HHsearch alignment for GI: 255764473 and conserved domain: PRK13376

>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional.
Probab=100.00  E-value=0  Score=402.84  Aligned_cols=302  Identities=20%  Similarity=0.243  Sum_probs=253.6

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCC---CCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCC-CCCC
Q ss_conf             877178445899999999999999996652366654---437987999942888357899998986347543333-2100
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK---PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFL-SGSE   80 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~---~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~-~~~~   80 (306)
T Consensus         7 grsl~vi~d~sv~eq~fly~~tk~lk~~~~~~~d~~ef~ik~d~~iyivFfEPSTRTRlSFesAa~~lgG~vV~~~~~~s   86 (524)
T PRK13376          7 GRSLTVIEDLSVEEQLFLYEKTKELKQKWYNKEDVSEFQIKKDVGIYIVFVEPSTRTKESFINAAKFHKNAKVNIFDSEH   86 (524)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEECCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             65035430356588899999899999986340332120451544289999668773077799999984897675337665


Q ss_pred             CCCCCCCCHHHHHHHHHHCCC--EEEEEECCCCH-------HHHHHCCCCC---CEECCCCC-CCHHHHHHHHHHHHHHH
Q ss_conf             001232107999997530010--11121013200-------6776301244---12404333-20246787655766420
Q gi|255764473|r   81 MQLGRAETIGDTAKVLSRYVD--AIVMRTTNHSR-------LLELTEYATV---PVINALTD-NTHPCQIIADIMTFEEH  147 (306)
Q Consensus        81 ss~~kgEsl~Dt~~~ls~~~D--~iviR~~~~~~-------~~~~~~~~~v---pvINa~~~-~~HPtQaL~D~~Ti~e~  147 (306)
T Consensus        87 SS~~KGESL~DTirvlsgYsDasIIVmRHP~eGaaRll~e~v~efA~~~~v~vp~~INAGDG~nEHPTQaLLDLfTI~ee  166 (524)
T PRK13376         87 SSFNKQESYVDTFNMLTGYSDYSIFIVRTRLEGVCRLLERKVSEFASRHGIERPAFINAGDGKHEHPTQELLDEFTFLEQ  166 (524)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             52015850999999986336762799947887721456788998886448987853778889888832899999999998


Q ss_pred             CC-CCCCCCEEEECC--CCCCCCCHHHCCCCC-CEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCC--
Q ss_conf             01-336773046104--555543101001233-125765200001321000024320133222136646630687332--
Q gi|255764473|r  148 RG-SVKGKLFSWSGD--GNNILHSLIEGAARF-NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCV--  221 (306)
Q Consensus       148 ~g-~l~~~~i~~vGd--~~~v~hS~i~~~~~~-g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V--  221 (306)
T Consensus       167 ~g~~~~~I~IAlVGDLK~GRTVHSL~~aL~~fkNV~~~LISPeEL~MP~~yiekmk~~G~evr~f~si~eyl~~~~~a~i  246 (524)
T PRK13376        167 NNFDNSFIHIALVGDLLHGRTVHSKVNGLKIFKNVKVDLIAPEELQMPEHYIEKMKKNGFEVRIFSSIEEYLKQKDVAKI  246 (524)
T ss_pred             HCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCEEEEECHHHHCCCHHHHHHHHHCCCEEEECCHHHHHHHCCCCHHE
T ss_conf             38777855999974434571188899888762483899988788069889999998669148851049998704761124


Q ss_pred             -CCCCE--EECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCC-CCCCHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             -22100--0000220133310011123368899628987299259998748-7357679679971068687755999999
Q gi|255764473|r  222 -FTDTW--ISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRG-EEVINEVLDGPQSVVFDEAENRLHTQKA  297 (306)
Q Consensus       222 -~~~~~--~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg-~EI~~~v~d~~~s~~~~Qa~Ngl~vr~A  297 (306)
T Consensus       247 wyftrlqlermge~ilek~~~lr~~vtf~k~~l~~~pe~~kfyhplpr~~~~ptip~fld~~plngwe~qa~ngy~~r~v  326 (524)
T PRK13376        247 WYFTRLQLERMGEDILEKEHILRKSVTFRKEFLDKLPEGVKFYHPLPRHKVYPTIPTFLDTLPLNGWETQAINGYWVRIV  326 (524)
T ss_pred             EEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCEEHHHH
T ss_conf             77508889877788888899987652027878753636660036688555689876423578887155553055446999


Q ss_pred             HHHHHHCCC
Q ss_conf             999962559
Q gi|255764473|r  298 ILLWCFGII  306 (306)
Q Consensus       298 iL~~~lG~~  306 (306)
T Consensus       327 llsmlgga~  335 (524)
T PRK13376        327 LLSMLGGAL  335 (524)
T ss_pred             HHHHHCCCC
T ss_conf             999854642