDEPTFILPTTLTPAQVRNS 245

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
                + SF+++   +  S  S+ F       Q++ LI  P +L AM ++AASVSL F R
Sbjct: 246 FSTPETVSFWQLPSYIRSSE-SSGFATAGYRLQYHKLIAQPFLLAAMVMLAASVSLRFFR 304

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
               + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      + LL +ED
Sbjct: 305 MGGVQKMVLSGVGAGFLLYVLSKVTEDLSKAALMDPIAAAWLPVFVGGLTGFMALLYQED 364

Query: 361 G 361
           G
Sbjct: 365 G 365


>gi|27379217|ref|NP_770746.1| permease [Bradyrhizobium japonicum USDA 110]
 gi|27352368|dbj|BAC49371.1| bll4106 [Bradyrhizobium japonicum USDA 110]
          Length = 363

 Score =  329 bits (843), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 83/363 (22%), Positives = 165/363 (45%), Gaps = 3/363 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   L RYF   ++   L       +L+ ++D  E+  +   L + S    A  +  RVP
Sbjct: 2   LTNTLGRYFAGRFVVAALGVFASIFLLLVLVDYIEMVRKTSGLASASAIMVAETSLFRVP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
            +++++ PF  L+  +  +  L+R  ELV++RA G+S WQ ++P +  ++L+G+   +  
Sbjct: 62  QLLEKLTPFCMLIGAMTCYLALSRRLELVVARAAGVSAWQFISPALGSALLIGVIATVAY 121

Query: 121 NPIATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           NP++ +  ++   +  +   +  G   +     W+          I A +   +      
Sbjct: 122 NPMSANLRELSKRMEAELFGSAPGGGIQDASGFWLNQVTNDGQTIINAARSEQQGVRLTG 181

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T    D +     R +A  A +   +   + V  +     PI++    +   +     +
Sbjct: 182 LTLFRFDTEQHFKERVEAREAELEVGQWIFRNVRRFSLDGPPIEQAVLAIPTTLTEAQVR 241

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
                  + SF+++   +  S  S+ F       Q++ L+  P +L AM ++AASVSL F
Sbjct: 242 NSFSTPETVSFWQLPSYIRSSE-SSGFATAGYRLQYHKLLAQPFLLAAMVMLAASVSLRF 300

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R    + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV++      L LL +
Sbjct: 301 FRMGGVQKMVLSGVGAGFLLYVLSKVTEDLSKAELMHPIAAAWLPVVVGGLTGFLALLYQ 360

Query: 359 EDG 361
           EDG
Sbjct: 361 EDG 363


>gi|182677644|ref|YP_001831790.1| permease YjgP/YjgQ family protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633527|gb|ACB94301.1| permease YjgP/YjgQ family protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 362

 Score =  326 bits (836), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 96/359 (26%), Positives = 156/359 (43%), Gaps = 1/359 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RY    +L   L        +++VIDL E+  + G  P  + S  A L+  R P +
Sbjct: 5   PTLGRYLSSRFLFMILAVFGTIFSMIYVIDLVEMLRRAGNRPGATASLIAFLSFLRAPSV 64

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
            +QI+PF  L   +  F NL R  EL+++RA GISIWQL+ P +  ++ +GIF+V + NP
Sbjct: 65  SEQILPFCVLFGTMATFINLTRRLELLVARAAGISIWQLMMPPLGIALAIGIFSVTLYNP 124

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
           I+   +     +  +       Q++    W++ ++      I A+ +          T  
Sbjct: 125 ISAMMKHRADGIETELFGGIGGQETKGGLWIRQNSVDGQAIIRAETVEAGGSRLGGVTLY 184

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
           T  K      R +A  A +     ++ +      G    +     L   +      +   
Sbjct: 185 TYGKDGSFEARIEARHAKLVPGVWQMTEARIIVPGEEIQEAGLYLLATNLTPGEVSENIV 244

Query: 243 QFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSN 302
              S  F+E+    + +  + +  + R   QF  L+  PL  +AM LIAA+ SL F R  
Sbjct: 245 TPESVPFWELQSFRAATELAGL-DSTRYRLQFQLLLARPLFFIAMVLIAAAFSLRFFRFG 303

Query: 303 QPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
               +V  G  +GF+LY +       G SG+L    AA  P ++   L  L LL +EDG
Sbjct: 304 GITKMVCGGAGAGFVLYIVSKFTGDLGTSGLLSAPIAAWSPAVVASMLGALALLNQEDG 362


>gi|154246776|ref|YP_001417734.1| permease YjgP/YjgQ family protein [Xanthobacter autotrophicus Py2]
 gi|154160861|gb|ABS68077.1| permease YjgP/YjgQ family protein [Xanthobacter autotrophicus Py2]
          Length = 364

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 91/365 (24%), Positives = 164/365 (44%), Gaps = 5/365 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G IL  YF + +    +   L  + L+ ++D  E+  +  +    ++   A++   R 
Sbjct: 1   MIGRILGFYFARRFASAVVLIFLSCVTLIVLVDFLEMARRTADREQVTVGLLALVTLYRA 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P   +Q++PF  L   I  F  L+R  ELV++RA+G+S+WQ + P V+ + L+G+F+  V
Sbjct: 61  PSFTEQLMPFAVLFGAISTFVLLSRRLELVVARAVGLSVWQFITPPVLVAFLIGVFSTTV 120

Query: 120 INPIATSGEKIGIDLIQQW---KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIW 176
            NP++   ++    +  +      +G   +     W++  +      I A+         
Sbjct: 121 FNPVSADFKERANQIEGEIFGSSSSGLLPQGKKEFWVRQQSVDGQSIIQAQATRQGGRAL 180

Query: 177 EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG 236
                   DK ++++ R +A  A + +    L        G      ++  +   +    
Sbjct: 181 SGVVVFEFDKADRLVERVEARSATLGDGAWILTDARVLVPGLDHQHYDTYLIATNLDPKQ 240

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            Q+      + SF+++   +  + +S  F   R   Q   L+  P +LVAM LIAA V L
Sbjct: 241 IQESLIAPETVSFWQLPAAIRSAEQSG-FGAERYRLQLQSLLARPFLLVAMVLIAAVVGL 299

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
              R       +  G+ +GF+LY    + +  G +G + PVAAA  P +  I L +LILL
Sbjct: 300 RVFRFGGVGQTILGGVLAGFLLYVGTKLAEDLGDAGFVHPVAAAWFPAVAGILLGVLILL 359

Query: 357 QKEDG 361
            +EDG
Sbjct: 360 HREDG 364


>gi|307946742|ref|ZP_07662077.1| permease [Roseibium sp. TrichSKD4]
 gi|307770406|gb|EFO29632.1| permease [Roseibium sp. TrichSKD4]
          Length = 364

 Score =  326 bits (835), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 105/364 (28%), Positives = 183/364 (50%), Gaps = 7/364 (1%)

Query: 4   ILWR----YFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           IL R    YF   + K+ L   L A +L+F+ D+ E+  + G+   +++ R A+++  RV
Sbjct: 2   ILGRTLAIYFSARFFKSILGLFLLAAVLIFLFDVLELVRRGGDQEGFTVVRVALISILRV 61

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           PL+++Q+IPF  L  +I+ F  L+R  ELV++RA GIS+WQ   P VV  +++G  +V+ 
Sbjct: 62  PLLLEQVIPFAVLFGSILAFVTLSRALELVVARASGISVWQFAAPAVVVGLIIGTLSVVA 121

Query: 120 INPIATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
            NP+A   +    +        +     ++    W++      +  + AK++L       
Sbjct: 122 YNPLAVWLQHRSDEAAAGLFGSEQSFLLQTTQDVWVRQDGLDGESVLLAKQLLDGGTRLL 181

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
           D T    DK+     R +A  A + +    L+ V  Y   R P       ++  +     
Sbjct: 182 DVTIFAFDKEGSFKERVEAATARLGDQIWFLEDVTVYTTERDPQQYGRYEVSTYLTATEV 241

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
           ++      S SF+ + + +  + ++     YR   Q+  L+  PL+L AM +IAA+VSL 
Sbjct: 242 RESIGSPESISFWSLPRFIELA-RNAGLPAYRYTLQYQTLLARPLLLTAMIIIAAAVSLR 300

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
            SR      ++  GI +GF+LY +  + K FG +GI+ P+ AA  P I  + + + ILL+
Sbjct: 301 VSRFGGLGSMILGGIVAGFVLYVLSELAKDFGGAGIVPPIVAAWAPGIFGVLMGLTILLK 360

Query: 358 KEDG 361
           +EDG
Sbjct: 361 QEDG 364


>gi|254473284|ref|ZP_05086681.1| permease YjgP/YjgQ [Pseudovibrio sp. JE062]
 gi|211957400|gb|EEA92603.1| permease YjgP/YjgQ [Pseudovibrio sp. JE062]
          Length = 363

 Score =  326 bits (835), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 100/360 (27%), Positives = 182/360 (50%), Gaps = 3/360 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y  K +LK+ L   L A +L+ + D+ E+  + G+   +S+ R A ++A RVPL++
Sbjct: 5   TLSLYISKRFLKSILALFLFAAVLILLFDVLELVRRGGDREGFSLLRIAAISALRVPLLL 64

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +Q+IPF  L  +I  F  L+R+ ELV++RA GIS+WQ   P ++  + +GI +V+  NP 
Sbjct: 65  EQVIPFAVLFGSIWAFVTLSRSLELVVARAAGISVWQFTAPALLTGLFIGIASVIGYNPG 124

Query: 124 ATSGEKIGIDLIQQWKD--NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           A   ++   ++ +           +     W++ +    +  + A+ I  +       T 
Sbjct: 125 AVYLQQKSDEVAEGLFSVEQTYLLEGSGEVWLRQNGTDGESVLHARHIGGQGATLNGVTI 184

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
            + D++ +   R +A  A++     +L   V Y     P   ++ +++  +     ++  
Sbjct: 185 FSFDRQGEFSERIEARRAVLAEGMWRLTDAVVYALDTDPQHYDNYSVSTFLTPTEVKESI 244

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S SF+ + + +  S ++ +   YR   Q+  L+  PL+LVAM +IAA+VSL  SR 
Sbjct: 245 GSPESISFWSLPRFIELSQRAGL-PAYRYSLQYQTLLAKPLLLVAMIVIAAAVSLRVSRF 303

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
                ++ +GI +GF+LY +  I K  G +GI+    AA  P +  + +   ILL +EDG
Sbjct: 304 GGIGRLIIWGIIAGFVLYAVSEISKDLGGAGIVPTAVAAWAPGVFGVLMGFTILLNQEDG 363


>gi|218672883|ref|ZP_03522552.1| putative permease protein [Rhizobium etli GR56]
          Length = 340

 Score =  324 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 137/340 (40%), Positives = 203/340 (59%), Gaps = 2/340 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M G L RYFF+ YL TT +FL+G   + F++D +E   +M  LP Y+I  G V+ A R+P
Sbjct: 2   MFGTLSRYFFRRYLATTGWFLIGVSAISFLLDFSETAGRMSGLPGYTIGGGIVMTAVRLP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           LI+QQ IPFI L V + V   LNR  ELV++RA GIS+WQ + PF+ GS+ LG+ T+  +
Sbjct: 62  LILQQTIPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMFPFIAGSLALGLLTMTAL 121

Query: 121 NPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA+ +        D 
Sbjct: 122 NPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAQTVQENGTKLVDA 181

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
             I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L   +K D  Q+
Sbjct: 182 VLIHFDSSGRVILRQDAATAKLEDGYWQLNGVVERKPGEIPLRKASVQLRTNLKQDFVQE 241

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 +  F+++  +++ + KS        ETQF  L+  PL+LVAMTLIAA+VSL+FS
Sbjct: 242 RLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTLIAATVSLKFS 300

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           R NQ R ++  GI SGFMLY I  ++K+FG SG++ P  A
Sbjct: 301 RFNQSRPVILGGILSGFMLYVITVLVKAFGSSGVVPPFVA 340


>gi|323137698|ref|ZP_08072774.1| permease YjgP/YjgQ family protein [Methylocystis sp. ATCC 49242]
 gi|322396995|gb|EFX99520.1| permease YjgP/YjgQ family protein [Methylocystis sp. ATCC 49242]
          Length = 361

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 88/362 (24%), Positives = 162/362 (44%), Gaps = 2/362 (0%)

Query: 1   MPGI-LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G+ + RYF   +++T L        L+FV+   E+  +  + P       A++ A +V
Sbjct: 1   MIGVTITRYFAWRFMRTILAIFFTIFCLMFVVVFVEMLRRASDNPQAGAGMVALMTAMKV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P   + I+PF  L  ++  F +L R  EL+++RA G+S+WQ + P V+ ++L+G+F+V V
Sbjct: 61  PAAAEMILPFAVLFGSMATFVDLTRKLELIVARAAGMSVWQFITPPVLTALLIGVFSVAV 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
            NP++ S ++    +  +        + D   W++         + A             
Sbjct: 121 YNPLSASMKQRSDQMELELFGVPGSLRIDHGVWLRQHGVDGLAVMHAMGTAKGGTELTFV 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           +          + R +A  A +      L   +    G       S  L   +  +    
Sbjct: 181 SVNIYSPNGGFLERVEAQSARLEPGVWVLNGAIVSAPGEPARPVASYMLATDLTPEQAAA 240

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
            +       F+E+ +  + + ++ +  +     QF  L+  PL+LVAM L+AAS SL F 
Sbjct: 241 ATTPPQGTPFWELPEMTARTTEAGL-DSTGYRLQFQTLLARPLLLVAMVLVAASFSLRFF 299

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R       ++ G+ +GF+LY +  ++   G +G++ P+ AA  P ++   L  L LL  E
Sbjct: 300 RFGGVAKTLSGGVAAGFVLYIVTKVLSDLGGAGLISPLVAAWSPALVGSMLGTLTLLYSE 359

Query: 360 DG 361
           DG
Sbjct: 360 DG 361


>gi|220925666|ref|YP_002500968.1| permease YjgP/YjgQ family protein [Methylobacterium nodulans ORS
           2060]
 gi|219950273|gb|ACL60665.1| permease YjgP/YjgQ family protein [Methylobacterium nodulans ORS
           2060]
          Length = 362

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 88/358 (24%), Positives = 154/358 (43%), Gaps = 1/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RY     L+      L    LV+ +D  E+  + GE         A L+  R P I 
Sbjct: 6   TLGRYIAGRLLRMIAGVFLTVFALVYTLDFVELMRRAGETQGIGALTVARLSLLRTPSIA 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +QI+PF  L   +     L+R  ELV++RA GIS WQ L P V  ++ +G   V   NP+
Sbjct: 66  EQIMPFAILFGAMGALLQLSRKLELVVARAAGISAWQFLQPGVFVALAVGALMVGAYNPM 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           A + ++   ++  +     ++  S    W++  +      + A+  +         +   
Sbjct: 126 AAALKQHSTEIEARIFSRSNRGGSGKDLWIRQRSVDGQAIVRAETAIEGTTTLAGVSVFA 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D +     + +A  A +++   +L+          P   ++  +   +     ++    
Sbjct: 186 FDDQGTFTQQIEARQATLHDGYWELQDARVLAKDSQPESYDTYLVASNLVPSQVRQRFTP 245

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             S  F+++   ++ S ++ +    R   Q   L+  P++ VAM L+AASVSL F R   
Sbjct: 246 PDSVPFWQLGDTIARSERAGL-DATRYRLQRAVLLARPMLFVAMVLVAASVSLRFFRFGG 304

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              +   G+ +GF LY    +M+  G SGI+    AA  P ++   L  L LL +EDG
Sbjct: 305 IGRMALAGVAAGFALYVARQVMEGLGASGIVAAPVAAWFPAVVGSLLGTLALLYQEDG 362


>gi|260427738|ref|ZP_05781717.1| permease, YjgP/YjgQ family [Citreicella sp. SE45]
 gi|260422230|gb|EEX15481.1| permease, YjgP/YjgQ family [Citreicella sp. SE45]
          Length = 364

 Score =  323 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 81/366 (22%), Positives = 167/366 (45%), Gaps = 11/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +    +  L    I V ++DL E   + G   + S ++   + A R+P  +
Sbjct: 2   ILHRYFARRFFWMFMSILSVFAIFVGLVDLVEQIRKFG--GDISFAQKVQITALRLPEGM 59

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P + ++    +F  L R+SELV+ RA G S    L   ++ ++ +   TV ++NP+
Sbjct: 60  YEILPLVMILATAALFLMLARSSELVVVRAAGRSGLTALMGPMMVALAISGVTVAMLNPL 119

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL + ++++G    S      W++  +      I A +  P+  +  D + 
Sbjct: 120 VAATSKRASDLAESYENDGASVISIGKEGLWLRQGSSDGQAVIRAARANPDATVLYDVSF 179

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYG------RIPIDKNSTTLNIPIKMD 235
           +   +    I R +A  A + +    L+    +  G            +   +   +  +
Sbjct: 180 LQYAEDGGPIRRVEAAEAALEDGAWALRDAKVWPLGTRANPEAAAERHDRLRIASDLTQN 239

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +    + ++ + +++   ++   ++  F   R E  F   +  P+ LVAM L+AA  +
Sbjct: 240 DIRDRFGKPSAVAIWDLPDFINGLEQAG-FSARRHEVWFQMELARPIFLVAMVLVAAGFT 298

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R  +  + V   +  GF LY +    +  G++G L P+ AA +P + ++ L++ ++
Sbjct: 299 MRPARLGRTGLYVLAAVLLGFGLYYVRNFAQIMGENGQLPPLFAAWVPPVASLMLALGLV 358

Query: 356 LQKEDG 361
           LQ EDG
Sbjct: 359 LQMEDG 364


>gi|56697305|ref|YP_167671.1| YjgP/YjgQ family permease [Ruegeria pomeroyi DSS-3]
 gi|56679042|gb|AAV95708.1| permease, YjgP/YjgQ family [Ruegeria pomeroyi DSS-3]
          Length = 365

 Score =  323 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 84/366 (22%), Positives = 157/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + ++++ L   L  + LV +IDL E   +       S+ +   L     P  I
Sbjct: 2   ILDRYFARRFIQSFLVIGLVFLGLVLLIDLIEQLRRFEGF-EVSMGQLVGLTLLNAPAAI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P + ++  IV+F  L R+SELV++RAIG S  + L   V+ ++++G+  V  +NPI
Sbjct: 61  SEILPLLMILSTIVLFVGLARSSELVVTRAIGRSGIRALVGPVLVALVIGLLAVTTLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +       L   +++ G      SD   W++  +      I A     +     D T 
Sbjct: 121 VAATAVRYQTLADTYRNGGPSVLSLSDEGLWLRQGDAGGQSVIHATGFGGDGVTLFDVTI 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNIPIKMD 235
           ++         R  A+ A + + K  L+K   +            +  +   +   +  +
Sbjct: 181 LSYAPDGSAQRRTIAESAQLQDGKWLLQKAKVWPLKVGQNPEANAVYHDRIEMPTSLTQE 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +    +  + S Y++ + +    ++  F   R +      +  PL LV+M L+ A+ +
Sbjct: 241 RIRDSLGRRETVSIYDLPQTIEQLQQAG-FSTKRHKVWLQVELARPLFLVSMVLVGAAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF LY      +  G++G +    AA  P +  I L+  +L
Sbjct: 300 MRHTRFGGTGLAVLSAVLLGFTLYFTRNFAQILGENGQIPVALAAWAPPVAAIMLTFGLL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHAEDG 365


>gi|115525295|ref|YP_782206.1| permease YjgP/YjgQ [Rhodopseudomonas palustris BisA53]
 gi|115519242|gb|ABJ07226.1| permease YjgP/YjgQ family protein [Rhodopseudomonas palustris
           BisA53]
          Length = 361

 Score =  322 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 87/360 (24%), Positives = 163/360 (45%), Gaps = 3/360 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF   ++   +   LG  +L+  +D  ++  + G          A  +  RVP +
Sbjct: 4   NTLGRYFAGKFVTAAVGVFLGLFVLLVFVDYIDLLRRSGGRA-IPALLIAQTSMFRVPQL 62

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +++++PF  L+  +  +  L+R  ELV++RA G+S WQ + P +  ++LLG F  +V NP
Sbjct: 63  LERLMPFCILIGAMTCYLALSRRLELVVARAAGVSAWQFMAPALWSALLLGTFATMVFNP 122

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSD-IIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           ++ + ++           +      D    W+   N +    I A     +  +    T 
Sbjct: 123 VSANLQERAKQNEASMFGDSSGSLQDASGFWINQVNSEGQAIINASHSQQQGVLLTGLTV 182

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
                      R +A  A +     +LK V  Y     P+++++  L   +     +   
Sbjct: 183 FRFATDFSFKDRLEAREATLEPGFWRLKSVRRYSLDAPPVEEDTLLLPTTLTQAQVRNSF 242

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               + SF+++   +  S  S+ F       Q++ L+  P +L AM ++AASVSL F R 
Sbjct: 243 STPETVSFWQLPSYIRSSE-SSGFATAGYRLQYHKLLARPFLLAAMVMLAASVSLRFFRF 301

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +V  G+ +GF+LY +  + +   K+ ++ P+AAA +PV +      + LL +EDG
Sbjct: 302 GGVQKMVLSGVGAGFLLYILSKVTEDLSKAELMHPLAAAWLPVFVGGLAGFMALLYQEDG 361


>gi|163735796|ref|ZP_02143225.1| permease YjgP/YjgQ family, putative [Roseobacter litoralis Och 149]
 gi|161390882|gb|EDQ15222.1| permease YjgP/YjgQ family, putative [Roseobacter litoralis Och 149]
          Length = 365

 Score =  322 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 86/366 (23%), Positives = 155/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + +    +   +    L+ ++DL +   +  +    S +    L     P  I
Sbjct: 2   ILHLYFARRFASWLMIAFIALFALIALVDLVDQTRRFADR-GVSAAGIFELVILNTPQTI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            QI+P I L+  +  F +L R+SEL+ +RA G S    L   V   I+LG      +NPI
Sbjct: 61  SQILPLIVLLATVAFFLSLARSSELIATRASGRSAMGALIAPVGVVIVLGTLATTTLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   +L Q ++  G      S    W++       + I A +  P+  +  D T 
Sbjct: 121 VAATSKKYNELSQTYRTGGGSTFSISTEGLWLRQGTDDGQMVIRAWRSNPDASVLFDVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR------IPIDKNSTTLNIPIKMD 235
           +  +     + R  AD A + +    L+ V ++   R         +  S T+   + ++
Sbjct: 181 LAYEVIGTPVRRIHADSAELKDGAWLLRNVKDWPLARGINSEGNATEHRSLTIPSSLTVE 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             ++     ++ S +E+   +   N++  F + +        +  PL LVAM LIA++ +
Sbjct: 241 RIRESFGHPSTISIWEMNDFIKQLNQAG-FSSLQHRVWLQSELARPLFLVAMVLIASAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF LY + +     G++G L    AA  P I ++ L+   L
Sbjct: 300 MRHTRFGGTGVAVLAAVLLGFALYFVRSFGLILGENGQLPVYLAAWAPPIASVLLAFGPL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHAEDG 365


>gi|170743204|ref|YP_001771859.1| permease YjgP/YjgQ family protein [Methylobacterium sp. 4-46]
 gi|168197478|gb|ACA19425.1| permease YjgP/YjgQ family protein [Methylobacterium sp. 4-46]
          Length = 362

 Score =  319 bits (817), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 92/358 (25%), Positives = 156/358 (43%), Gaps = 1/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RY    +L+      L    LV+ +D  E+  + GE P  S    A L+  R P + 
Sbjct: 6   TLGRYIAARFLRMIAGVFLTVFALVYTLDFVELMRRAGEAPGASALTVAHLSLLRTPAVA 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +QI+PF  L   +     L+R  ELV++RA GIS WQ L P V+ ++ +G   V   NP+
Sbjct: 66  EQIMPFAILFGAMGALLQLSRKLELVVARAAGISAWQFLQPGVLVAVGIGALMVGAYNPL 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           A S ++    +  +      K       W++  +      + A   +         T  T
Sbjct: 126 AASLKQRSTQVEARIFARSTKGGLSNDLWIRQRSVDGQAIVRASTAIEGTTSLAGVTIFT 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D +     + +A  A +++   +L+          P   ++  +   +     ++    
Sbjct: 186 FDAQGAFGQQIEARRATLHDGYWELQDARVLTQDSGPESYDTYLVASNLAPSQVRQRVTP 245

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             S  F+++ + ++ S ++ +    R   Q   L+  P++ VAM L+AASVSL F R   
Sbjct: 246 PDSVPFWQLSETIARSERAGL-DAARYRLQRAVLLARPMLFVAMVLVAASVSLRFFRFGG 304

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              +   G+ +GF LY    +M+  G SGI+    AA  P ++   L  L LL +EDG
Sbjct: 305 IGRMALAGVAAGFALYVARQVMEGLGASGIVAAPVAAWFPAVVGSLLGTLALLYQEDG 362


>gi|86138692|ref|ZP_01057265.1| permease, YjgP/YjgQ family protein [Roseobacter sp. MED193]
 gi|85824752|gb|EAQ44954.1| permease, YjgP/YjgQ family protein [Roseobacter sp. MED193]
          Length = 367

 Score =  319 bits (817), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 89/367 (24%), Positives = 155/367 (42%), Gaps = 12/367 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L  Y+ + +L+         M LV +IDLNE   +  E  + S S    L     P  + 
Sbjct: 3   LDLYYARRFLQWFAVICGVLMTLVMLIDLNEQIRRFDEF-DVSASEIVGLTLLNAPAALS 61

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           + +P I ++  IV+F  L R+SELV++RAIG S  + L   V+ + LLGI  V  +NPI 
Sbjct: 62  EFLPLIMILTTIVLFVGLARSSELVVTRAIGRSGIRALAAPVLVAGLLGILAVSTLNPIV 121

Query: 125 TSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILP--ENHIWEDFT 180
            +   +   L   ++  G    S      W++  +P     I A       +N +  D T
Sbjct: 122 AATTNLSKTLADTYRTGGPSALSFSGEGLWLRQGSPSGQSVIHASSYGGGSDNIVLYDVT 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNIPIKM 234
            +    +   I +  A+ A +  ++  L K   +         R      +  L   +  
Sbjct: 182 ILAYAPQGGPIRQIIAESARLDGEEWLLHKAKAWHMTAGLNPERSAATHETLRLPTTLTQ 241

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
           D  +         S Y++   +    ++  F   R +  +   +  PL L+AM L+ A+ 
Sbjct: 242 DRIRDRLGSADGISVYDLPTTIRDLAQAG-FSTKRYQVWYQVELARPLFLIAMVLVGAAF 300

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           ++  +R     + V   +  GF LY +    +  G++G +    AA  P + +I L++ +
Sbjct: 301 TMRHTRFGGTGLAVLTAVLLGFGLYFVRNFAQILGENGQIPVALAAWAPPVASILLTMGL 360

Query: 355 LLQKEDG 361
           LL  EDG
Sbjct: 361 LLHAEDG 367


>gi|254486546|ref|ZP_05099751.1| permease, YjgP/YjgQ family [Roseobacter sp. GAI101]
 gi|214043415|gb|EEB84053.1| permease, YjgP/YjgQ family [Roseobacter sp. GAI101]
          Length = 365

 Score =  318 bits (816), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 87/366 (23%), Positives = 155/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + ++   +        L+ ++D+ E   +  E  +    R   +     P  +
Sbjct: 2   ILHLYFARRFVTGFVLISAVLFALLILVDMVEQARKFAEH-DIGWQRLFGMTLLNTPETL 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  +V+F +L R+SELV++RA G S    L   V  + ++GI  V ++NPI
Sbjct: 61  NLILPLIMILATVVLFLSLARSSELVVTRASGRSALSALQAPVWVAFIIGIMAVGMLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K  I L +  +  G      SD   W++    Q    I A +   +  +  D T 
Sbjct: 121 VAATAKRYIQLSESIRAGGVSTLSISDEGLWLRQGGDQGQTVIRAWRSNADASVLYDVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYG------RIPIDKNSTTLNIPIKMD 235
           +T   +   I R +A  A + +D   L     +                + TL   + +D
Sbjct: 181 LTYAAQGGPIRRIEASSAALEDDGWVLTGAKSWPLELGVNAEGNAEVFETLTLPSTLTLD 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             ++        S Y++   +     +  F   R +      +  P  LVAM L+A++ +
Sbjct: 241 RIRESITDPGVVSIYDLPGFIHQLELAG-FSPRRHKVWLQTELARPFFLVAMVLVASAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF LY I +  +  G++G +  V AA  P + +I L+I +L
Sbjct: 300 MRHTRFGGTGVAVLASVLLGFGLYFIRSFAQILGENGQIPVVLAAWAPPVASILLAIGLL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHAEDG 365


>gi|298291095|ref|YP_003693034.1| permease YjgP/YjgQ family protein [Starkeya novella DSM 506]
 gi|296927606|gb|ADH88415.1| permease YjgP/YjgQ family protein [Starkeya novella DSM 506]
          Length = 361

 Score =  317 bits (813), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 98/364 (26%), Positives = 167/364 (45%), Gaps = 6/364 (1%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L  YF + +L   L   +G   L+ +IDL E+  ++GE  +       +L   R+
Sbjct: 1   MIGRTLGVYFGRRFLGAVLGIFVGCAGLIMLIDLLELSRRVGER-DVDFGTLMLLVVYRM 59

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P   +Q++PF  L   I  F  L+R  ELV++RA GIS WQ + P  + ++LLG+F+  V
Sbjct: 60  PFFTEQLLPFAVLFGAIGTFLTLSRRLELVVARAAGISAWQFIAPACLLALLLGVFSTTV 119

Query: 120 INPIATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWE 177
            NP++   +     L  +   +  G    +    WM+  +      I A           
Sbjct: 120 YNPVSADFKDRASRLEAEIFNRQTGLFAMTTGGFWMRQQSVDGQAIIQAAATSDGGRQLT 179

Query: 178 DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGF 237
                     +K+  R +A  AI+     +L+       G    + ++  L   +  +  
Sbjct: 180 GVNVFLFGADDKLTERIEAVRAILEPGAWRLEHARVLTPGIGLQEYDAYMLATNLTPNQV 239

Query: 238 QKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLE 297
           Q+  +   +  F+++   +  + +   F   R   Q+  L+  P++L+AM LIAASVSL 
Sbjct: 240 QETLQS-DTVPFWQLPAAIDAATR-VGFGAERYRLQYQSLLARPMLLLAMVLIAASVSLR 297

Query: 298 FSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQ 357
             R       +  G+ +GF+LY    + +  G++GI+ PV AA  P ++   + ILILL 
Sbjct: 298 VFRFGGIGQTILGGVAAGFLLYVSTKLAEDLGEAGIVHPVIAAWFPAVVGALMGILILLH 357

Query: 358 KEDG 361
           +EDG
Sbjct: 358 REDG 361


>gi|259419234|ref|ZP_05743151.1| permease YjgP/YjgQ [Silicibacter sp. TrichCH4B]
 gi|259345456|gb|EEW57310.1| permease YjgP/YjgQ [Silicibacter sp. TrichCH4B]
          Length = 368

 Score =  316 bits (811), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 86/369 (23%), Positives = 152/369 (41%), Gaps = 13/369 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  Y+ K + +  L      M LV +IDL+E   +     +    +   L     P  +
Sbjct: 2   ILDLYYAKRFFQWFLVIAAVLMSLVMLIDLSEQFRRFDG-QDLQFGQLLELTLLNTPAAL 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            + +P I ++  IV++  + R+SELV++RA+G S  + L P VV +++LG   V  +NPI
Sbjct: 61  NEFLPLIMILTTIVLYVGMARSSELVVTRALGRSGIRALLPPVVVALILGGLAVSTLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK---QKSDIIPWMQISNPQQDIFIGAKKI--LPENHIWED 178
             +       L + ++  G       S    W++         I A       EN    D
Sbjct: 121 VAATTNRFDSLSESYRQTGGPAAVSLSGEGLWLRQGGQNGQSVIHAANYRGDAENLFLYD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNIPI 232
            + +T         R  A  A +  +   L+    +Q        R     +   L   +
Sbjct: 181 VSILTYTPDGGPTRRTIAAEARLDGEDWVLRDAKVWQLIVGVNPERSAKSYDELRLPTTL 240

Query: 233 KMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAA 292
             +  +         S YE+ + +   +++  F   R +      +  PL LVAM L+ A
Sbjct: 241 TNERIRDTLGYAEGISIYELPQTIKSLSEAG-FSTTRFQVWLQVELARPLFLVAMVLVGA 299

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSI 352
           + ++  +R     I V   +  GF LY +    +  G++G +  + AA  P + +I L++
Sbjct: 300 AFTMRHTRLGGTGIAVLTSVLLGFALYFVHNFARILGENGQIPILLAAWAPPVASILLTM 359

Query: 353 LILLQKEDG 361
            +LL  EDG
Sbjct: 360 GLLLHAEDG 368


>gi|288958014|ref|YP_003448355.1| hypothetical protein AZL_011730 [Azospirillum sp. B510]
 gi|288910322|dbj|BAI71811.1| hypothetical protein AZL_011730 [Azospirillum sp. B510]
          Length = 364

 Score =  315 bits (808), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 87/361 (24%), Positives = 170/361 (47%), Gaps = 3/361 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RY  + ++      ++  + +V ++D  E+  + G  P+ +      +A  ++P I
Sbjct: 5   PTLSRYIGRQFIFWFCLLMVILLAIVLLLDTVELLRRAGTKPHVTFGLVVEMALLKLPEI 64

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
            QQI PF+ L   +  F+ L R++ELV++RA+G+S WQ L P +  +  +G+  V ++NP
Sbjct: 65  GQQIFPFVILFAGMFTFWRLTRSAELVVARAVGVSAWQFLMPVMFAAAAIGVVKVTLVNP 124

Query: 123 IATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           +          L  ++    +     S    W++ +N  +  FI A+ + P      +  
Sbjct: 125 VGAVFIAKYDQLQDRYLKLQSSSLNISRSGLWLRQTNETEQFFIHAELVNPATFELSNVV 184

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
               D     + R DA  A++   K +L+  +  +  + P   +S T+   + M   ++ 
Sbjct: 185 VFLFDADQNYLARVDAPSAVLRERKWELQDAILNRAKKDPEKLDSYTIPTELDMATIEES 244

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
                + SF+E+ + +  + ++  F   R    +  L+  P + +AM L AA+ SL   R
Sbjct: 245 FAPPETISFWELPRFI-HTLETTGFPAVRHRLHYQSLLAQPFLFLAMVLFAAAFSLRLPR 303

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
                 +V  G+ +GF+L+ +  ++++FG S  +  + AA  P  +++ L I  LL  ED
Sbjct: 304 RGGTMAMVTGGVLTGFVLFVMTDVVRTFGMSETIPIIMAAWSPAGISLLLGIAALLHLED 363

Query: 361 G 361
           G
Sbjct: 364 G 364


>gi|89070357|ref|ZP_01157664.1| putative permease [Oceanicola granulosus HTCC2516]
 gi|89044004|gb|EAR50179.1| putative permease [Oceanicola granulosus HTCC2516]
          Length = 366

 Score =  315 bits (807), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 83/366 (22%), Positives = 152/366 (41%), Gaps = 9/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + YL + L       +L+  +DL E  N++ +      S    L     P  +
Sbjct: 2   ILHRYFARRYLTSFLTVSGLFFVLLGAMDLVEQANEVSDEAAARWSDVLALTLLNAPASL 61

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P + ++  I +F  L R+SELV++RA G S    L   V+   L+G   + V+NP+
Sbjct: 62  YEILPLLVILSTIALFLGLARSSELVVTRAAGRSALHALVAPVLVVALIGAVALAVLNPL 121

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K     +   +D G           W++   P+    I A +   +       T 
Sbjct: 122 VAATSKEYEARVSALEDRGASIVSVDAGGLWLRQGGPEGQSVIRAARANTDGTELSGVTF 181

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNS------TTLNIPIKMD 235
           IT  ++ +   R DA  A +     +L +   +  G   + + +        +   +   
Sbjct: 182 ITFAEEGRPSRRIDARRARLEAGVWRLVEAKSWPLGDAGVPEAAAEEHDVYEVATSLTAA 241

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +      +S   +E+ + +    ++  F   R +      +  P  LVAM LI A+ +
Sbjct: 242 QIRDSFGAPSSIPIWELPRFIDRL-QTAGFSARRHQVWLQTELAKPAFLVAMLLIGAAFT 300

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +   R  +  ++    I   F LY +    +  G++G +  + AA  P +  I+ S+ +L
Sbjct: 301 MRHQRGGRTGLMALVAILLSFGLYFLRNFAQILGENGQIPVLLAAWAPPLAGIAASVALL 360

Query: 356 LQKEDG 361
           L KEDG
Sbjct: 361 LHKEDG 366


>gi|126736392|ref|ZP_01752134.1| putative permease [Roseobacter sp. CCS2]
 gi|126714213|gb|EBA11082.1| putative permease [Roseobacter sp. CCS2]
          Length = 364

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 86/365 (23%), Positives = 155/365 (42%), Gaps = 9/365 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF   +L++ L   +   +++  +DL +   + G   + +     +L+   +P   
Sbjct: 2   ILHRYFASRFLRSFLGVGMVFFLIMLFVDLVDQLRRFGSK-DATFVDLLMLSLLNIPQAF 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  I +F +L+R+SE+V++RA G S    L   +  ++L+GIF V V+NPI
Sbjct: 61  YAILPLIMILATIALFLSLSRSSEMVVTRAAGRSALHSLLAPLTVALLVGIFAVGVMNPI 120

Query: 124 ATSGEKIGIDLIQQWK-DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
                K         + D+          W++  N      I A+    +  +  D T +
Sbjct: 121 VAGTSKEFEARSDALRGDSSVLSFGSSGLWLRQGNATGQTVIRAQSANLDGTLLTDVTFL 180

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL------NIPIKMDG 236
           T       I R  A  A +      L+    +Q   +   + S  L         +  D 
Sbjct: 181 TFAPDGNPITRISAASAELTTGAWVLRDAKSWQLAGVTTPEASAQLDAERTVQSTLTPDQ 240

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            +      +S   +E+   +    ++  F   R    F+  + +P+ LV+M LI AS +L
Sbjct: 241 IRDSFGTPSSIPIWELPAFIDRL-QTAGFSAQRHLVWFHTELALPIFLVSMVLIGASFTL 299

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
              R  +  ++V + +   F+ Y I    +  G++G L  + AA  P    I +S+  LL
Sbjct: 300 RHQRGGRTGMMVMFAVLLAFVTYFIRNFAQVLGENGQLPVLLAAWAPPFAAIGISMGFLL 359

Query: 357 QKEDG 361
             EDG
Sbjct: 360 HHEDG 364


>gi|217978371|ref|YP_002362518.1| permease YjgP/YjgQ family protein [Methylocella silvestris BL2]
 gi|217503747|gb|ACK51156.1| permease YjgP/YjgQ family protein [Methylocella silvestris BL2]
          Length = 361

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 94/362 (25%), Positives = 174/362 (48%), Gaps = 2/362 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RYF   +L   L   +    +VFV+D  E+  +  +LP+ S    A+LA  R 
Sbjct: 1   MIGWTLGRYFSARFLTLILAVFVTICGMVFVVDFVEMLRRTTDLPDASPRSVALLAMLRA 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P   +Q++PF  L  ++  F +L R  EL+I+RA+G+S+W  L P +  +I++GI +V++
Sbjct: 61  PSASEQLMPFCVLCGSMAAFLDLTRKLELLIARAVGVSVWGFLVPPIAIAIVIGIGSVML 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
            NP++ + ++    +  +      +Q +D   W++  +   D  I A+ +  +       
Sbjct: 121 FNPVSAAMKQRADKIEVEIFGRLTQQNADADIWIRQKSVDGDAIIKARTMSRDGSRLTKP 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           T    D  +K     +A+ A + +   + ++      G   I+ +   L   +      +
Sbjct: 181 TVYIYDDHDKFEAEVEAEHAQLSDGVWRFEQARILMPGEETIETSVYLLASNLTPAQVAR 240

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
                 S +F+++      ++++ +  +   + QF  L+  PL+ VAM LIAA+ SL F 
Sbjct: 241 GPISPQSVAFWDLDAARRQTDRAGL-DSTAYKLQFQSLLARPLLFVAMVLIAAAFSLRFF 299

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R      +V  G+ +GF+LY    ++   G +G++    AA  P ++   L  L LL +E
Sbjct: 300 RFGGIEKMVGGGVAAGFVLYVATKLVGDLGGAGLVSAPVAAWSPAVIASMLGALALLNQE 359

Query: 360 DG 361
           DG
Sbjct: 360 DG 361


>gi|146277167|ref|YP_001167326.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555408|gb|ABP70021.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 364

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 77/365 (21%), Positives = 150/365 (41%), Gaps = 9/365 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RY  + +L+      L    L+ +ID+ +   +  +    ++ +  +L+  RVP  I
Sbjct: 2   ILSRYIARRFLRMVFIVFLVFFGLMMLIDVLDQMRRFSD-EGITLVQAGLLSLLRVPATI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  + +F  L RTSELV+ RA G S  + L   ++ ++ +G   V V+NPI
Sbjct: 61  YTILPLIVILAAVALFLGLARTSELVVVRAAGRSGLRFLVAPMIVALAIGAAAVTVLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
                +       +           S+   W++    +    I A +   +       T 
Sbjct: 121 VAGTSRQYDAAASRLARGEASILSISEEGLWLRQGGAEGQTVIHAARSNTDGTRLYAVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ-----YGRIPIDKNSTTLNIPIKMDG 236
           +T D       R  A+ A +     +L     +             + +  +   +  +G
Sbjct: 181 LTFDGNGLPRSRVAAEQAALETGYWQLSGAKSWDLTLANPEASANLEGNIRVPSDLTREG 240

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            Q      ++   +E+   ++   ++  F   +        + +P ML AM L+AA  ++
Sbjct: 241 IQDSFGDPSAIPIWELPAYVAGLERAG-FSARKHRVWMQMELALPFMLAAMVLVAAGFTM 299

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
             SR      +V   + SGF L+ +    +  G++G +  + AA  P ++ +  S+ +LL
Sbjct: 300 RHSRFGGTGRMVLLALLSGFGLFFLRNFAQVLGENGQIPILLAAWSPPLIGVMGSLGLLL 359

Query: 357 QKEDG 361
             EDG
Sbjct: 360 HLEDG 364


>gi|163759135|ref|ZP_02166221.1| putative permease [Hoeflea phototrophica DFL-43]
 gi|162283539|gb|EDQ33824.1| putative permease [Hoeflea phototrophica DFL-43]
          Length = 345

 Score =  313 bits (803), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 107/346 (30%), Positives = 181/346 (52%), Gaps = 2/346 (0%)

Query: 16  TTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVN 75
           T L + L  ++++ ++D NE   ++   P Y+++ G +++A RVP I+Q  IPF+ L+ +
Sbjct: 2   TFLTYCLAILVIILLVDFNESGRRLSAAPEYTVTTGLLVSALRVPTILQAAIPFVVLIAS 61

Query: 76  IVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLI 135
           I     LNR  ELV++RA GIS WQ L P V  ++L+G   V  +N  A S  +    +I
Sbjct: 62  IATLLQLNRKYELVVARAAGISAWQFLAPLVAANLLIGFIAVAGLNTFAASAMQWAETII 121

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKD 195
            + ++ G  Q SD  PW++    Q D  +GA+            T    D+   I  R +
Sbjct: 122 VE-RNLGSAQSSDSAPWLRQRTEQGDTVLGARASAAGGTRLSGATFFLFDEDQNIKERLE 180

Query: 196 ADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKK 255
           A+ A++ + +  L  V   +         S ++   +K +   +      +  F+E+  K
Sbjct: 181 AETAVLGDGEWVLTNVRRIRGSEPVEQVESASVPTSLKAEFVGESLTSPDTVPFFELRDK 240

Query: 256 MSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSG 315
           ++ + KS        E QF+ L+  P +L AMTLIAA VSL+F R  Q   ++  GI +G
Sbjct: 241 IAVA-KSFGLSATSYEMQFHRLVAQPALLAAMTLIAAIVSLKFVRFGQSLTVILGGILAG 299

Query: 316 FMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           F+LY +  ++++F  +G + P+ AA +PV++  +L   +LL KEDG
Sbjct: 300 FVLYVVSELIQAFANAGTIPPIVAAWLPVLVASALGTTVLLHKEDG 345


>gi|330993928|ref|ZP_08317858.1| Lipopolysaccharide export system permease protein lptG
           [Gluconacetobacter sp. SXCC-1]
 gi|329758874|gb|EGG75388.1| Lipopolysaccharide export system permease protein lptG
           [Gluconacetobacter sp. SXCC-1]
          Length = 371

 Score =  313 bits (802), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 84/367 (22%), Positives = 166/367 (45%), Gaps = 10/367 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y  + +   TL  +     L+ + D  ++  ++   PN   S  + +A   +P   
Sbjct: 6   TLSLYIARQFTGATLAVIAFLTGLITMFDFIDLLRRVSTRPNVPTSLVSQIAFLHIPFAC 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+PF  L+  I+ F+ L R+SELV++RA GIS WQ L   V+ ++L+G      ++P+
Sbjct: 66  LEILPFGVLLGGILCFWRLARSSELVVARAAGISAWQFLAGPVICAVLIGAMATTCVSPL 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQK---SDIIPWMQISN----PQQDIFIGAKKILPENHIW 176
           ++   +    L +Q+  + + +    S    W++  +          I A+++     + 
Sbjct: 126 SSVMYRRAEALDRQYLRDNNGKSLNLSGGTLWLRQGDNGLVDHGVDIIHARQVRLNGGVL 185

Query: 177 E--DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
                T   +   + ++ R +A    +   +  L+     +   +P D    TL+  + +
Sbjct: 186 HIGGITIFRLGPDDGLLTRIEAQSGYLGGGRWILEGARMLRPDEMPSDMGRFTLHADLTL 245

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
            G ++      + S + +   +   N+S  F   R    F  L+ +P++   M L+AA  
Sbjct: 246 AGVEESFASPDTLSVWALPGFIRQLNRSG-FSTIRHRLHFQSLLTLPVLSGTMALVAAGF 304

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           S+  +R      +++ G+ +GF L+ +  I   FG++G L PV AA  P    + L++ +
Sbjct: 305 SMRPARRGGVIRMISSGVAAGFALFALSKIAAQFGETGTLPPVLAAWAPTGAGLCLAVTL 364

Query: 355 LLQKEDG 361
           LL  EDG
Sbjct: 365 LLHLEDG 371


>gi|110680307|ref|YP_683314.1| YjgP/YjgQ family permease [Roseobacter denitrificans OCh 114]
 gi|109456423|gb|ABG32628.1| permease YjgP/YjgQ family, putative [Roseobacter denitrificans OCh
           114]
          Length = 365

 Score =  312 bits (801), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 88/366 (24%), Positives = 156/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + +    L   +    L+ ++DL +   +  +    S +    L     P  I
Sbjct: 2   ILHLYFARRFASWLLIAFIALSALIALVDLVDQTRRFADR-GVSATGIFELVILNTPQTI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            QI+P I L+  +  F +L R+SEL+ +RA G S    L   V   ILLG      +NPI
Sbjct: 61  SQILPLIVLLATVAFFLSLARSSELIATRASGRSAMGALVAPVSVVILLGTLATTTLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   +L Q ++  G      S    W++ +     + I A +  P+  +  D T 
Sbjct: 121 VAATSKKYNELSQIYRTGGVSTLSISTEGLWLRQATDDGQMVIRAWRSNPDASVLFDVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR------IPIDKNSTTLNIPIKMD 235
           +  +     + R  AD A + +    L+ V ++   R         +  S T+   + ++
Sbjct: 181 LAYEVIGTPVRRIHADSAELKDGAWLLRNVKDWPLARGINSEGNATEHRSLTIPSSLTVE 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             ++     ++ S +E+   +   N++  F + +        +  PL LVAM LIA++ +
Sbjct: 241 RIRESFGHPSTISIWEMTDFIKQLNQAG-FSSLQHRVWLQSELARPLFLVAMVLIASAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF LY + +     G++G L    AA  P I ++ L+   L
Sbjct: 300 MRHTRFGGTGVAVLAAVLLGFALYFVRSFGLILGENGQLPVYLAAWAPPIASVLLAFGPL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHAEDG 365


>gi|218679276|ref|ZP_03527173.1| permease YjgP/YjgQ family protein [Rhizobium etli CIAT 894]
          Length = 312

 Score =  312 bits (799), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 123/312 (39%), Positives = 187/312 (59%), Gaps = 2/312 (0%)

Query: 51  GAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSI 110
           G ++ A R+PLI+QQ +PFI L V + V   LNR  ELV++RA GIS+WQ ++PF+ GS+
Sbjct: 2   GILMTAVRLPLILQQTVPFIALFVGMTVLIGLNRKYELVVTRAAGISVWQFMSPFIAGSL 61

Query: 111 LLGIFTVLVINPIATSGEKIGIDLIQQWKD-NGDKQKSDIIPWMQISNPQQDIFIGAKKI 169
           LLGI T+  +NP+A  G++  + +   W+  N   +K+  IPW++  + + D+ IGA  +
Sbjct: 62  LLGILTMTALNPLAAWGQRQALLVESDWRGENAVLRKAPQIPWLRQISGRDDVIIGAHTV 121

Query: 170 LPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLN 229
                   D   I  D   ++I R+DA  A + +   +L  VVE + G IP+ K S  L 
Sbjct: 122 QENGTKLIDAVLIHFDSSGQVILRQDAATAKLEDGYWQLNNVVERKPGEIPVRKASVQLR 181

Query: 230 IPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTL 289
             +K D  Q+      +  F+++  +++ + KS        ETQF  L+  PL+LVAMT 
Sbjct: 182 TNLKQDFVQERLTAPETIGFFDLSNRIA-AAKSFGISTKALETQFNSLLSQPLLLVAMTF 240

Query: 290 IAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTIS 349
           IAA+VSL+FSR NQ R ++  GI SGF+LY I  ++K+FG SG++ P  A  IPV++ ++
Sbjct: 241 IAATVSLKFSRFNQSRSVILGGILSGFVLYVITVLVKAFGSSGVVPPFVATWIPVVVALA 300

Query: 350 LSILILLQKEDG 361
           L   ILL +EDG
Sbjct: 301 LGATILLHREDG 312


>gi|83942393|ref|ZP_00954854.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. EE-36]
 gi|83846486|gb|EAP84362.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. EE-36]
          Length = 365

 Score =  311 bits (798), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 79/366 (21%), Positives = 154/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + ++   +        L+ ++D+ +   +     +    R   +     P  +
Sbjct: 2   ILHLYFARRFIMGFILISAVLFSLLVLVDMVDQARRFSSY-DIGWLRLFGMTLLNTPETM 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  +V+F +L R+SELV++RA G S    L   +  + ++G+  V ++NPI
Sbjct: 61  NLILPLIMILATVVLFLSLARSSELVVTRAAGRSALSALQAPIWVAFIIGVMAVGMLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K  I L    +  G      SD   W++  + +    I A +   +  +  D T 
Sbjct: 121 VAATAKRYIQLSDSIRAGGTSVLSVSDEGLWLRQGSDEGQTVIRAWRSNKDASVLYDVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYG------RIPIDKNSTTLNIPIKMD 235
           ++   +     R +AD A + N    L     +               ++ TL   + +D
Sbjct: 181 LSYAPEGGPARRIEADSAALENGIWTLTDAKSWPLEVGVNAEGAAETFDTLTLPSTLTLD 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +       + S Y++   +     +  F   R +      +  P  LVAM L+A++ +
Sbjct: 241 RIRDSITDPGAVSIYDLPDYIKQLELAG-FSPRRHKVWLQTELARPFFLVAMVLVASAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF LY I +  +  G++G +  + AA  P + +I L++ +L
Sbjct: 300 MRHTRFGGTGVAVLASVLMGFGLYFIRSFAQILGENGQIPVLLAAWAPPVASILLALGLL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHSEDG 365


>gi|114704780|ref|ZP_01437688.1| hypothetical protein FP2506_07586 [Fulvimarina pelagi HTCC2506]
 gi|114539565|gb|EAU42685.1| hypothetical protein FP2506_07586 [Fulvimarina pelagi HTCC2506]
          Length = 360

 Score =  311 bits (798), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 101/358 (28%), Positives = 177/358 (49%), Gaps = 2/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RYFF+ YL      ++    LV +IDL E+  +   L + S+    + +A RVP  +
Sbjct: 5   TLNRYFFRLYLVNFFSTVVAVSALVLLIDLVELGRR-SVLADQSLGVLLLFSALRVPAFM 63

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           +Q  PFI L  +I    +LNR  ELV++RA G+S WQ+L PF+ GS+ LG+      NP+
Sbjct: 64  EQAFPFIILFSSIFTLISLNRRLELVVARAAGVSAWQILMPFIAGSLFLGLLATFAYNPL 123

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           +   +    ++    +       +   PW++ +       +GA ++     +  + ++  
Sbjct: 124 SAYTKAQAANIESAAEGREVASSALQTPWLRQNADGVRSIMGATQVAENGRVLSNVSAFV 183

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
           +     +  R DA  A + N +  L +    + G  P D     L   ++ +  ++    
Sbjct: 184 MADDGSVETRIDAPRAELGNQEWILLRPRVTRIGYTPRDLVEYRLPTSLRPEYIEQRLAD 243

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             + S +E+  K+  +  S  F++     Q++ LI  P + VAMTL+AA+V+  FSR+ Q
Sbjct: 244 PETISIWELGSKIDVAA-SLGFNSMAFSMQYHTLIAQPALFVAMTLLAATVATRFSRTGQ 302

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           P  I   G+ +GF+LY +  + K+ G + ++ P+ AA  PV+      + ILL +EDG
Sbjct: 303 PGRIFVGGVLAGFVLYVVTFLAKALGSNDVVPPIVAAWFPVLAAGLFGVTILLHQEDG 360


>gi|296116657|ref|ZP_06835267.1| permease YjgP/YjgQ family protein [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976869|gb|EFG83637.1| permease YjgP/YjgQ family protein [Gluconacetobacter hansenii ATCC
           23769]
          Length = 371

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 92/367 (25%), Positives = 171/367 (46%), Gaps = 10/367 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y  + +    L  +     L+ + D  ++  ++   PN   S  + +A   +P  +
Sbjct: 6   TLSLYIARQFTYAVLAVIAFLTGLITLFDFIDLLRRVSSRPNVPASLVSEIAVLHIPFAM 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+PF  L+  I+ F+ L R+SELV++RA GIS WQ L   V  ++L+G  +  VI+P+
Sbjct: 66  LEILPFGVLLGGIICFWRLARSSELVVARAAGISAWQFLAGPVGCALLIGALSTTVISPL 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQK---SDIIPWMQISN----PQQDIFIGAKKILPENHIW 176
           +++  +    L QQ+      +    S    WM+ S+          I A+++   +++ 
Sbjct: 126 SSAMYRRAEILDQQYLRESTVKTINMSGGALWMRQSDSGLVDHGVAIIHARRVRLRDNVM 185

Query: 177 E--DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKM 234
                +   +D ++ ++ R +A    + N +  L+          P+D    TL   + +
Sbjct: 186 RISGISIFRLDGQDHMLARIEAGHGYLGNGRWVLEGARLLHPDENPVDMGHMTLRADLTL 245

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
            G Q       + S + +   +   N+S  F + R   +F  L+ +P++   M L+AA  
Sbjct: 246 AGVQDSLASPNTLSVWALPGFIKLLNRSG-FSSIRHRLRFQSLLTLPVLCGTMALVAAGF 304

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           S+  +R      +++ G+ +GF L+ I  I   FG+SG L PV AA  P    + L++ +
Sbjct: 305 SMRPARRGGVVRMISLGVGAGFALFAISKIAAQFGESGALPPVLAAWAPTGAGLCLAVSL 364

Query: 355 LLQKEDG 361
           LL  EDG
Sbjct: 365 LLHLEDG 371


>gi|300023218|ref|YP_003755829.1| permease YjgP/YjgQ family protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525039|gb|ADJ23508.1| permease YjgP/YjgQ family protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 364

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 95/360 (26%), Positives = 168/360 (46%), Gaps = 3/360 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RY  + ++   +  L    +L+F+ID  E+    G+      +    +A  R+P  I
Sbjct: 6   TLTRYIARMFIVAIVTTLTVCALLIFMIDFVELLRMAGKYGAVPGTTLLRIALLRLPAYI 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           + +I F  LV +I     LNR SEL + RA G+S+WQ L P +   + +GIF + V NP+
Sbjct: 66  EFLIGFAVLVGSISALIYLNRKSELAVMRAGGMSVWQFLGPGLFVGLAVGIFAMAVFNPL 125

Query: 124 ATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           A+ G      L  +   N     +      W++ +    +  +GA     +         
Sbjct: 126 ASRGRATSEKLYAKAFGNEANLLRAQGGGSWIRQNGADGESVLGAAAASNQGLTLTGVLV 185

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              D++     R DA  A + +   +L+     + G+ P    S  L+  +  D  Q   
Sbjct: 186 FAYDREGHFSERIDAGSAELKDGYWELQDAWVTRLGQEPEKFKSYLLSTYLTPDRVQDAL 245

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
               S SF+++ + +  ++K+ +    R   Q+  L+V P++ +AM L+AA+VSL   RS
Sbjct: 246 GTVFSISFWDLPELIQAADKAKL-STERLRVQYQSLLVRPMLCLAMVLLAATVSLRSFRS 304

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              + +VA G+  G   + +  I +  G +G+     AA +PV+L +++S  +LL +EDG
Sbjct: 305 GGIQTMVATGMIGGVGFFLLSEIARQIGIAGLAPAWVAAWMPVVLVLAISTTVLLHQEDG 364


>gi|254460215|ref|ZP_05073631.1| permease, YjgP/YjgQ family [Rhodobacterales bacterium HTCC2083]
 gi|206676804|gb|EDZ41291.1| permease, YjgP/YjgQ family [Rhodobacteraceae bacterium HTCC2083]
          Length = 365

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 89/366 (24%), Positives = 157/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + + +  L  LL  +  + +IDL E   +  +  + S S    L     P  I
Sbjct: 2   ILHFYFARRFFRVFLTTLLIFLAFLTLIDLVEQMRRF-DSKDVSFSDIVFLTLFNAPGAI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            QI+P + ++  + +F  L RTSELV++R+ G S    L   +  + ++GI TV + NPI
Sbjct: 61  YQILPLVMILSAVSLFLTLARTSELVVTRSAGRSALVTLASPMCVAAVIGITTVTLFNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             S  +  I L Q++K       S      W++  +      I A     +     D   
Sbjct: 121 VASTTRQYITLEQEYKSQKKNTVSIGRDGLWLRQGDENGQTVIHALSTSDDMRTLFDARF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYG------RIPIDKNSTTLNIPIKMD 235
           +  +  ++   R  AD A + N   +L +   +             + +   L   + ++
Sbjct: 181 LQYNTDSQPKTRIIADEARLTNTGWQLIRAKHWSLDTSGNPEETAREIDVLMLPTTLTIE 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +    + A+ S +E+   +    ++  F   R +         PL L+AM L+ AS +
Sbjct: 241 NIRDSFSEPAAISIWEMDAYIEGLEEAG-FSTRRHKVWQQMEFARPLFLMAMVLVGASFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R  +  + V   I  GF LY +    +  G++G L  + AA  P I +I L++ +L
Sbjct: 300 MRHTRFGKAGVAVLAAIMMGFGLYYVRNFAQILGENGQLPTMIAAWTPPIASILLALGLL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHMEDG 365


>gi|126462313|ref|YP_001043427.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103977|gb|ABN76655.1| permease YjgP/YjgQ family protein [Rhodobacter sphaeroides ATCC
           17029]
          Length = 364

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 78/365 (21%), Positives = 150/365 (41%), Gaps = 9/365 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RY  + +L+      L    L+ +ID+ +   +  +    ++ +  +L+  RVP  +
Sbjct: 2   ILSRYIARRFLRMVFIVFLAFFGLMMLIDVLDQMRRFSD-EGITLVQAGLLSLLRVPATL 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  + +F  L R+SELV+ RA G S  + L   +V ++ LG   V V+NPI
Sbjct: 61  YTILPLIVILAAVALFLGLARSSELVVVRAAGRSGLRFLVAPMVVALALGTVAVTVLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
                +       +           S    W++     +   I A +   +       T 
Sbjct: 121 VAGTSRQYDAAAGRLARGEASILSISKEGLWLRQGGSGEQTVIHALRSNTDGTRLYAVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI-PIDKNSTTLNIP----IKMDG 236
           +T D + +   R  A+ A +     +L     +      P  + S   N+     +  +G
Sbjct: 181 LTFDAEGRPTGRIAAEQAALERGYWQLSGAKSWDLTEANPEARASLPGNLRVTSELTREG 240

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            Q      ++   +E+   ++   ++  F   +          +P  L AM L+AA  ++
Sbjct: 241 IQDSFGDPSAIPIWELPAYVAGLERAG-FSARKHRVWMQMEFALPATLAAMVLVAAGFTM 299

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
             SR      +V   +  GF L+ +    +  G++G +  + AA  P ++ +  S+ +LL
Sbjct: 300 RHSRFGGTGRMVLLALLGGFSLFFLRNFAQVLGENGQIPILLAAWSPPLIGVMGSLGLLL 359

Query: 357 QKEDG 361
             EDG
Sbjct: 360 HLEDG 364


>gi|77463458|ref|YP_352962.1| putative permease [Rhodobacter sphaeroides 2.4.1]
 gi|221639316|ref|YP_002525578.1| permease Yjgp/YjgQ family protein [Rhodobacter sphaeroides KD131]
 gi|332558335|ref|ZP_08412657.1| Permease YjgP/YjgQ family protein precursor [Rhodobacter
           sphaeroides WS8N]
 gi|77387876|gb|ABA79061.1| putative permease [Rhodobacter sphaeroides 2.4.1]
 gi|221160097|gb|ACM01077.1| Permease YjgP/YjgQ family protein precursor [Rhodobacter
           sphaeroides KD131]
 gi|332276047|gb|EGJ21362.1| Permease YjgP/YjgQ family protein precursor [Rhodobacter
           sphaeroides WS8N]
          Length = 364

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 75/365 (20%), Positives = 148/365 (40%), Gaps = 9/365 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RY  + +L+      L    L+ +ID+ +   +  +    ++ +  +L+  RVP  +
Sbjct: 2   ILSRYIARRFLRMVFIVFLAFFGLMMLIDVLDQMRRFSD-EGITLVQAGLLSLLRVPATL 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  + +F  L R+SELV+ RA G S  + L   +V ++ LG   V V+NPI
Sbjct: 61  YTILPLIVILAAVALFLGLARSSELVVVRAAGRSGLRFLVAPMVVALALGTVAVTVLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
                +       +           S    W++     +   I A +   +       T 
Sbjct: 121 VAGTSRQYDAAAGRLARGEASILSISKEGLWLRQGGSGEQTVIHALRSNTDGTRLYAVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPID-----KNSTTLNIPIKMDG 236
           +T D + +   R  A+ A +     +L     +       +       +  +   +  +G
Sbjct: 181 LTFDAEGRPTGRIAAEQAALERGYWQLSGAKSWDLTEANPEARAGLPGNLRVTSELTREG 240

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            Q      ++   +E+   ++   ++  F   +          +P  L AM L+AA  ++
Sbjct: 241 IQDSFGDPSAIPIWELPAYVAGLERAG-FSARKHRVWMQMEFALPATLAAMVLVAAGFTM 299

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
             SR      +V   +  GF L+ +    +  G++G +  + AA  P ++ +  S+ +LL
Sbjct: 300 RHSRFGGTGRMVLLALLGGFSLFFLRNFAQVLGENGQIPILLAAWSPPLIGVMGSLGLLL 359

Query: 357 QKEDG 361
             EDG
Sbjct: 360 HLEDG 364


>gi|83953613|ref|ZP_00962334.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. NAS-14.1]
 gi|83841558|gb|EAP80727.1| permease, YjgP/YjgQ family protein [Sulfitobacter sp. NAS-14.1]
          Length = 365

 Score =  310 bits (795), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 78/366 (21%), Positives = 156/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + ++   +        L+ ++D+ +   +     +    R   +   + P  +
Sbjct: 2   ILHLYFARRFIMGFILISAVLFSLLVLVDMVDQARRFSSY-DIGWLRLFGMTLLKTPETM 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  +V+F +L R+SELV++RA G S    L   +  + ++G+  V ++NPI
Sbjct: 61  NLILPLIMILATVVLFLSLARSSELVVTRAAGRSALSALQAPIWVAFIIGVMAVGMLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K  I L    +  G      SD   W++  + +    I A +   +  +  D T 
Sbjct: 121 VAATAKRYIQLSDSIRAGGTSVLSVSDEGLWLRQGSDEGQTVIRAWRSNKDASVLYDVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYG------RIPIDKNSTTLNIPIKMD 235
           ++   ++    R +AD A + +    L     +               ++ TL   + +D
Sbjct: 181 LSYAPESGPARRIEADSAALEDGIWTLTDAKSWPLEVGVNAEGAAETFDTLTLPSTLTLD 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +       + S Y++   +     +  F   R +      +  P  LVAM L+A++ +
Sbjct: 241 RIRDSITDPGAVSIYDLPDYIKQLELAG-FSPRRHKVWLQTELARPFFLVAMVLVASAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF LY I +  +  G++G +  + AA  P + +I L++ +L
Sbjct: 300 MRHTRFGGTGVAVLASVLMGFGLYFIRSFAQILGENGQIPVLLAAWAPPVASILLALGLL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHSEDG 365


>gi|188583149|ref|YP_001926594.1| permease YjgP/YjgQ family protein [Methylobacterium populi BJ001]
 gi|179346647|gb|ACB82059.1| permease YjgP/YjgQ family protein [Methylobacterium populi BJ001]
          Length = 362

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 87/358 (24%), Positives = 159/358 (44%), Gaps = 1/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RYF   +++T L   L    LV+ +D  E+  + G+    S    A LA  R P + 
Sbjct: 6   TLGRYFAWRFVRTILGVFLTVFALVYTLDFVELLRRAGDSEGASTGLMAQLALYRTPAVA 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           + ++PF  L  ++     L+R  ELV++RA GIS WQ L P    ++ +G   +   NP+
Sbjct: 66  ESVLPFAVLFGSMAALLQLSRKLELVVARAAGISAWQFLQPGAFVALAIGALAIGAYNPL 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           + + ++   ++  +      K  +    W++  +      I A+  +         T   
Sbjct: 126 SAALKQRSSEIEAKIFAKSTKAGTGKDLWLRQRSVDGQAIIRAETAVEGTTTLAGVTVFQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D       + +A  A +++   +L+ V        P       +   +     ++    
Sbjct: 186 FDDAGVFTAQIEAARATLHDGWWELRDVRVLTRDEPPESHEVYLVASTLDPSQIRQRFTP 245

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             S  F+++ + ++   ++ +    R   Q+  L+  PL+ +AM L+AA+VSL F R   
Sbjct: 246 PESVPFWQLPETIARHERAGL-DATRYRLQYDVLLATPLLYLAMVLVAATVSLRFFRFGG 304

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              +V  G+ +GF+LY    +M+  G SG++ P  AA  P ++   L  L LL +EDG
Sbjct: 305 VGKLVLGGVSAGFVLYVARQVMEGLGASGMVAPTVAAWFPAVVGSLLGTLTLLYQEDG 362


>gi|258542096|ref|YP_003187529.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-01]
 gi|256633174|dbj|BAH99149.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-01]
 gi|256636231|dbj|BAI02200.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-03]
 gi|256639286|dbj|BAI05248.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-07]
 gi|256642340|dbj|BAI08295.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-22]
 gi|256645395|dbj|BAI11343.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-26]
 gi|256648450|dbj|BAI14391.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-32]
 gi|256651503|dbj|BAI17437.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654494|dbj|BAI20421.1| transporter YjgP/YjgQ [Acetobacter pasteurianus IFO 3283-12]
          Length = 370

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 87/366 (23%), Positives = 172/366 (46%), Gaps = 9/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RY  + ++ + +  +     +V + D  ++  ++   P+ S +    +AA  VP   
Sbjct: 6   TLSRYIARQFVFSVVAMIASLTGIVCLFDFIDLLRRVATKPDVSTNVVTEIAALHVPYFA 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+PF  L+  IV F+ L R+SEL+++RA GIS WQ L   V  ++L+G     +I+P+
Sbjct: 66  TEILPFGMLLGGIVCFWRLTRSSELIVARAAGISAWQFLTAPVACAMLIGAVFTTLISPV 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWM------QISNPQQDIFIGAKKILPENHIW- 176
           ++S  +   +L QQ+   G    S     +         +P     + A+ +  ++ +  
Sbjct: 126 SSSMYRRAEELDQQYLRTGGGPLSLSSGSLWLRQSDSQYDPHGVAMLHARGVQLKDGLLR 185

Query: 177 -EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
             + +   +D ++K++ R +A    +   K  L      +   +        L   + ++
Sbjct: 186 IRNVSVFRLDHQDKLMMRIEAPEGYLGTLKWILSDASVVRPNDLLHHVGQIDLPTDLTVN 245

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             Q+      + S + +   +S  ++S  F + R    F  L+ +P++   M L+AA  S
Sbjct: 246 RVQESFSSPETLSVWALPGFISLLDRSG-FSSIRHRIHFQSLLALPMLAGTMALVAAGFS 304

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  SR      ++  G+ +GF+L+T+  + + FG SG L P+ AA  P +  + L++ +L
Sbjct: 305 MRPSRRGGVARMIGSGVAAGFLLFTVSKVAEQFGNSGALPPMLAAWAPTLAGLCLAVSLL 364

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 365 LHLEDG 370


>gi|329114151|ref|ZP_08242913.1| Lipopolysaccharide export system permease protein LptG [Acetobacter
           pomorum DM001]
 gi|326696227|gb|EGE47906.1| Lipopolysaccharide export system permease protein LptG [Acetobacter
           pomorum DM001]
          Length = 370

 Score =  309 bits (792), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 87/366 (23%), Positives = 172/366 (46%), Gaps = 9/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RY  + ++ + +  +     +V + D  ++  ++   P+ S +    +AA  VP   
Sbjct: 6   TLSRYIARQFVFSVVAMIASLTGIVCLFDFIDLLRRVATKPDVSTNVVTEIAALHVPYFA 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+PF  L+  IV F+ L R+SEL+++RA GIS WQ L   V  ++L+G     +I+P+
Sbjct: 66  TEILPFGMLLGGIVCFWRLTRSSELIVARAAGISAWQFLTAPVACAMLIGALFTTLISPV 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWM------QISNPQQDIFIGAKKILPENHIW- 176
           ++S  +   +L QQ+   G    S     +         +P     + A+ +  ++ +  
Sbjct: 126 SSSMYRRAEELDQQYLRTGGGPLSLSSGSLWLRQSDSQYDPHGVAMLHARGVQLKDGLLR 185

Query: 177 -EDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
             + +   +D ++K++ R +A    +   K  L      +   +        L   + ++
Sbjct: 186 IRNVSVFRLDHQDKLMMRIEAPEGYLGTLKWILSDASVVRPNDLLHHVGQIDLPTDLTVN 245

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             Q+      + S + +   +S  ++S  F + R    F  L+ +P++   M L+AA  S
Sbjct: 246 RVQESFSSPETLSVWALPGFISLLDRSG-FSSIRHRIHFQSLLALPMLAGTMALVAAGFS 304

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  SR      ++  G+ +GF+L+T+  + + FG SG L P+ AA  P +  + L++ +L
Sbjct: 305 MRPSRRGGVARMIGSGVAAGFLLFTVSKVAEQFGNSGALPPMLAAWAPTLAGLCLAVSLL 364

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 365 LHLEDG 370


>gi|260466947|ref|ZP_05813129.1| permease YjgP/YjgQ family protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029244|gb|EEW30538.1| permease YjgP/YjgQ family protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 360

 Score =  308 bits (790), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 113/362 (31%), Positives = 193/362 (53%), Gaps = 3/362 (0%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           M   L RYFF  Y+  T++F LG + LVF+ID  E+  +   LP ++      ++  R+P
Sbjct: 1   MGWTLGRYFFFRYVAITIWFFLGLLALVFLIDFTELSGRTTGLPGFTYGTAMAISGLRMP 60

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +I+ Q +PF+ L   +    +LNR  ELVI+R+ G+S WQ L P  +G++L G+ +V +I
Sbjct: 61  MIMLQTVPFVGLFSAMATLVSLNRRYELVIARSAGVSAWQFLLPCCIGALLFGVVSVGII 120

Query: 121 NPIATSGEKIGIDLIQQWKDN-GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
           NP+A     +   +  Q +    +   +D  PW++      D  IGA+ IL +     D 
Sbjct: 121 NPLAAHAFSLSEQIETQLRSGKSNTVSADAAPWIRQKTSSGDTIIGARAILNQGLEMSDA 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
               +D++  I  RKDA  A + +   +L+ V  ++ G I     +  +   +K +  Q+
Sbjct: 181 VFFILDQQGNIAERKDAVRAYLRDGYWELQDVKTFRNGVI-QSAANDRVPTNLKPEFVQE 239

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
              +  +  FY++  K+  + +S          QF  L+ +P +LVAMTLIAA+VS+ F+
Sbjct: 240 RLARPETIPFYDLPGKIEVA-RSFGLKANAFAMQFDSLVALPFLLVAMTLIAATVSMRFA 298

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R  Q   ++  G+ +GF+LY +  ++K+FG +G +    AA +PV++ +   +  LL KE
Sbjct: 299 RMGQSATMILGGVVAGFLLYVVSVLVKAFGVAGFVPTAVAAWVPVVVAMFFGVTFLLYKE 358

Query: 360 DG 361
           DG
Sbjct: 359 DG 360


>gi|162149096|ref|YP_001603557.1| hypothetical protein GDI_3326 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545161|ref|YP_002277390.1| permease YjgP/YjgQ family protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787673|emb|CAP57269.1| putative membrane protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532838|gb|ACI52775.1| permease YjgP/YjgQ family protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 369

 Score =  308 bits (789), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 82/365 (22%), Positives = 165/365 (45%), Gaps = 8/365 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y  + +    +  +L    LV + D  ++  ++   P+   S  + +A   VP  +
Sbjct: 6   TLSFYIARQFTLAVMAMILSLTGLVSLFDFIDLLRRVATRPDVPTSLASEIALLHVPYFM 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+PF  L+  IV F+ L R+SEL+++RA GIS WQ L   +  ++L+GI     ++P+
Sbjct: 66  IEILPFGVLLGGIVCFWRLTRSSELIVARAAGISAWQFLTGPLSCALLIGILATGALSPL 125

Query: 124 ATSGEKIGIDLIQQW-KDNGDKQKSDIIPWMQISN----PQQDIFIGAKKILPENHIWE- 177
           ++   +    L   + +  G    SD   W++ ++    P     + A+ +  +  +   
Sbjct: 126 SSIMYRQAETLDHVYLRSGGPLNLSDGALWLRQADSGLVPHGVAILHARSVHLQGGVLRI 185

Query: 178 -DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG 236
              +   +D  + +I R +A    +       +     +  R+P+      +   + +  
Sbjct: 186 GGISLFRLDDTDHLIVRIEAPEGYLGRKVWIFQDARTIRPDRLPVPAGRFVMPTDLTVPR 245

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            Q+      + S + +   ++   +S  F + R    F  L+ +P++   M L+AA  S+
Sbjct: 246 VQESFASPDTLSVWALPGFIALLERSG-FSSIRHRLHFQTLLTLPILAGTMALVAAGFSM 304

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
             +R      ++  G+ +GF L+TI  +   FG+SG + P+ AA  P    + L++ +LL
Sbjct: 305 RPTRRGGVARMIGSGVAAGFALFTISKVAAQFGESGAMPPLLAAWAPTGAGLCLAVSLLL 364

Query: 357 QKEDG 361
             EDG
Sbjct: 365 HLEDG 369


>gi|254477617|ref|ZP_05091003.1| permease YjgP/YjgQ [Ruegeria sp. R11]
 gi|214031860|gb|EEB72695.1| permease YjgP/YjgQ [Ruegeria sp. R11]
          Length = 367

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 81/368 (22%), Positives = 150/368 (40%), Gaps = 12/368 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y+ + +L+         + LV +IDLNE   +  +  + S  +   L     P  +
Sbjct: 2   TLDFYYARRFLQWFAVICAVLLTLVMLIDLNEQIRRF-DAQDLSFGQLFGLTLLNAPAAL 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            + +P I ++  IV+F  L R+SELV++RAIG S  + L   VV +  +G+  V  +NPI
Sbjct: 61  SEFLPLIMILTTIVLFVGLARSSELVVTRAIGRSGIRALAAPVVLAAFIGLLAVSTLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPE--NHIWEDF 179
             +      DL + +++ G      +    W++    Q    I AK    +  +      
Sbjct: 121 VAATSNHYRDLAETYRNGGPAALSLTGEGLWLRQGGAQGQSVIHAKGYSGDVEDVTLLGV 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNIPIK 233
           T ++   + + I +  A  A +      L     +             +  S  L+  + 
Sbjct: 181 TILSYGPEGRPIRQTVARSATLDGSDWVLTNAKVWPLVTGVNPETNATEHASLRLSTTLT 240

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
            +  +         S Y++   +    ++  F   R E      +  PL L+AM L+ A+
Sbjct: 241 SERIRDTLGTATGISVYDLPATIRELAEAG-FSTKRYEVWLQVELARPLFLIAMVLVGAA 299

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
            ++  +R     + V   +  GF LY +    +  G++G +    A   P +  I L++ 
Sbjct: 300 FTMRHARFGGTGLAVLMAVLLGFGLYFLRNFAQILGENGQIPVALAGWAPPVAAILLTMG 359

Query: 354 ILLQKEDG 361
           +LL  EDG
Sbjct: 360 LLLHAEDG 367


>gi|126725341|ref|ZP_01741183.1| putative permease [Rhodobacterales bacterium HTCC2150]
 gi|126704545|gb|EBA03636.1| putative permease [Rhodobacterales bacterium HTCC2150]
          Length = 365

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 81/366 (22%), Positives = 154/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  YF + ++   L  L     ++F+ID+ E   +        +   A LA    P  +
Sbjct: 2   ILHLYFARKFITNFLMILFVFFGIIFLIDMVEQLRRFSSNS-VGMKEAAQLALLNAPGNL 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P + ++  + +F NL RTSELVI+RA G S    L   ++ +  LG+F V V NPI
Sbjct: 61  YRILPLLVILSTLALFLNLTRTSELVIARASGRSALGALLAPLLVTFTLGVFGVSVWNPI 120

Query: 124 ATSGEKIGIDLIQQ--WKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +   +   +  +   + +          W++  N +    I A +      I  + T 
Sbjct: 121 GAATANLYETISDRHLGRASNALSIGAEGLWLRQGNVEGQTVIHANETNQNGTILGNVTF 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI------PIDKNSTTLNIPIKMD 235
           +  D  +++I+R +A  A +      L     + +             ++  L   +   
Sbjct: 181 LAFDINSQVIYRIEAKTAKLETGGWVLNDTKRWDFKDTLNPELSASTTDTIRLQSNLTQK 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             Q+     +   F+E+   ++    +  F + +    +   + +P  L+AM LI A  +
Sbjct: 241 EIQESFGAPSDIPFWELPAFIASLENAG-FSSTQHRVWYATELALPAFLMAMVLIGAMFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  SR  +  I++   I  GF L+ +    +  G SG +  + AA  P +  I L++  +
Sbjct: 300 MRHSRFGKTGIMLLGAIVMGFGLFFLKNFAQVLGNSGQIPVLLAAWTPPLAGILLALGFI 359

Query: 356 LQKEDG 361
           L  E+G
Sbjct: 360 LHTEEG 365


>gi|163853055|ref|YP_001641098.1| permease YjgP/YjgQ family protein [Methylobacterium extorquens PA1]
 gi|218531865|ref|YP_002422681.1| permease YjgP/YjgQ family protein [Methylobacterium
           chloromethanicum CM4]
 gi|240140388|ref|YP_002964867.1| putative permease [Methylobacterium extorquens AM1]
 gi|254562992|ref|YP_003070087.1| permease [Methylobacterium extorquens DM4]
 gi|163664660|gb|ABY32027.1| permease YjgP/YjgQ family protein [Methylobacterium extorquens PA1]
 gi|218524168|gb|ACK84753.1| permease YjgP/YjgQ family protein [Methylobacterium
           chloromethanicum CM4]
 gi|240010364|gb|ACS41590.1| putative permease [Methylobacterium extorquens AM1]
 gi|254270270|emb|CAX26266.1| putative permease [Methylobacterium extorquens DM4]
          Length = 362

 Score =  306 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 87/358 (24%), Positives = 160/358 (44%), Gaps = 1/358 (0%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RYF   +++T L   L    LV+ +D  E+  + G+    S    A LA  R P + 
Sbjct: 6   TLGRYFAWRFVRTILGVFLTVFALVYTLDFVELLRRAGDAEGASPGLMAQLALYRTPAVA 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
           + ++PF  L  ++     L+R  ELV++RA GIS WQ L P    ++ +G   +   NP+
Sbjct: 66  ESVLPFAVLFGSMAALLQLSRKLELVVARAAGISAWQFLQPGAFVALAIGALAIGAYNPL 125

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSIT 183
           + + ++   ++  +      K  +    W++  +      I A+  +         T   
Sbjct: 126 SAALKQRSSEIEAKIFAKSTKAGTGKDLWLRQRSIDGQAIIRAETAVEGTTTLAGVTVFQ 185

Query: 184 IDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQ 243
            D+      + +A  A +++   +L+ V        P       +   +     ++    
Sbjct: 186 FDEAGAFAAQLEAARATLHDGWWELRDVRVLTRDEPPESHEVYLVASTLDPSQIRQRFTP 245

Query: 244 FASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQ 303
             S  F+++ + ++   ++ +    R   Q+  L+  PL+ +AM L+AA+VSL F R   
Sbjct: 246 PESVPFWQLPETIARHERAGL-DATRYRLQYDVLLATPLLYLAMVLVAATVSLRFFRFGG 304

Query: 304 PRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
              +V  G+ +GF+LY    +M+  G SG++ P  AA  P ++   L  L LL +EDG
Sbjct: 305 VGKLVLGGVSAGFVLYVARQVMEGLGASGMVAPTVAAWFPAVVGSLLGTLTLLYQEDG 362


>gi|126728788|ref|ZP_01744603.1| permease, YjgP/YjgQ family protein [Sagittula stellata E-37]
 gi|126710718|gb|EBA09769.1| permease, YjgP/YjgQ family protein [Sagittula stellata E-37]
          Length = 364

 Score =  306 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 79/366 (21%), Positives = 155/366 (42%), Gaps = 11/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y+ + +L   L       +   ++DL +   Q+G+    S      L   ++P  +
Sbjct: 2   TLHFYYARRFLSLFLGIFAVFALFQGLLDLIDELRQLGD--EVSFGETLQLVILKLPEGL 59

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P + ++  + +F  L R+SELV +RA G S    L      ++L+G   V ++NPI
Sbjct: 60  YEILPLVMILATVAMFIGLARSSELVATRAAGRSGLTALMAPATVALLIGAIIVAMMNPI 119

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL + ++       S      W++         I A +  PE     D + 
Sbjct: 120 VAATSKRYADLRETYESGNTSAVSFGPEGLWLRQGGEDGQSVIRAARANPEATELYDVSI 179

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEY--QYGRIPIDKN----STTLNIPIKMD 235
           +T         R  A+ A + +    L     +    G  P           L   +  +
Sbjct: 180 VTYAPDGGPAMRIQAESAALSDGAWHLTDAKAWPLTPGLNPELGARLHVEYELPSTLTRE 239

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +    + ++ + +++ + ++   +S  F   R    +   +  PL LVAM L+ A+ +
Sbjct: 240 SIRDRFGRPSAVAIWDLPQFIAGLEESG-FSARRHIVWYNMELARPLFLVAMVLVGAAFT 298

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           ++ +R  +  + V   +  GF LY + +  +  G++G L PV AA +P   ++ L++ ++
Sbjct: 299 MQPTRLARTGLAVLSAVLLGFGLYYVRSFAQIMGENGQLAPVVAAWVPPTASVLLALGLV 358

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 359 LHMEDG 364


>gi|163739705|ref|ZP_02147113.1| permease YjgP/YjgQ [Phaeobacter gallaeciensis BS107]
 gi|163743162|ref|ZP_02150544.1| permease, YjgP/YjgQ family protein [Phaeobacter gallaeciensis 2.10]
 gi|161383579|gb|EDQ07966.1| permease, YjgP/YjgQ family protein [Phaeobacter gallaeciensis 2.10]
 gi|161386935|gb|EDQ11296.1| permease YjgP/YjgQ [Phaeobacter gallaeciensis BS107]
          Length = 367

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 82/368 (22%), Positives = 154/368 (41%), Gaps = 12/368 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y+ + +L+         + LV +IDLNE   +  E  + S+ +   L     P  +
Sbjct: 2   TLDFYYARRFLQWFAVICGVLLTLVMLIDLNEQIRRF-EAQDLSLGQLFGLTLLNTPAAL 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            + +P I ++  IV+F  L R+SELV++RAIG S  + L   V+ + L+G+  V  +NPI
Sbjct: 61  SEFLPLIMILTTIVLFIGLARSSELVVTRAIGRSGIRALAAPVLLAALIGVLAVSTLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENH--IWEDF 179
             +      DL + +++ G      +    W++    Q    I A     +       D 
Sbjct: 121 VAATSNRYRDLAETYRNGGPAALSLTGEGLWLRQGGAQGQSVIHATGYSGDTDDITLYDV 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNIPIK 233
           T ++   + + I +  A+ A +      L K   +               ++  L+  + 
Sbjct: 181 TILSYGPEGRPIRQTLAEEAALDGGDWVLIKAKVWPLIVGVNPETNAERHSTLRLSTTLT 240

Query: 234 MDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAAS 293
            +  +         S Y++   +   +++  F   R E      +  PL L+AM L+ A+
Sbjct: 241 SERIRDTLGTATGISVYDLPATIRELSEAG-FSTKRYEVWLQVELARPLFLIAMALVGAA 299

Query: 294 VSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSIL 353
            ++  +R     + V   +  GF LY +    +  G++G +    A   P +  I L++ 
Sbjct: 300 FTMRHARFGGTGLAVLTAVLLGFGLYFLRNFAQILGENGQIPVALAGWAPPVAAILLTMG 359

Query: 354 ILLQKEDG 361
           +LL  EDG
Sbjct: 360 LLLHAEDG 367


>gi|114328862|ref|YP_746019.1| hypothetical protein GbCGDNIH1_2198 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317036|gb|ABI63096.1| hypothetical membrane spanning protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 370

 Score =  306 bits (784), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 91/366 (24%), Positives = 172/366 (46%), Gaps = 9/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y  + +L   L  L+   +LV + D  E+  +    P+ S    + +AA R+P + 
Sbjct: 6   TLSSYITRVFLAAALVVLVALTLLVGLFDFIELLRRAATKPDVSFGLVSTIAALRLPWMS 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+PF  L+  I  F+ L R+SELV++RA GIS WQ L   V  + LLG+  + VI+P+
Sbjct: 66  ITILPFAVLLGGIGAFWRLTRSSELVVARAAGISAWQFLALPVGAAALLGMLAMTVISPL 125

Query: 124 ATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQ----QDIFIGAKKILPENHIWE 177
           ++        L   +     G  + +    W++ S+P         I A ++    +  +
Sbjct: 126 SSVMLSRAEQLDNTYLRTSGGPMRLAGGQLWLRQSDPGLDPHGVSIIHAMQVAAHKNSLQ 185

Query: 178 --DFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMD 235
               T   +D +++++ R +A  A + + +  L      +   +P   ++  +   + + 
Sbjct: 186 ASSITVFRLDSEDRLVQRIEAATARLVSGQWVLDNARVLRPSHLPDPPHTVEIPTDLTVR 245

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             Q+      + SF+ +   +   ++S  F + R   +F  L+ +PL+   M L+AA  S
Sbjct: 246 RIQESFASPDTLSFWSLPDFIRLLDRSG-FSSLRHRLRFQSLLALPLLCATMALVAAGFS 304

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  SR      ++  G+ +GF L+ +  + + FG+SG +  V AA  P +  + L++ +L
Sbjct: 305 MRPSRRGGVAKMIGSGVAAGFCLFVVSKVAEEFGQSGTVPVVLAAWAPSVAGLMLAVALL 364

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 365 LHLEDG 370


>gi|99080789|ref|YP_612943.1| permease YjgP/YjgQ [Ruegeria sp. TM1040]
 gi|99037069|gb|ABF63681.1| permease YjgP/YjgQ [Ruegeria sp. TM1040]
          Length = 368

 Score =  306 bits (783), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 86/369 (23%), Positives = 153/369 (41%), Gaps = 13/369 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL  Y+ + +L+  +      M LV +IDL+E   +  +  +    +   L     P   
Sbjct: 2   ILDLYYARRFLQWFMVIAAVLMSLVMLIDLSEQFRRF-DAQDLRFGQLLELTLLNAPAAF 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            + +P I ++  IV+F  + R+SELV++RAIG S  + L P VV +++LG   V  +NPI
Sbjct: 61  SEFLPLIMILTTIVLFVGMARSSELVVTRAIGRSGIRALVPPVVVALVLGGLAVSTLNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNGDK---QKSDIIPWMQISNPQQDIFIGAKKI--LPENHIWED 178
             +       L + ++  G       S    W++         I A       EN    D
Sbjct: 121 VAATTNRFETLSESYRQTGGPAAVSLSGEGLWLRQGGQNGQSVIHAANYRGDAENLYLYD 180

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNIPI 232
            + +T         R  A  A +  D   L+    +Q        R     +   L   +
Sbjct: 181 VSILTYAPDGGPTRRTVAAEARLEGDDWVLRDAKVWQLILGVNPERSAKRYDELRLPTTL 240

Query: 233 KMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAA 292
             +  +         S Y++ + +   +++  F   R +      +  PL LVAM L+ A
Sbjct: 241 TNERIRDTLGYAEGISIYDLPQTIQSLSEAG-FSTTRFQVWLQVELARPLFLVAMVLVGA 299

Query: 293 SVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSI 352
           + ++  +R     + V   +  GF LY +    +  G++G +  + AA  P + +I L++
Sbjct: 300 AFTMRHTRLGGTGVAVLTSVLLGFALYFVHNFARILGENGQIPILLAAWAPPVASILLTM 359

Query: 353 LILLQKEDG 361
            +LL  EDG
Sbjct: 360 GLLLHAEDG 368


>gi|149914657|ref|ZP_01903187.1| permease, YjgP/YjgQ family protein [Roseobacter sp. AzwK-3b]
 gi|149811450|gb|EDM71285.1| permease, YjgP/YjgQ family protein [Roseobacter sp. AzwK-3b]
          Length = 363

 Score =  305 bits (782), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 80/366 (21%), Positives = 154/366 (42%), Gaps = 12/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  Y  + +L T L      +IL+F+ID+     +M + P +  S    +A  + P   
Sbjct: 2   TLHLYLARRFLLTFLAIFSVFVILLFLIDIV---KEMQDFPAFPFSEILEIALLKAPSAN 58

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P I ++  + +F  ++R SELV+ RA G S  + L   +V + L+G+ +V ++NPI
Sbjct: 59  YEILPLIVILATVALFLRMSRNSELVVVRASGRSAIRALVAPLVVAGLIGVVSVTMLNPI 118

Query: 124 ATSGEKIGIDLIQQWK--DNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL+  +          +    W++  +      I A++   +     + T 
Sbjct: 119 VAASAKRHNDLMNSYLGWSINIMAIAPEGLWLRQGSETGQTVIHAERASSDVSTLYNTTF 178

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQ------YGRIPIDKNSTTLNIPIKMD 235
           I          R  A  A + + + +L     +             + +S ++   +  D
Sbjct: 179 IAFGLDGTPQRRITAASATLGDGEWRLADAKLWDLSSGINPESTAQELDSYSVPSALTQD 238

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
                  +    S +++ K +    +S  F   R        +  PL L+A+ + AA+ +
Sbjct: 239 RIIDSFGKPEYISIWDLPKFIGQLEESG-FSARRYAVWMQTELARPLFLIALVMAAAAFT 297

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  SR +   + V   I  GF L+ I    +  G++G +  + AA  P +    L++ IL
Sbjct: 298 MRHSRLHNTGVSVLTAIMLGFGLHYIRNFAQILGENGQIPIMLAAWAPPVAAFLLALGIL 357

Query: 356 LQKEDG 361
           L  E+G
Sbjct: 358 LHMEEG 363


>gi|84500988|ref|ZP_00999223.1| permease, YjgP/YjgQ family protein [Oceanicola batsensis HTCC2597]
 gi|84391055|gb|EAQ03473.1| permease, YjgP/YjgQ family protein [Oceanicola batsensis HTCC2597]
          Length = 365

 Score =  305 bits (782), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 85/366 (23%), Positives = 157/366 (42%), Gaps = 10/366 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L  YF   +L+  +  L   +++  +ID+ E   ++   P  ++S+   L     P  I
Sbjct: 2   TLHYYFAWRFLRIFIGLLAVFLLMSMLIDVAEHLRRLSSTP-ATLSQVLRLVLLNAPEGI 60

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
             I+P I ++  + +F  L RTSELV++RA G S  + L   V+ +  +G+  V ++NPI
Sbjct: 61  YTILPLIMILATVALFLGLARTSELVVTRAAGRSALRSLVSPVIVAFAIGVIGVAMVNPI 120

Query: 124 ATSGEKIGIDLIQQWKDNG--DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K    L++ ++  G      S    W++    +    I A +  P+     D T 
Sbjct: 121 VAATSKRYAALLESYQSGGADVLSLSAEGLWLRQGGAEGQTVIRAARSNPQATELYDVTM 180

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNST----TLNIPIKMD-- 235
           I          R +A  A +     +L     +   R    +  T    +  +P  +   
Sbjct: 181 IAYAPDGGPEKRIEAARARLIAGAWELHDARIWPLARGTNPEARTERRESFEVPSSLTEA 240

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
             +    + ++   +++   +    ++  F   R    F   +  PL LVAM LIAA+ +
Sbjct: 241 RIRDTFGEPSAIPVWDMPTYIGLLTEAG-FSARRHAVWFQMELAKPLFLVAMVLIAAAFT 299

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +   R  +  I V   I  GF LY +   ++  G++G +    AA  P + ++ L++ +L
Sbjct: 300 MRHVRFGKTGIAVLSAIMLGFALYYVRNFVQILGENGQIPVALAAWAPPVASVLLALGLL 359

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 360 LHMEDG 365


>gi|296445732|ref|ZP_06887685.1| permease YjgP/YjgQ family protein [Methylosinus trichosporium OB3b]
 gi|296256712|gb|EFH03786.1| permease YjgP/YjgQ family protein [Methylosinus trichosporium OB3b]
          Length = 361

 Score =  305 bits (781), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 87/362 (24%), Positives = 155/362 (42%), Gaps = 2/362 (0%)

Query: 1   MPG-ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRV 59
           M G  L RY    + KT L        L+FV+   E+  + G++P       A++   RV
Sbjct: 1   MIGLTLSRYLAARFAKTILAIFATMFCLMFVVYFVELLRRAGDIPQAGADTVALMTILRV 60

Query: 60  PLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLV 119
           P   + I+PF  L   +  F +L R  ELV++RA G+S+WQ L P    ++++G+ +V +
Sbjct: 61  PATAETILPFAVLFGAMTTFVDLTRKLELVVARASGVSVWQFLFPPAFVALVIGVVSVTL 120

Query: 120 INPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDF 179
            NP++   ++    +  +        + D   W++++       + A           + 
Sbjct: 121 YNPVSAVMKQRSDQMELELFGVQGSVRVDHSKWLRLTGVDGTAILHATDYQAGGARLTEV 180

Query: 180 TSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQK 239
           +     K+   + R +A  A +      L++      G       S  L   +  +    
Sbjct: 181 SVNVYSKEGLFLERVEAARARLLAGVFVLEEARVNAPGEESRTVGSYLLATDLTPEQLVT 240

Query: 240 FSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFS 299
            +       F+ +++ +                QF  L+  PL+LVAM L+AAS SL F 
Sbjct: 241 ATTPPQGAPFWSLLE-LGEKTADAGLDPTGYILQFQTLLARPLLLVAMVLVAASFSLRFF 299

Query: 300 RSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE 359
           R       V+ G+ +GF+LY +  +    G +G++ P+ AA  P ++   L  + LL  E
Sbjct: 300 RMGGIARTVSGGVVAGFVLYIVTKLFSDLGGAGVISPLVAAWSPALVGSMLGAVSLLYSE 359

Query: 360 DG 361
           DG
Sbjct: 360 DG 361


>gi|254510403|ref|ZP_05122470.1| permease, YjgP/YjgQ family [Rhodobacteraceae bacterium KLH11]
 gi|221534114|gb|EEE37102.1| permease, YjgP/YjgQ family [Rhodobacteraceae bacterium KLH11]
          Length = 382

 Score =  305 bits (781), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 91/367 (24%), Positives = 159/367 (43%), Gaps = 11/367 (2%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + ++++ L      + L+ +IDL E   +   + + S  +   L     P  I
Sbjct: 18  ILDRYFARRFVQSFLVIGGIFLTLMILIDLIEQVRRFDSV-DLSFGQLLQLTLLNTPAAI 76

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +++P + ++  I +F  L R+SELV++RAIG S  + L   V  ++++G F V ++NPI
Sbjct: 77  SEMLPLLMILATIALFVGLARSSELVVTRAIGRSGIRALLAPVFIALMIGGFAVALLNPI 136

Query: 124 ATSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGA-KKILPENHIWEDFT 180
           A +  +    L   +++ G      S    W++ ++      I A   +  ++    D T
Sbjct: 137 AAATSEEFQRLADGYRNQGSSALSISGEGLWLRQASASGQSVIHATGTVNGDDFALHDVT 196

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTT------LNIPIKM 234
             T     K   +  A  A + N    L++   +        + + T      L   +  
Sbjct: 197 ITTFSSDGKPNQQIAARQADLENGYWTLRQAKVWTLEDDLNPETNATTHEVLNLPTTLTR 256

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
           D       Q  S S Y++ + +S   ++  F   + E      +  PL LV+M LI A+ 
Sbjct: 257 DRILDTLGQQDSVSVYDLPQLISDLREAG-FATKQYEVWLQVQLARPLFLVSMVLIGAAF 315

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           ++   R     I V   +  GF +Y I    +  G++G L    AA  P    I LS+ +
Sbjct: 316 TMRHVRFGGTGIAVLTAVLLGFGIYFIRNFAQILGENGQLPIFVAAWAPPFAGILLSLGL 375

Query: 355 LLQKEDG 361
           LL  EDG
Sbjct: 376 LLHAEDG 382


>gi|315122194|ref|YP_004062683.1| putative permease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495596|gb|ADR52195.1| putative permease protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 321

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 216/322 (67%), Positives = 270/322 (83%), Gaps = 1/322 (0%)

Query: 40  MGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIW 99
           M ELP YS SRGA+L+ TR+PLIIQQ IPFI+L+V+++VFFNLNRT+ELVI+RA+G+SIW
Sbjct: 1   MSELPGYSTSRGAMLSVTRLPLIIQQTIPFISLIVSMIVFFNLNRTNELVITRAVGVSIW 60

Query: 100 QLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ 159
           QLL+PF  GS LLG+FT+LVINP+A SGEK+GI ++  W+   D++  +IIPW+ I N +
Sbjct: 61  QLLSPFTTGSFLLGMFTILVINPMAVSGEKMGISMVNNWR-THDQKTLEIIPWIHIENKK 119

Query: 160 QDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI 219
           +D FIGAKKILPE +I EDFT IT++K+N  I R+DA  AI+  + + LK+VVEY+YG +
Sbjct: 120 EDFFIGAKKILPEKNILEDFTFITVNKENDTIFRQDAHFAIVQKNNIYLKEVVEYKYGAL 179

Query: 220 PIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIV 279
           P+ KNST LNI IKM+ FQKF+EQF S SFYEIIKK+ FS++S++F NY +ETQFYF+I 
Sbjct: 180 PVFKNSTILNIAIKMNYFQKFTEQFTSHSFYEIIKKVIFSHQSSVFRNYFSETQFYFMIS 239

Query: 280 IPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           IP MLVAMTLIAA+VSLEF+RSNQPRIIV YG+ +GFMLYTIIT+MKSFGKSGILLP AA
Sbjct: 240 IPFMLVAMTLIAAAVSLEFNRSNQPRIIVTYGVCAGFMLYTIITLMKSFGKSGILLPFAA 299

Query: 340 ALIPVILTISLSILILLQKEDG 361
           ALIP+I  I LSI ILL+KEDG
Sbjct: 300 ALIPIISIICLSIFILLKKEDG 321


>gi|114766152|ref|ZP_01445156.1| permease, YjgP/YjgQ family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114541612|gb|EAU44654.1| permease, YjgP/YjgQ family protein [Roseovarius sp. HTCC2601]
          Length = 364

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 82/366 (22%), Positives = 165/366 (45%), Gaps = 11/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +L   L  L    + + ++DL +   + G   + S  +   L    +P  +
Sbjct: 2   ILHRYFARRFLTMFLSILTVFALFLALLDLVDQLRRFG--SDVSFGQVVYLTLLNLPSGL 59

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +I+P + ++    +F  + R+SELV+ RA G S    L   V  ++++   +V ++NPI
Sbjct: 60  YEILPLVMILATAALFLMMARSSELVVVRAAGRSGLTALAGPVAVALVISGVSVAILNPI 119

Query: 124 ATSGEKIGIDLIQQWKDNGDKQKS--DIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  +   DL + +K NG    S      W++    + D  I A +  P+  +  + + 
Sbjct: 120 VAATSRQSSDLTESYKSNGASTISIGREGLWLRQGGDEGDTVIRAARANPDATVLYEVSF 179

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEY------QYGRIPIDKNSTTLNIPIKMD 235
           +  + ++  + R +A+ A + +    L+    +          +        L   +  D
Sbjct: 180 VEYEAESGPLRRIEAEEAALQDGAWVLRDAKAWPLQSGRSPEGMSERFERLELPSDLTQD 239

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
           G +    + +S + +++ + +     +  F   R        +  P+ LVAM L+AA  +
Sbjct: 240 GIRDRFGKPSSVAIWDLPEFIEGLEMAG-FSARRHVVWLQMELARPVFLVAMVLVAAGFT 298

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R  +  + V   +  GF LY +    +  G++G L P+ AA IP I ++ L++ ++
Sbjct: 299 MRPARLGRTGLHVLAAVLLGFGLYYVRNFAQIMGENGQLPPILAAWIPPIASLLLALGLV 358

Query: 356 LQKEDG 361
           LQ EDG
Sbjct: 359 LQMEDG 364


>gi|170746989|ref|YP_001753249.1| permease YjgP/YjgQ family protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653511|gb|ACB22566.1| permease YjgP/YjgQ family protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 363

 Score =  303 bits (777), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 89/359 (24%), Positives = 161/359 (44%), Gaps = 1/359 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYF   +L+T L   +    LV+ +D  E+  + GE    S    A L+  R P +
Sbjct: 6   PTLGRYFAARFLRTVLGVFVTVFALVYTLDFVELLRRAGEAQGASAGLMAQLSLYRTPAV 65

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
            + ++PF  L  ++     L+R  ELV++RA GIS WQ L P +  ++ LG   V V NP
Sbjct: 66  AEGVLPFAVLFGSMAALLQLSRKLELVVARAAGISAWQFLQPGLFVALALGALAVGVYNP 125

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
           ++   ++   ++  +      K  S    W++      +  + A+  +         +  
Sbjct: 126 VSAMLKQRSTEIEAKIFAKSTKASSGKDLWIRQKGLDGEAILRAETAVEGTTTLAGVSVF 185

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
           T D   K   +  A  A++++   +L  V        P   ++  +   +     ++   
Sbjct: 186 TFDAAGKFAEQLVAARAMLHDGYWELSDVRVLTPDAPPESFDTYLIASNLDPGQVRQRFT 245

Query: 243 QFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSN 302
              S  F+++   ++ + ++ +    R   Q+  L   P++ VAM ++AA+VSL F R  
Sbjct: 246 PPESVPFWQLPTTIARTERAGL-DATRYRLQYDVLWARPVLFVAMVIVAATVSLRFFRFG 304

Query: 303 QPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
               +V  G+ +GF LY +  +M+  G SG++    AA  P ++   L  L LL +EDG
Sbjct: 305 GVGKLVLGGVAAGFALYVVRQVMEGLGASGLVAAPVAAWFPAVVGSLLGTLTLLYQEDG 363


>gi|154253776|ref|YP_001414600.1| permease YjgP/YjgQ family protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154157726|gb|ABS64943.1| permease YjgP/YjgQ family protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 363

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 90/360 (25%), Positives = 162/360 (45%), Gaps = 4/360 (1%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
            L RY  + +L   L      ++L+F+I+L E+  +  + P+ +      +A   VP I 
Sbjct: 6   TLSRYLGRQFLGVVLLTFGVFIVLIFMIELVELLRRSADKPDVTFGLVVTIALMEVPRIG 65

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            Q +PF  L   +  F  L+R +ELV++RA G+S+WQ + P +  + ++G F   V NP+
Sbjct: 66  AQTLPFAVLFGGMAAFLRLSRNNELVVARAAGVSVWQFIAPALAVAFVIGAFVTTVFNPV 125

Query: 124 ATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
           + +       L  ++  +       S    W++ ++      + A + + +       T 
Sbjct: 126 SATLTTRAEQLESKYLSRQASFVAVSANGLWLRQADSTGQSVVHALR-MDDGFRLRRVTI 184

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFS 241
              D+ N+   R DA  A +     +L  V     G      ++      +     ++  
Sbjct: 185 FLYDQGNRFSGRIDAATARLRPGYWELADVWVMMDGEQSRKYDTYRQETSLTQKQIEESF 244

Query: 242 EQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRS 301
            +  S SF+E+   ++ +  +  F   R +  F+ L+  P +L  M LIAA+ SL  +R 
Sbjct: 245 AREESISFWELPHFIATAE-AAGFSARRYQIYFHQLLATPALLCTMVLIAAAFSLRVTRM 303

Query: 302 NQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
                +V  GIFSGF++Y +  +  + G SGIL    AA  P ++   L + +L   EDG
Sbjct: 304 GGLLQMVLGGIFSGFLIYFLGNLAIALGLSGILPAALAAWAPSLVATLLGLAVLFHLEDG 363


>gi|310816138|ref|YP_003964102.1| putative permease [Ketogulonicigenium vulgare Y25]
 gi|308754873|gb|ADO42802.1| putative permease [Ketogulonicigenium vulgare Y25]
          Length = 360

 Score =  302 bits (775), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 89/365 (24%), Positives = 153/365 (41%), Gaps = 13/365 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF   Y K  L    G  +++ +I+L E   + G   ++       L    VP  +
Sbjct: 2   ILHRYFALRYFKAFLGTAAGFFLMLVMIELIEQLRRFGGQSDFPA-----LTLLNVPATL 56

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            Q++P I ++  +V+F  L R+SE+V++RA G S    L   V+  +L+G+  V+  NPI
Sbjct: 57  YQVLPLIVIISALVLFLGLARSSEMVVTRAAGRSALIALIAPVLIVMLMGLLAVMAFNPI 116

Query: 124 ATSGEKIGIDLIQQWKDNG-DKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
             S  +   + I     +    Q      W++  +      I A    P+       T +
Sbjct: 117 VASTSREYDNRIATITGSSRILQIGGDAIWLRQGDEDGQSVIRAAASDPDGTTLRGVTML 176

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTL------NIPIKMDG 236
           +         R DA  A +  D  +++    +        + S T+         +  D 
Sbjct: 177 SYTNDGIPARRIDAAAATLSGDHWQMQNAKVWPLNTGQNPEASATIHATLAVPSNLSPDE 236

Query: 237 FQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSL 296
            +      AS S +E+   +     +  F   R        + +P  LVAM LIAA  +L
Sbjct: 237 IRNSFGNPASISVWELPAFIKRMEDAG-FTAQRQIVHLQSELALPAFLVAMMLIAAVFTL 295

Query: 297 EFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILL 356
              R  +  ++V + +   F LY I  + +  G++G L P+ AA +  +  I+L + +LL
Sbjct: 296 RHQRGGRTGMMVLFAVLISFSLYFIRNLAQILGENGQLTPLLAAWVTPLAAIALGVGLLL 355

Query: 357 QKEDG 361
             EDG
Sbjct: 356 HLEDG 360


>gi|110634109|ref|YP_674317.1| permease YjgP/YjgQ [Mesorhizobium sp. BNC1]
 gi|110285093|gb|ABG63152.1| permease YjgP/YjgQ [Chelativorans sp. BNC1]
          Length = 359

 Score =  302 bits (774), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 113/359 (31%), Positives = 175/359 (48%), Gaps = 3/359 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L RYFF+ Y   T +  +G   LV+++   EI  + G+L  ++ S    LAA ++P+I
Sbjct: 4   PTLGRYFFRRYAVITAWNFIGVAALVYIVTFTEITGRAGDLEGFTTSWALGLAALQLPII 63

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           +QQ +PFI LV  I    +LNR  ELVI+RA GIS WQ L P   G+ + G+ TVLV+NP
Sbjct: 64  MQQAVPFIGLVAAIATLISLNRKYELVIARAAGISAWQFLTPIAFGAFVFGLLTVLVLNP 123

Query: 123 IATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSI 182
           IA         L    +   D   +    W++    Q +  IGA   L            
Sbjct: 124 IAARAFASAQMLEATVR-GADTSNNAKERWIKQRTDQGETIIGADAALAGGTELVRPVFF 182

Query: 183 TIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSE 242
            I    +I  R DA  A + +   +L  VV  Q G  P    +  +   +K +   +   
Sbjct: 183 IIGDD-RIAERLDAASAFLRDGYWELVDVVRRQGGNAPEKIATARVPTNLKPEFVGQELT 241

Query: 243 QFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSN 302
              + S + +   +  +  S          Q + LI +P +LVAMTLIAA+VS+ F+R  
Sbjct: 242 DPDAVSIFALPGMIETA-HSFGLRANAFAMQLHSLITLPPLLVAMTLIAATVSMRFTRMG 300

Query: 303 QPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG 361
           Q   ++  G+ +GF+LY    ++++FG +G + P  AA  PV++ +   +  LL +EDG
Sbjct: 301 QSATVILGGVVAGFLLYVSSVLVRAFGDAGFVPPPIAAWTPVMVAMFFGVTFLLFREDG 359


>gi|328544012|ref|YP_004304121.1| permease YjgP/YjgQ [polymorphum gilvum SL003B-26A1]
 gi|326413756|gb|ADZ70819.1| Permease YjgP/YjgQ [Polymorphum gilvum SL003B-26A1]
          Length = 363

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 101/361 (27%), Positives = 186/361 (51%), Gaps = 3/361 (0%)

Query: 3   GILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLI 62
             L  YF + +LK  L   L A +L+F+ D+ E+  + GE  ++S+ R  +++  RVPL+
Sbjct: 4   PTLTLYFSRRFLKAILGLFLLAAVLIFLFDVLELLRRAGERGDFSVLRITLISLLRVPLL 63

Query: 63  IQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINP 122
           ++Q++PF  L   I  F  L+R  ELV++RA GIS+WQ   P V+ ++++G+ +V + NP
Sbjct: 64  LEQVLPFAVLFGAIWAFVTLSRALELVVARAAGISVWQFGAPAVLVALIIGLVSVTLYNP 123

Query: 123 IATSGEKIGIDLIQQW--KDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFT 180
           +A   ++   ++       +     ++    W++      +  + A+++L         T
Sbjct: 124 MAVWMQERSNEVAAGIFGTEETFLLQTTNAVWIRQDGLDGESVLNAEQLLDHGERLLGVT 183

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKF 240
             T D+      R +A  A + N    LK V+ Y     P    +  ++  +     ++ 
Sbjct: 184 IFTFDRAGSFQERIEAREARLRNQFWHLKDVIVYTTESDPQRYGTYEVSTYLTPTEVRES 243

Query: 241 SEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSR 300
                S SF+ + + +  ++++ +   YR   Q++ L+  PL+L+AM LIAA+VSL  SR
Sbjct: 244 IGAPESISFWNLPRFIELASRAGL-PAYRYTLQYHSLLARPLLLLAMVLIAAAVSLRVSR 302

Query: 301 SNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED 360
                 ++  GI +GF+LY +  + + FG +GI+ P+ AA  P    + + + ILL +ED
Sbjct: 303 FGGLGGMILGGIIAGFVLYVLSELGRDFGGAGIVPPLVAAWAPGAFGVLMGLTILLNRED 362

Query: 361 G 361
           G
Sbjct: 363 G 363


>gi|126739400|ref|ZP_01755093.1| permease, YjgP/YjgQ family protein [Roseobacter sp. SK209-2-6]
 gi|126719500|gb|EBA16209.1| permease, YjgP/YjgQ family protein [Roseobacter sp. SK209-2-6]
          Length = 367

 Score =  299 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 81/367 (22%), Positives = 149/367 (40%), Gaps = 12/367 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           L  Y+ + + +  L      M LV +IDL+E   +     + S  +   L     P  + 
Sbjct: 3   LDLYYARRFAQWFLVITGVLMTLVVLIDLSEQIRRFDAF-DLSAGQILGLTLLNAPAAMN 61

Query: 65  QIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIA 124
           + +P I ++  IV+F  L R+SELV++RAIG S  + L   V+ + L+G+  V  +NPI 
Sbjct: 62  EFLPLIMILTTIVLFVGLARSSELVVTRAIGRSGIRALAAPVLVAALIGVLAVSTLNPIV 121

Query: 125 TSGEKIGIDLIQQWKDNGDK--QKSDIIPWMQISNPQQDIFIGAKKILPENH--IWEDFT 180
            +       L   ++  G      +    W++  +P     + A          I  D T
Sbjct: 122 AATTNRYKSLSDSYRTGGPSVLSLTGEGLWLRQGSPSGQSVVHAAGYGGGREEIILYDVT 181

Query: 181 SITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR------IPIDKNSTTLNIPIKM 234
            +T  K +    R  A  A +      L+    +             +     +   +  
Sbjct: 182 ILTYGKDSGPRTRTQARSARLEGSDWVLQDAKVWPLSAWTNPEISAGEHQELRIPTTLTQ 241

Query: 235 DGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASV 294
           D  +   +     S Y++ + +    ++  F   + E  +   +  P  L+AM L+ A+ 
Sbjct: 242 DRIRDRLDASDGISIYDLPQTIRELAEAG-FATKKHEVWYQVELARPFFLIAMVLVGAAF 300

Query: 295 SLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILI 354
           ++  +R     + V   +  GF LY I    +  G++G +    AA  P + +I L++ +
Sbjct: 301 TMRHTRFGGTGMAVLTAVLLGFGLYFIRNFAQILGENGEIPVALAAWAPPVASILLTLGL 360

Query: 355 LLQKEDG 361
           LL  EDG
Sbjct: 361 LLHAEDG 367


>gi|149201834|ref|ZP_01878808.1| permease, YjgP/YjgQ family protein [Roseovarius sp. TM1035]
 gi|149144882|gb|EDM32911.1| permease, YjgP/YjgQ family protein [Roseovarius sp. TM1035]
          Length = 378

 Score =  299 bits (766), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 71/366 (19%), Positives = 151/366 (41%), Gaps = 12/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +  + +   +  ++++ +IDL +     G+ P  +  +   +   ++P   
Sbjct: 17  ILERYFGRRFFVSFMGVTITMLVIMGLIDLMDEL---GDFPELAFGQVLGIVLLKLPEAY 73

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +IIP + ++ ++ +F  L R+SE+V+ RA G S  + L      ++ +G+  + V NP+
Sbjct: 74  YEIIPLVMILASVALFLRLARSSEMVVLRASGRSALRGLLAPAAVALAIGLLGLAVGNPL 133

Query: 124 ATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL+  +      D   +    W++         I A +   +       + 
Sbjct: 134 VAATAKRHHDLVNTYSGQTYSDLAIASEGLWLRQGGTAGQTVIYAARSSSDLSTLYGPSF 193

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR----IPIDKNSTTLNIPIKMDGF 237
                  + + R  A  A +      L+    +          + +    L++P  +   
Sbjct: 194 YDFAPDGQPLRRISASTARLETGAWLLEDAKIWDLAENINPEAMARQEAQLSVPSDLTQD 253

Query: 238 Q--KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
           +             +E+ K +    ++  F   R    F   +  P+ LVA+ LI+A+++
Sbjct: 254 RILDSFGSPEYIPIWELPKFIDQLEEAG-FSARRYAIWFQSELAQPVFLVALVLISAALT 312

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           +  +R     + V   +  GF L+ +       G++G L  + AA  P + ++ + + IL
Sbjct: 313 MGHTRGANVGLSVLTAVLLGFGLHYVRNFAHILGENGQLPILLAAWAPPVASLFIGLGIL 372

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 373 LHLEDG 378


>gi|312113657|ref|YP_004011253.1| permease YjgP/YjgQ family protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218786|gb|ADP70154.1| permease YjgP/YjgQ family protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 363

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 85/363 (23%), Positives = 163/363 (44%), Gaps = 4/363 (1%)

Query: 1   MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVP 60
           +   + RY  K +  T L      ++L+F +D  E+    G   + S    A++   R+P
Sbjct: 3   IFTTVGRYMAKRFAITILGVFFVTLLLIFFVDFVEVLRS-GARKDVSAGTLALITLLRIP 61

Query: 61  LIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVI 120
           +  +  +PF  L+  I  F +L+RTSEL I RA G+S+WQ + P ++ +I  G+F V V 
Sbjct: 62  IFAELTLPFAILIGTIAAFLSLSRTSELTIMRAAGLSVWQFVQPALIVAIFFGVFAVTVY 121

Query: 121 NPIATSGEKIGIDLIQQWKDN--GDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWED 178
           NP+A++ +     +  +   +            W++  +      + AK           
Sbjct: 122 NPVASAMKAKSEKIQAEIFQSEKSFATSRGTGSWLRQESVDGPTILHAKTSADRGLTLAG 181

Query: 179 FTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQ 238
            T +  D  N+   +  A+ A +     +L+ V+    G      +   ++  +      
Sbjct: 182 VTLLQFDPANRFYEQIQANKAELRQGYWRLEGVIVQSSGDAVRRYDEYFVSTYLGPAQIM 241

Query: 239 KFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEF 298
                  + SF+++   ++F+ K+ +    + E Q    +  P+++ AM LIAA+ SL+ 
Sbjct: 242 NSLGSLETLSFWDLPGFIAFAGKAGL-PTRQYELQHQLFLARPILMAAMVLIAATCSLKA 300

Query: 299 SRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQK 358
            R  + + +V  G+  GF  +    + +  G SG++    AA  P ++ + LS  +LL +
Sbjct: 301 FRFGKIQTMVLTGLTGGFGFFIFSELSRKVGASGLVPVTVAAWGPALVALLLSATVLLYQ 360

Query: 359 EDG 361
           EDG
Sbjct: 361 EDG 363


>gi|85706341|ref|ZP_01037435.1| permease, YjgP/YjgQ family protein [Roseovarius sp. 217]
 gi|85669114|gb|EAQ23981.1| permease, YjgP/YjgQ family protein [Roseovarius sp. 217]
          Length = 363

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 77/366 (21%), Positives = 154/366 (42%), Gaps = 12/366 (3%)

Query: 4   ILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLII 63
           IL RYF + +  + L   +  ++++ +IDL +     G+ P  +  +   +   ++P   
Sbjct: 2   ILERYFGRRFFMSFLGVTVTLVVMLGLIDLMDEL---GDFPELAFGQVLGIVLLKLPEAY 58

Query: 64  QQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPI 123
            +IIP + ++ ++ +F  L RTSELV+ RA G S  Q L      ++ +G+  + V NP+
Sbjct: 59  YEIIPLVMILASVALFLRLARTSELVVLRASGRSALQGLLAPAAVALAIGLLGLAVGNPL 118

Query: 124 ATSGEKIGIDLIQQWKD--NGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTS 181
             +  K   DL+  +    + D   +    W++ S  +    I A +   +       + 
Sbjct: 119 VAATSKRHHDLVNSYSGQASSDLAIASEGLWLRQSAAEGQTVIYAARASSDLGTLYAPSF 178

Query: 182 ITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGR------IPIDKNSTTLNIPIKMD 235
                  K + R  A  A +      L +   +   +         +    T+   +  D
Sbjct: 179 YDFAPDGKPLRRISATSAQLEEGAWVLTEAKIWDLAQGVNPEASAREDAQMTVPSDLTQD 238

Query: 236 GFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVS 295
                         +E+ K ++   ++  F   R    F   +  P+ LVA+ LI+A+ +
Sbjct: 239 RILDSFGSPEYVPIWELPKFIAQLEEAG-FSARRYAIWFQSELAQPVFLVALVLISAAFT 297

Query: 296 LEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILIL 355
           ++ +R     + V   +  GF L+ I    +  G++G +  + AA  P + ++ + + IL
Sbjct: 298 MQHTRGANVGLSVLTAVLLGFGLHYIRNFAQILGENGQIPILLAAWAPPVASLFIGLGIL 357

Query: 356 LQKEDG 361
           L  EDG
Sbjct: 358 LHLEDG 363


>gi|254453977|ref|ZP_05067414.1| permease, YjgP/YjgQ family [Octadecabacter antarcticus 238]
 gi|198268383|gb|EDY92653.1| permease, YjgP/YjgQ family [Octadecabacter antarcticus 238]
          Length = 362

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 82/365 (22%), Positives = 151/365 (41%), Gaps = 11/365 (3%)

Query: 5   LWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQ 64
           + RYF + +  T      G  +L+ +IDL E   + G   + S+     L+   +P  I 
Sbjct: 1   MHRYFARRFAWTFAATFGGFFVLMLLIDLVEQLRRYG--GDASLGDMFQLSLLNLPTGIY 58

Query: