HHsearch alignment for GI: 255764473 and conserved domain: PRK01713

>PRK01713 ornithine carbamoyltransferase; Provisional.
Probab=100.00  E-value=0  Score=651.16  Aligned_cols=299  Identities=36%  Similarity=0.605  Sum_probs=279.7

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87717844589999999999999999665236665443798799994288835789999898634754333321000012
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG   84 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~   84 (306)
T Consensus         7 ~rhlL~~~d~s~~ei~~il~~A~~~K~~~~~~~~~~~L~gK~v~~lF~epSTRTR~SFE~A~~~LGg~~i~l~~~~s~~~   86 (334)
T PRK01713          7 NRHLLSLVNHTEREIKYLLDLSRDLKRAKYAGTEQQRLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDPTSSQIG   86 (334)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             99838700099999999999999998665268878778999899984799626899999999985990998475124578


Q ss_pred             CCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCC-CCCCCEEEECCC-
Q ss_conf             321079999975300101112101320067763012441240433320246787655766420013-367730461045-
Q gi|255764473|r   85 RAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGS-VKGKLFSWSGDG-  162 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~-l~~~~i~~vGd~-  162 (306)
T Consensus        87 kgEsl~Dta~vls~~~D~iv~R~~~~~~~~~~a~~~~vPVINg~~~~~HPtQ~LaDl~Ti~E~~~~~l~gl~ia~vGD~~  166 (334)
T PRK01713         87 HKESMKDTARVLGRMYDAIEYRGFKQSIVNELAKYAGVPVFNGLTDEFHPTQMLADVLTMIEHCEKPLSEISYVYIGDAR  166 (334)
T ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCC
T ss_conf             99899999999996285899954672899999986599889389787775899988999999841654674999938975


Q ss_pred             CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHH----HHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHH-
Q ss_conf             5554310100123312576520000132100002----43201332221366466306873322210000002201333-
Q gi|255764473|r  163 NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-  237 (306)
Q Consensus       163 ~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~----~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~-  237 (306)
T Consensus       167 nnv~~S~~~~~~~lG~~v~i~~P~~~~p~~~~~~~~~~~~~~~g~~i~~~~d~~~a~~~aDvvytd~w~smg~~~~~~~e  246 (334)
T PRK01713        167 NNMGNSLLLIGAKLGMDVRICAPKALLPEDSLVEMCEKFAKESGARITVTDDIDTAVKGVDFVHTDVWVSMGEPLETWGE  246 (334)
T ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHCCCCEEEEEEEEECCCHHHHHHH
T ss_conf             41889999999977997999889765878899999999999719908996078888567868987667636645777889


Q ss_pred             -HHCCCCCCCCHHHHHCC-CCCCEEECCCCC-------------------CCCCCCCHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             -10011123368899628-987299259998-------------------748735767967997106868775599999
Q gi|255764473|r  238 -EHVFQPFQVNLSLMSMA-HPDALFMHCLPA-------------------HRGEEVINEVLDGPQSVVFDEAENRLHTQK  296 (306)
Q Consensus       238 -~~~~~~y~i~~~~l~~a-~~~~~vmHplP~-------------------~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~  296 (306)
T Consensus       247 r~~~~~~y~v~~elm~~~~~~~~~fmHcLPa~~~~e~~~~~~~~~~~P~~~rG~EIt~~V~d~p~S~if~QAeNrlh~~k  326 (334)
T PRK01713        247 RIDLLMPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKVGRQIAEKYPALANGIEVTEEVFESPMNIAFEQAENRMHTIK  326 (334)
T ss_pred             HHHHHCCCEEHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHCCCCCCCEEECHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             98775178362999975289992996888666531000002456526888787286589968898732689875599999


Q ss_pred             HHHHHHH
Q ss_conf             9999962
Q gi|255764473|r  297 AILLWCF  303 (306)
Q Consensus       297 AiL~~~l  303 (306)
T Consensus       327 AvL~~~L  333 (334)
T PRK01713        327 AVMVASL  333 (334)
T ss_pred             HHHHHHH
T ss_conf             9999986