HHsearch alignment for GI: 255764473 and conserved domain: PRK02102

>PRK02102 ornithine carbamoyltransferase; Validated.
Probab=100.00  E-value=0  Score=673.61  Aligned_cols=301  Identities=41%  Similarity=0.689  Sum_probs=284.9

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87717844589999999999999999665236665443798799994288835789999898634754333321000012
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG   84 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~   84 (306)
T Consensus         7 ~kh~L~~~dls~~ei~~il~~A~~~k~~~~~~~~~~~L~gk~v~~lF~epSTRTR~SFe~A~~~LGg~~i~l~~~~s~~~   86 (331)
T PRK02102          7 GRSFLKLLDFTPAEIEYLIDLSIELKAAKKAGIEHQYLKGKNIALIFEKTSTRTRCAFEVAAIDLGAHVTYLGPNDIQLG   86 (331)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             99818500099999999999999998766458877667999899995589730599999999985990995787556377


Q ss_pred             CCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCC-C
Q ss_conf             321079999975300101112101320067763012441240433320246787655766420013367730461045-5
Q gi|255764473|r   85 RAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-N  163 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~-~  163 (306)
T Consensus        87 kGEs~~Dt~~~Ls~~~D~iviR~~~~~~~~~~a~~~~vPVIN~~~~~~HPtQ~L~Dl~Ti~e~~g~l~gl~i~~vGD~~n  166 (331)
T PRK02102         87 KKESMEDTARVLGRMYDGIEYRGFSQEIVEELAKYSGVPVWNGLTDEWHPTQMLADFMTMKEHFGPLKGLKLAYLGDGRN  166 (331)
T ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC
T ss_conf             89898999999997516789962772899999974798645488876487999999999999838756773899788764


Q ss_pred             CCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHH----HCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHH-HHH
Q ss_conf             55431010012331257652000013210000243----2013322213664663068733222100000022013-331
Q gi|255764473|r  164 NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE  238 (306)
Q Consensus       164 ~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~----~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~-~~~  238 (306)
T Consensus       167 nVa~S~~~~~~~lG~~v~~~~P~~~~p~~~~~~~~~~~~~~~g~~i~~~~d~~ea~~~aDVvytdvw~sm~~~~~~~~r~  246 (331)
T PRK02102        167 NMANSLLVGGAKLGMDVRICAPKSLWPEEELVAQAKEIAKETGAKITITEDVEEAVKGADVIYTDVWVSMGEEEKWEERI  246 (331)
T ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCEEEEEECHHHHHCCCCEEEEEHHHCCCHHHHHHHHH
T ss_conf             24668999998559859997586448897999999999998299389995666663357656530332233477799999


Q ss_pred             HCCCCCCCCHHHHHCC-CCCCEEECCCCC-----------------CCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             0011123368899628-987299259998-----------------7487357679679971068687755999999999
Q gi|255764473|r  239 HVFQPFQVNLSLMSMA-HPDALFMHCLPA-----------------HRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL  300 (306)
Q Consensus       239 ~~~~~y~i~~~~l~~a-~~~~~vmHplP~-----------------~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~  300 (306)
T Consensus       247 ~~~~~y~v~~~l~~~a~k~~ai~MH~LPa~~n~~~~~~~~~~~~~~~RG~EI~~~V~d~p~S~i~~QaeNrl~~r~AvL~  326 (331)
T PRK02102        247 KLLKPYQVNMDLMKATGNPDVIFMHCLPAFHDTETKVGKEIAEKYGLKGLEVTDEVFESKYSIVFDEAENRMHTIKAVMV  326 (331)
T ss_pred             HHHCCCEECHHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHCCCCCCCCEEECHHHHCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             87407637899997347999489734877532232100222013577753866888488763025477521999999999


Q ss_pred             HHHCC
Q ss_conf             96255
Q gi|255764473|r  301 WCFGI  305 (306)
Q Consensus       301 ~~lG~  305 (306)
T Consensus       327 ~~LGd  331 (331)
T PRK02102        327 ATLGD  331 (331)
T ss_pred             HHHCC
T ss_conf             98478