>cd04177 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key featu

Probab=99.67 E-value=3.7e-16 Score=127.85 Aligned_cols=153 Identities=22% Similarity=0.280 Sum_probs=98.9 Q ss_pred EEEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHCCCCEEEECCEE--EEEEECHHCCCCCCCCCHHHHHHCCCCCE Q ss_conf 0388640356425678876520121100024566542023114203406--99981711044444300011100012100 Q gi|255764471|r 204 LRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHP--IEIFDTAGMRKPSRITESLEQKTVKKSMQ 281 (470) Q Consensus 204 i~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtTrD~i~~~~~~~~~~--~~liDTaGirkk~~~~~~~E~~s~~~t~~ 281 (470) T Consensus 2 fKivlvGd~~VGKTsli~rf~~~~-f-~~~y~pTi~~~~~k~i~i~~~~~~l~iwDtaG----------~e~~~~~~-~~ 68 (168) T cd04177 2 YKIVVLGAGGVGKSALTVQFVQNV-F-IESYDPTIEDSYRKQVEIDGRQCDLEILDTAG----------TEQFTAMR-EL 68 (168) T ss_pred EEEEEECCCCCCHHHHHHHHHHCC-C-CCCCCCCCCCEEEEEEEECCEEEEEEEEECCC----------CCCCCCCH-HH T ss_conf 199998999977999999996193-8-98658833315999999999999999982788----------62333451-54 Q ss_pred EEECCEEEEEECCCCCCCHHHHH-HHHHHH----HCCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf 12012059984553212202122-320000----0035766558944223354155566654201333200488311123 Q gi|255764471|r 282 SVRTCETTIVLLDATIPFEKQDL-RIVDSV----FNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTI 356 (470) Q Consensus 282 ~i~~advvi~viDa~~~~~~qd~-~i~~~i----~~~~k~~iiv~NK~Dli~~~~~~~~~~~~~~~~~~~~~~~~~i~~i 356 (470) T Consensus 69 ~~~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r~v~~~e~~~-~a~~---~~~~~~~E~ 144 (168) T cd04177 69 YIKSGQGFLLVYSVTSEASLNELGELREQVLRIKDSDNVPMVLVGNKADLEDDRQVSREDGVS-LSQQ---WGNVPFYET 144 (168) T ss_pred HHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHCCCCCHHHHHH-HHHH---CCCCEEEEE T ss_conf 512686679853689888999999999999985178887489887314612137689999999-9997---499779996 Q ss_pred CCCCCCCHHHHHHHHHH Q ss_conf 45333485899999999 Q gi|255764471|r 357 SGRTGEGLDDLMVSVLE 373 (470) Q Consensus 357 SA~~g~gi~~l~~~i~~ 373 (470) T Consensus 145 SAk~~~nV~e~F~~l~~ 161 (168) T cd04177 145 SARKRTNVDEVFIDLVR 161 (168) T ss_pred CCCCCCCHHHHHHHHHH T ss_conf 24878468999999999

HHsearch alignment for GI: 255764471 and conserved domain: cd04177