HHsearch alignment for GI: 255764473 and conserved domain: COG0111

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism].
Probab=96.62  E-value=0.011  Score=37.74  Aligned_cols=140  Identities=17%  Similarity=0.196  Sum_probs=89.0

Q ss_pred             HHHHCCCCCCEECCCCCCCHHHH--HHHHHHHHHH-----------------HCC--CCCCCCEEEECCCCCCCCCHHHC
Q ss_conf             77630124412404333202467--8765576642-----------------001--33677304610455554310100
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHPCQ--IIADIMTFEE-----------------HRG--SVKGKLFSWSGDGNNILHSLIEG  172 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HPtQ--aL~D~~Ti~e-----------------~~g--~l~~~~i~~vGd~~~v~hS~i~~  172 (306)
T Consensus        82 ~~~~~~~gi~V~nap~~na~~vAE~~~~~~L~~~R~~~~~~~~~~~g~W~~~~~~g~el~gkTvGIiG~G-~IG~~va~~  160 (324)
T COG0111          82 LEAATKRGILVVNAPGGNAISVAELVLALLLALARRIPDADASQRRGEWDRKAFRGTELAGKTVGIIGLG-RIGRAVAKR  160 (324)
T ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCC-HHHHHHHHH
T ss_conf             3553137437996798653769999999999996056477899872867523566510169889998987-899999999


Q ss_pred             CCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHH
Q ss_conf             12331257652000013210000243201332221366466306873322210000002201333100111233688996
Q gi|255764473|r  173 AARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMS  252 (306)
Q Consensus       173 ~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~  252 (306)
T Consensus       161 l~afgm~v~~~d~~~~~~~~------~~--~~~~~~~~Ld~lL~~aDiv~lh--~PlT~e---------T~g~i~~~~~a  221 (324)
T COG0111         161 LKAFGMKVIGYDPYSPRERA------GV--DGVVGVDSLDELLAEADILTLH--LPLTPE---------TRGLINAEELA  221 (324)
T ss_pred             HHHCCCEEEEECCCCCCCCC------CC--CCCEECCCHHHHHHHCCEEEEC--CCCCCH---------HHCCCCHHHHH
T ss_conf             98679869998898860001------23--5631102699998769999983--899812---------22137999994


Q ss_pred             CCCCCCEEECCCCCCCCCCCCHHH
Q ss_conf             289872992599987487357679
Q gi|255764473|r  253 MAHPDALFMHCLPAHRGEEVINEV  276 (306)
Q Consensus       253 ~a~~~~~vmHplP~~rg~EI~~~v  276 (306)
T Consensus       222 ~MK~gailIN~a---RG~vVde~a  242 (324)
T COG0111         222 KMKPGAILINAA---RGGVVDEDA  242 (324)
T ss_pred             CCCCCCEEEECC---CCCEECHHH
T ss_conf             489981999888---752035899