>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.

Probab=97.75 E-value=0.00014 Score=52.40 Aligned_cols=57 Identities=32% Similarity=0.494 Sum_probs=39.4 Q ss_pred CCCEEEEEEEEECCEEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCCEEEEEEHHHHHH Q ss_conf 3786674653400028996089998999999985799788887678552788888888762 Q gi|255764470|r 301 LADRPAKSIMTPRTEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLR 361 (523) Q Consensus 301 L~e~~V~~IMtPR~~i~~ld~~~s~~e~~~~i~~~~~SR~PV~~~~~D~iiGiv~~kDLl~ 361 (523) T Consensus 53 ~~~~~v~~iM~--~~~~tv~~~~~i~~a~~~m~~~~~~~lpVvd~--g~lvGiit~~Dilk 109 (110) T cd04595 53 LGHAPVKDYMS--TDVVTVPPDTPLSEVQELMVEHDIGRVPVVED--GRLVGIVTRTDLLR 109 (110) T ss_pred CCCCCCEEEEE--CCEEEECCCCCHHHHHHHHHHCCCEEEEEEEC--CEEEEEEEHHHEEC T ss_conf 67881210325--36688669993999999889749139999989--99999998415615

HHsearch alignment for GI: 255764470 and conserved domain: cd04595