>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.15 E-value=1e-09 Score=89.95 Aligned_cols=109 Identities=18% Similarity=0.248 Sum_probs=93.3 Q ss_pred CEEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCCEEEEEEHHHHHHHHHC-CC---CCHHHHHH-CCCEEECCCCCHH Q ss_conf 0289960899989999999857997888876785527888888887620202-46---60168873-2743523899989 Q gi|255764470|r 314 TEIVWLDVNCVDEDLQWKILELGHSRFPVAQGSLDSFIGIVSARDLLRDLLE-EG---SMNFKRSI-RKPLVVHENISVL 388 (523) Q Consensus 314 ~~i~~ld~~~s~~e~~~~i~~~~~SR~PV~~~~~D~iiGiv~~kDLl~~~~~-~~---~~~~~~li-r~~~~Vpe~~~l~ 388 (523) T Consensus 1 pdvitv~~~~tv~eA~~~M~~~~i~~v~V~~~~~~~~vGiiT~~Di~~~~~~~~~~~~~~~V~~vMt~~v~tv~~d~~~~ 80 (114) T cd04630 1 PNVVTIDGLATVAEALQLMKEHGVSSLVVEKRRESDAYGIVTMRDILKKVVAEGRDPDRVNVYEIMTKPLISVSPDMDIK 80 (114) T ss_pred CCEEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCEEEEEEEHHHHHHHHHCCCCCCCCCHHHHCCCCEEEECCCCCHH T ss_conf 98499998293999999999829988999978996089999818989999846789444498682703549999949499 Q ss_pred HHHHHHHHCCCEEEEEECCCCCEEEEEEHHHHHHH Q ss_conf 99998850386277752286742565259999998 Q gi|255764470|r 389 KLMERLRKSSQTFVMVLDEYGVLEGMITPANILEA 423 (523) Q Consensus 389 ~lL~~fr~~~~~lAiVvDE~G~~~GIVTleDIlE~ 423 (523) T Consensus 81 ~a~~~m~~~~i~~lpVvd~-~~lvGiit~~Dil~A 114 (114) T cd04630 81 YCARLMERTNIRRAPVVEN-NELIGIISLTDIFLA 114 (114) T ss_pred HHHHHHHHCCCCEEEEEEC-CEEEEEEEHHHHHCC T ss_conf 9999999779729999999-999999976896479

HHsearch alignment for GI: 255764470 and conserved domain: cd04630