HHsearch alignment for GI: 255764473 and conserved domain: PRK07574

>PRK07574 formate dehydrogenase; Provisional.
Probab=96.02  E-value=0.048  Score=33.68  Aligned_cols=143  Identities=13%  Similarity=0.154  Sum_probs=87.5

Q ss_pred             CHHHHHHCCCCCCEECCC-CC-CCHHHHHHHHHHHHHHHC---------C------------CCCCCCEEEECCCCCCCC
Q ss_conf             006776301244124043-33-202467876557664200---------1------------336773046104555543
Q gi|255764473|r  111 SRLLELTEYATVPVINAL-TD-NTHPCQIIADIMTFEEHR---------G------------SVKGKLFSWSGDGNNILH  167 (306)
Q Consensus       111 ~~~~~~~~~~~vpvINa~-~~-~~HPtQaL~D~~Ti~e~~---------g------------~l~~~~i~~vGd~~~v~h  167 (306)
T Consensus       127 nIDL~AA~erGI~V~nvpG~Ns~SVAEhtv~liLal~R~i~~~~~~v~~G~W~~a~~~~~~~EL~GKTlGIVG~-GrIG~  205 (385)
T PRK07574        127 HVDLQAASEHNITVAEVTGSNSISVAEHVVMMILALVRNYLPSHRQVVDGGWNIADCVSRSYDLEGMTVGTVGA-GRIGL  205 (385)
T ss_pred             HHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHCCCCCEECCCCEEEEECC-CHHHH
T ss_conf             45499899789999959998719999999999999975888899999849985121256643268998999897-88999


Q ss_pred             CHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCC
Q ss_conf             10100123312576520000132100002432013322213664663068733222100000022013331001112336
Q gi|255764473|r  168 SLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVN  247 (306)
Q Consensus       168 S~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~  247 (306)
T Consensus       206 ~VArra~aFgm~Vl~yDp~~l--~~~---~e~~l--g~~~~~sldeLl~~sDvVslh~--PLt~e---------T~~Lin  267 (385)
T PRK07574        206 AVLRRLKPFDVTLHYTDRHRL--PAE---VEQEL--GLTYHPDVDSLVSVCDVVTIHC--PLHPE---------TEHLFD  267 (385)
T ss_pred             HHHHHHHHCCCEEEEECCCCC--CHH---HHHHC--CCCCCCCHHHHHHHCCEEEECC--CCCHH---------HHHHCC
T ss_conf             999999977998998588669--889---99971--9865689999986289699866--79857---------740102


Q ss_pred             HHHHHCCCCCCEEECCCCCCCCCCCCHH
Q ss_conf             8899628987299259998748735767
Q gi|255764473|r  248 LSLMSMAHPDALFMHCLPAHRGEEVINE  275 (306)
Q Consensus       248 ~~~l~~a~~~~~vmHplP~~rg~EI~~~  275 (306)
T Consensus       268 ~~~l~~MK~ga~LVNtA---RG~iVDe~  292 (385)
T PRK07574        268 KDVLSRMKRGSYLVNTA---RGKIVDRD  292 (385)
T ss_pred             HHHHHCCCCCCEEEECC---CCHHCCHH
T ss_conf             99994389981899888---61101999