HHsearch alignment for GI: 255764473 and conserved domain: PRK07200

>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated.
Probab=100.00  E-value=0  Score=599.84  Aligned_cols=301  Identities=25%  Similarity=0.349  Sum_probs=270.4

Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88771784458999999999999999966523666544379879999428883578999989863475433332100001
Q gi|255764473|r    4 YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQL   83 (306)
Q Consensus         4 ~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~   83 (306)
T Consensus        19 ~grdfL~l~D~t~eEi~~lldlA~~LK~~k~~g~~~~~l~gk~~~~IFeK~STRTR~SFEva~~~LGg~~~yL~p~~~Ql   98 (395)
T PRK07200         19 HEKDFLLTWEQTPDELKQVLDVAAALKALRAENISTKVFNSGLGISVFRDNSTRTRFSYASALNLLGLAQQDLDEGKSQI   98 (395)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             68877720139999999999999999999976997744589738999706983468999999997799769738987627


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEE-----ECCCCHHHHHHCCC-------C----CCEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             23210799999753001011121-----01320067763012-------4----41240433320246787655766420
Q gi|255764473|r   84 GRAETIGDTAKVLSRYVDAIVMR-----TTNHSRLLELTEYA-------T----VPVINALTDNTHPCQIIADIMTFEEH  147 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~~D~iviR-----~~~~~~~~~~~~~~-------~----vpvINa~~~~~HPtQaL~D~~Ti~e~  147 (306)
T Consensus        99 G~gEsi~DTArVLsR~~D~I~~R~~~~~g~g~~~~~e~a~~~~~~~~~~~vp~~~pViN~LTD~~HPtQ~LADllTi~E~  178 (395)
T PRK07200         99 AHGETVRETANMISFCADAIGIRDDMYLGAGNAYMREVGAALDDGYKQGVLPQRPALVNLQCDIDHPTQSMADLAWLREH  178 (395)
T ss_pred             CCCCCHHHHHHHHHHHHHEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCHHHHHHHHHHHHH
T ss_conf             79988899999998550258873033345414899999999988887346765551232555577858999999999998


Q ss_pred             CCCC---CCCCEEEE-------CCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHH----CCCCCCCCCCCHHH
Q ss_conf             0133---67730461-------0455554310100123312576520000132100002432----01332221366466
Q gi|255764473|r  148 RGSV---KGKLFSWS-------GDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQ  213 (306)
Q Consensus       148 ~g~l---~~~~i~~v-------Gd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~----~~g~~i~~~~d~~e  213 (306)
T Consensus       179 ~G~l~~lkg~k~~~~~~y~~~~g~~~nv~~sl~~~~a~lGmdv~ia~P~gy~p~~~~v~~A~~~A~~sG~~i~iT~D~~e  258 (395)
T PRK07200        179 FGSLENLKGKKIAMTWAYSPSYGKPLSVPQGIIGLMTRFGMDVTLAHPEGYDLIPDVVEVAKNNAKASGGSFRQVTSMEE  258 (395)
T ss_pred             HCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCEEEEECCHHH
T ss_conf             18732457863899974146677422689999999977497499978987798989999999999983998999679999


Q ss_pred             HCCCCCCCCCCCEEECC---CCCHH-----------------HHHHCCCCCCCCHHHHHCC-CCCCEEECCCCCC-----
Q ss_conf             30687332221000000---22013-----------------3310011123368899628-9872992599987-----
Q gi|255764473|r  214 AVKGAHCVFTDTWISMN---QEFKA-----------------REEHVFQPFQVNLSLMSMA-HPDALFMHCLPAH-----  267 (306)
Q Consensus       214 al~~aD~V~~~~~~~~~---~~~~~-----------------~~~~~~~~y~i~~~~l~~a-~~~~~vmHplP~~-----  267 (306)
T Consensus       259 Av~gADvIYTDvW~sm~~~~e~~e~l~~~~~~~~~~~e~e~~~r~~~~~~yqVn~~lm~~a~~~~aifMHCLPA~~~~~~  338 (395)
T PRK07200        259 AFKDADIVYPKSWAPYKVMEERTELLRANDHEGLKALEKQCLAQNAQHKDWHCTEEMMELTKDGEALYMHCLPADISGVS  338 (395)
T ss_pred             HHCCCCEEECCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCEECHHHHHHCCCCCEEEEECCCCCCCCCC
T ss_conf             95799999727877765443106653123102344567777655304789546799998427998599836899876667


Q ss_pred             -CCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             -4873576796799710686877559999999999625
Q gi|255764473|r  268 -RGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       268 -rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
T Consensus       339 ~r~~EVTdeVfd~p~SvVFdEAENRlHtiKAvMvat~~  376 (395)
T PRK07200        339 CKEGEVTEGVFEKYRIATYKEASWKPYIIAAMILSRKY  376 (395)
T ss_pred             CCCCEECHHHHCCCCCCEECHHCCHHHHHHHHHHHHHC
T ss_conf             76760127540577762433121228999999999530