>cd04106 Rab23_lke Rab23-like subfamily. Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina. Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system. GTPase activating proteins (GAPs) interact with G

Probab=99.61 E-value=2e-15 Score=122.82 Aligned_cols=153 Identities=19% Similarity=0.211 Sum_probs=94.1 Q ss_pred EEEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHCCCCEEE--ECCE--EEEEEECHHCCCCCCCCCHHHHHHCCCC Q ss_conf 03886403564256788765201211000245665420231142--0340--6999817110444443000111000121 Q gi|255764471|r 204 LRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWN--WKNH--PIEIFDTAGMRKPSRITESLEQKTVKKS 279 (470) Q Consensus 204 i~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtTrD~i~~~~~--~~~~--~~~liDTaGirkk~~~~~~~E~~s~~~t 279 (470) T Consensus 1 iKivvlGd~~VGKTsLi~r~~~~~-f~~~y~~Tig~~~~~k~i~~~~~~~~v~l~iwDtaG----------~e~~~~l~- 68 (162) T cd04106 1 IKVIVVGNGNVGKSSMIQRFVKGI-FTKDYKKTIGVDFLEKQIFLRQSDEDVRLMLWDTAG----------QEEFDAIT- 68 (162) T ss_pred CEEEEECCCCCCHHHHHHHHHHCC-CCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCC----------CCCCCCCH- T ss_conf 989999999988999999998496-898768855625788789986799799999997899----------70134152- Q ss_pred CEEEECCEEEEEECCCCCCCHHHHHH-HHHHHHC--CCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf 00120120599845532122021223-2000000--35766558944223354155566654201333200488311123 Q gi|255764471|r 280 MQSVRTCETTIVLLDATIPFEKQDLR-IVDSVFN--TGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTI 356 (470) Q Consensus 280 ~~~i~~advvi~viDa~~~~~~qd~~-i~~~i~~--~~k~~iiv~NK~Dli~~~~~~~~~~~~~~~~~~~~~~~~~i~~i 356 (470) T Consensus 69 ~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~piilVgNK~DL~~~r~V~~~e~~~-----~a~~~~~~~~E~ 143 (162) T cd04106 69 KAYYRGAQACILVFSTTDRESFEAIESWKEKVEAECGDIPMVLVQTKIDLLDQAVITNEEAEA-----LAKRLQLPLFRT 143 (162) T ss_pred HHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCHHHHHH-----HHHHCCCEEEEE T ss_conf 456123031268840698899999999999999766996299984054441017789999999-----999869879998 Q ss_pred CCCCCCCHHHHHHHHHH Q ss_conf 45333485899999999 Q gi|255764471|r 357 SGRTGEGLDDLMVSVLE 373 (470) Q Consensus 357 SA~~g~gi~~l~~~i~~ 373 (470) T Consensus 144 SAk~~~nV~e~F~~la~ 160 (162) T cd04106 144 SVKDDFNVTELFEYLAE 160 (162) T ss_pred CCCCCCCHHHHHHHHHH T ss_conf 68888298999999996

HHsearch alignment for GI: 255764471 and conserved domain: cd04106