>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=97.77 E-value=0.00027 Score=50.43 Aligned_cols=83 Identities=23% Similarity=0.208 Sum_probs=55.5 Q ss_pred CCCEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEEEHHHHHHHHCCCCCCCCCCCCCEEEECCCEEEEEECCCHH Q ss_conf 27435238999899999885038627775228674256525999999870664457888631288349859987001199 Q gi|255764470|r 376 RKPLVVHENISVLKLMERLRKSSQTFVMVLDEYGVLEGMITPANILEAIAGDFPDEDDQKLDITVGDDGSLTVDGWIDVR 455 (523) Q Consensus 376 r~~~~Vpe~~~l~~lL~~fr~~~~~lAiVvDE~G~~~GIVTleDIlE~IvGei~DE~d~~~~i~~~~d~~~~v~G~~~l~ 455 (523) T Consensus 1 r~vvtv~~~~tl~ea~~~m~~~~~~~~~Vvd~~~~lvGiiT~~Di~~~~~~~~~~--~~~-v~~~m~~~~~tv~~~~~l~ 77 (112) T cd04624 1 RPVVTVDPDTSIREAAKLMAEENVGSVVVVDPDERPIGIVTERDIVRAVAAGIDL--DTP-VSEIMTRDLVTVDPDEPVA 77 (112) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEECCHHHHHHHCCCCC--CCC-EEEEECCCCEEECCCCCHH T ss_conf 9978978939599999999862998899993998299999820458898648743--442-0456516716787999899 Q ss_pred HHHHHH Q ss_conf 999982 Q gi|255764470|r 456 YASKLF 461 (523) Q Consensus 456 el~~~l 461 (523) T Consensus 78 ~a~~~m 83 (112) T cd04624 78 EAAKLM 83 (112) T ss_pred HHHHHH T ss_conf 999999

HHsearch alignment for GI: 255764470 and conserved domain: cd04624