HHsearch alignment for GI: 255764473 and conserved domain: COG0540

>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism].
Probab=100.00  E-value=0  Score=617.22  Aligned_cols=302  Identities=31%  Similarity=0.443  Sum_probs=274.4

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             98887717844589999999999999999665236665443798799994288835789999898634754333321000
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM   81 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s   81 (306)
T Consensus         4 ~~~~rhlisi~dls~~ei~~ll~~A~~~~~~~~~~~~~~~l~gk~v~~lFFEpSTRTr~SFE~A~krLG~~Vv~~~~~~s   83 (316)
T COG0540           4 PFKMRHLISIEDLSREELELLLDTADEFKAVARAEKKLDLLKGKVVANLFFEPSTRTRLSFETAMKRLGADVVNFSDSES   83 (316)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCHHCCCEEEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             66666250167589999999999999998665024775021276799998458773066499999972993896458766


Q ss_pred             CCCCCCCHHHHHHHHHHC-CCEEEEEECCCCHHHHHHCCCCC-CEECCCCC-CCHHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             012321079999975300-10111210132006776301244-12404333-2024678765576642001336773046
Q gi|255764473|r   82 QLGRAETIGDTAKVLSRY-VDAIVMRTTNHSRLLELTEYATV-PVINALTD-NTHPCQIIADIMTFEEHRGSVKGKLFSW  158 (306)
Q Consensus        82 s~~kgEsl~Dt~~~ls~~-~D~iviR~~~~~~~~~~~~~~~v-pvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~~~i~~  158 (306)
T Consensus        84 Ss~KGEtL~DT~~tl~ayg~D~iViRH~~egaa~~~a~~~~~~pvINaGDG~~qHPTQ~LLDl~TI~~~~G~~~gl~iai  163 (316)
T COG0540          84 SSKKGETLADTIRTLSAYGVDAIVIRHPEEGAARLLAEFSGVNPVINAGDGSHQHPTQALLDLYTIREEFGRLDGLKIAI  163 (316)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             54466109999999986079989994764148999987358885478888999895289999999999848767947999


Q ss_pred             ECC--CCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEE--CCCCCH
Q ss_conf             104--5555431010012331257652000013210000243201332221366466306873322210000--002201
Q gi|255764473|r  159 SGD--GNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS--MNQEFK  234 (306)
Q Consensus       159 vGd--~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~--~~~~~~  234 (306)
T Consensus       164 vGDlkhsRva~S~~~~L~~~ga~v~lvsP~~L~~p~~i~~~l~~~~~~~~~~~~~e~~i~~~DVl~~lRvQ~ER~~~~~~  243 (316)
T COG0540         164 VGDLKHSRVAHSNIQALKRFGAEVYLVSPETLLPPEYILEELEEKGGVVVEHDSDEEVIEEADVLYMLRVQKERFNDPEE  243 (316)
T ss_pred             ECCCCCHHHHHHHHHHHHHCCCEEEEECCHHHCCCHHHHHHHHHCCCEEEEECCHHHHHCCCCEEEEEHHHHHHCCCCCC
T ss_conf             82544118888779999981987999886586794657888762485279814666642337789852234754478632


Q ss_pred             HH-HHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             33-310011123368899628987299259998748735767967997106868775599999999996255
Q gi|255764473|r  235 AR-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       235 ~~-~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
T Consensus       244 ~s~~~~y~~~~~~~~~~~--~k~~~ivmHP~PvnR~~EI~~~v~~~p~s~~f~Q~~nGV~vRMAlL~~~l~~  313 (316)
T COG0540         244 YSKVKEYYKLYGLTLERL--AKPDAIVMHPLPVNRVVEIASEVDDTPQSRYFQQVKNGVAVRMALLELLLGG  313 (316)
T ss_pred             HHHHHHHHHHHHHHHHHH--CCCCCEEECCCCCCCCCCCCHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCC
T ss_conf             588888999978899962--6899689788875678757665644617789999962799999999998533