HHsearch alignment for GI: 255764473 and conserved domain: KOG1504

>KOG1504 consensus.
Probab=100.00  E-value=0  Score=536.56  Aligned_cols=301  Identities=44%  Similarity=0.693  Sum_probs=283.6

Q ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHC-CCC-CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             888771784458999999999999999966523-666-544379879999428883578999989863475433332100
Q gi|255764473|r    3 TYPKHFADLSNISSSNLSCIIEVAKKIKNSSEN-IFE-NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSE   80 (306)
Q Consensus         3 ~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~-~~~-~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~   80 (306)
T Consensus        37 s~~r~llsikd~s~eeik~ll~rase~K~~~Kqn~e~n~~~l~gks~amIF~KrStRTRvStEt~~~~lGg~~mfLg~~D  116 (346)
T KOG1504          37 SDLRDLLSIKDFSTEEIKTLLDRASEVKALLKQNGERNYLPLKGKSMAMIFAKRSTRTRVSTETGFFLLGGHPMFLGKND  116 (346)
T ss_pred             CCHHHEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCCEEEEECHHHHHHCCCCEEECCHH
T ss_conf             56455053014776899999988899999998468534555567546788862665157750012454278520205312


Q ss_pred             CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCC-CCCCCEEEE
Q ss_conf             0012321079999975300101112101320067763012441240433320246787655766420013-367730461
Q gi|255764473|r   81 MQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGS-VKGKLFSWS  159 (306)
Q Consensus        81 ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~-l~~~~i~~v  159 (306)
T Consensus       117 IqlGvnEs~~DtarVlSsm~d~I~ARV~khsDi~tlak~sSvPiINgL~D~~HPlQ~laD~LTi~E~f~ks~~glkvawi  196 (346)
T KOG1504         117 IQLGVNESLYDTARVLSSMVDIIMARVNKHSDILTLAKYSSVPIINGLCDHFHPLQILADLLTIIEHFGKSVEGLKVAWI  196 (346)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             10244222676999999988999998762335999864268863324202467489999999999987343455079997


Q ss_pred             CCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHH----HCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHH
Q ss_conf             045555431010012331257652000013210000243----2013322213664663068733222100000022013
Q gi|255764473|r  160 GDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA  235 (306)
Q Consensus       160 Gd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~----~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~  235 (306)
T Consensus       197 GD~NNvlhs~mia~ak~gih~s~atPkg~e~d~div~~akq~a~eNgsk~eltnDp~eA~~~anvlvtDtwiSMGqe~ek  276 (346)
T KOG1504         197 GDGNNVLHSWMIAAAKFGIHFSCATPKGYEPDKDIVSKAKQAAEENGSKFELTNDPLEAVIGANVLVTDTWISMGQEDEK  276 (346)
T ss_pred             CCCCHHHHHHHHHHHHCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHCCCCEEEEEHHHHCCHHHHH
T ss_conf             26508899999986331437885289998856689999999987058778974582886348867997314442637799


Q ss_pred             HHH-HCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             331-001112336889962898729925999874873576796799710686877559999999999625
Q gi|255764473|r  236 REE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       236 ~~~-~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
T Consensus       277 earlkaFqGfQV~~el~kvA~~~~~FmHCLPr~~-eEVsdeVfy~~~SiVF~eAENR~~a~mavm~~ll~  345 (346)
T KOG1504         277 EARLKAFQGFQVTEELMKVAGPKAKFMHCLPRHP-EEVSDEVFYGPYSIVFPEAENRKWAQMAVMLHLLG  345 (346)
T ss_pred             HHHHHHHCCCEEHHHHHHHHCCCCEEEECCCCCH-HHCCCCEEECCCEEECCHHHHHHHHHHHHHHHHHC
T ss_conf             9999862372230899964178745762168880-22367526545405551333057899999999843