>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

Probab=99.66 E-value=5.9e-16 Score=126.47 Aligned_cols=151 Identities=17% Similarity=0.180 Sum_probs=83.5 Q ss_pred EEEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHCCCCEEEECCEEEEEEECHHCCCCCCCCCHHHHHHCCCCCEEE Q ss_conf 03886403564256788765201211000245665420231142034069998171104444430001110001210012 Q gi|255764471|r 204 LRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSV 283 (470) Q Consensus 204 i~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtTrD~i~~~~~~~~~~~~liDTaGirkk~~~~~~~E~~s~~~t~~~i 283 (470) T Consensus 1 ~KililG~~~sGKTsll~~l~~~~~~~~~pT~g~~----~~~~~~~~~~l~iwD~~G~----------~~~r~l-~~~Y~ 65 (159) T cd04150 1 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFN----VETVEYKNISFTVWDVGGQ----------DKIRPL-WRHYF 65 (159) T ss_pred CEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCC----EEEEEECCEEEEEEECCCC----------CCCCHH-HHHHC T ss_conf 99999999999989999999729967758968701----7999989899999978997----------214656-78647 Q ss_pred ECCEEEEEECCCCCCCHHHH--HHHHHHH---HCCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCC Q ss_conf 01205998455321220212--2320000---003576655894422335415556665420133320048831112345 Q gi|255764471|r 284 RTCETTIVLLDATIPFEKQD--LRIVDSV---FNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISG 358 (470) Q Consensus 284 ~~advvi~viDa~~~~~~qd--~~i~~~i---~~~~k~~iiv~NK~Dli~~~~~~~~~~~~~~~~~~~~~~~~~i~~iSA 358 (470) T Consensus 66 ~~a~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~~~--~~ei~~~l~l~~~~~~~~~i~~~SA 143 (159) T cd04150 66 QNTQGLIFVVDSNDRERIGEAREELQRMLNEDELRDAVLLVFANKQDLPNAMS--AAEVTDKLGLHSLRNRNWYIQATCA 143 (159) T ss_pred CCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCC--HHHHHHHHCHHHHHCCCEEEEEEEC T ss_conf 68738999997777789999999999996235336982999997566778989--9999999686666379859998268 Q ss_pred CCCCCHHHHHHHH Q ss_conf 3334858999999 Q gi|255764471|r 359 RTGEGLDDLMVSV 371 (470) Q Consensus 359 ~~g~gi~~l~~~i 371 (470) T Consensus 144 ~tG~Gv~e~f~WL 156 (159) T cd04150 144 TSGDGLYEGLDWL 156 (159) T ss_pred CCCCCHHHHHHHH T ss_conf 6793989999998

HHsearch alignment for GI: 255764471 and conserved domain: cd04150