HHsearch alignment for GI: 255764473 and conserved domain: cd01080

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme. Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well a
Probab=91.03  E-value=0.27  Score=28.75  Aligned_cols=73  Identities=15%  Similarity=0.094  Sum_probs=52.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCC
Q ss_conf             32024678765576642001336773046104555543101001233125765200001321000024320133222136
Q gi|255764473|r  130 DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFH  209 (306)
Q Consensus       130 ~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~  209 (306)
T Consensus        21 ~~~~PcTp~ai~~ll~~~~i~l~Gk~vvViGrS~iVG~Pla~lL~~~~atVt~chs~---------------------T~   79 (168)
T cd01080          21 PGFIPCTPAGILELLKRYGIDLAGKKVVVVGRSNIVGKPLAALLLNRNATVTVCHSK---------------------TK   79 (168)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEECCC---------------------CC
T ss_conf             988698499999999994988778569998787300899999998489979997689---------------------88


Q ss_pred             CHHHHCCCCCCCCC
Q ss_conf             64663068733222
Q gi|255764473|r  210 DAVQAVKGAHCVFT  223 (306)
Q Consensus       210 d~~eal~~aD~V~~  223 (306)
T Consensus        80 ~l~~~~~~ADIvIs   93 (168)
T cd01080          80 NLKEHTKQADIVIV   93 (168)
T ss_pred             CHHHHHHHCCEEEE
T ss_conf             97997410453554