Query         gi|255764473|ref|YP_003064846.2| ornithine carbamoyltransferase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 306
No_of_seqs    122 out of 4501
Neff          7.3 
Searched_HMMs 39220
Date          Sun May 29 16:39:43 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764473.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00658 orni_carb_tr ornithi 100.0       0       0  760.6  18.5  299    6-304     1-341 (341)
  2 PRK00779 ornithine carbamoyltr 100.0       0       0  687.7  22.8  302    4-305     4-307 (308)
  3 PRK02255 putrescine carbamoylt 100.0       0       0  681.7  22.9  303    2-304     1-313 (341)
  4 PRK02102 ornithine carbamoyltr 100.0       0       0  673.6  22.6  301    5-305     7-331 (331)
  5 PRK03515 ornithine carbamoyltr 100.0       0       0  663.7  22.7  302    4-305     5-334 (334)
  6 PRK12562 ornithine carbamoyltr 100.0       0       0  662.1  22.7  302    4-305     5-334 (334)
  7 PRK04284 ornithine carbamoyltr 100.0       0       0  658.8  22.6  301    5-305     6-332 (332)
  8 PRK08192 aspartate carbamoyltr 100.0       0       0  656.7  23.6  304    2-305     2-318 (338)
  9 COG0078 ArgF Ornithine carbamo 100.0       0       0  660.0  20.8  302    2-304     3-310 (310)
 10 PRK00856 pyrB aspartate carbam 100.0       0       0  654.6  22.4  293    4-305     5-303 (304)
 11 PRK01713 ornithine carbamoyltr 100.0       0       0  651.2  23.0  299    5-303     7-333 (334)
 12 TIGR00670 asp_carb_tr aspartat 100.0       0       0  656.0  18.2  299    6-304     1-336 (336)
 13 TIGR03316 ygeW probable carbam 100.0       0       0  638.4  22.1  299    4-302     2-357 (357)
 14 PRK13814 pyrB aspartate carbam 100.0       0       0  633.0  22.6  297    1-304     1-304 (310)
 15 PRK04523 N-acetylornithine car 100.0       0       0  619.2  21.5  297    2-305     1-335 (335)
 16 COG0540 PyrB Aspartate carbamo 100.0       0       0  617.2  20.1  302    2-305     4-313 (316)
 17 PRK07200 aspartate/ornithine c 100.0       0       0  599.8  20.5  301    4-304    19-376 (395)
 18 PRK11891 aspartate carbamoyltr 100.0       0       0  586.9  21.4  300    5-305    88-400 (430)
 19 KOG1504 consensus              100.0       0       0  536.6  12.4  301    3-304    37-345 (346)
 20 PRK13376 pyrB bifunctional asp 100.0       0       0  402.8  17.1  302    5-306     7-335 (524)
 21 pfam02729 OTCace_N Aspartate/o 100.0       0       0  340.0  11.5  140    6-147     1-140 (140)
 22 pfam00185 OTCace Aspartate/orn 100.0 8.9E-41 2.8E-45  287.4   8.6  148  152-302     1-155 (155)
 23 PRK00257 erythronate-4-phospha  97.6 0.00051 1.3E-08   46.6   7.9  140  115-277    75-217 (379)
 24 PRK10792 bifunctional 5,10-met  96.7   0.034 8.8E-07   34.6  10.4  187    8-223     5-208 (288)
 25 COG0111 SerA Phosphoglycerate   96.6   0.011 2.9E-07   37.7   7.4  140  114-276    82-242 (324)
 26 PRK08605 D-lactate dehydrogena  96.5   0.074 1.9E-06   32.4  10.9  129  114-264    85-236 (332)
 27 PRK13243 glyoxylate reductase;  96.5    0.02 5.1E-07   36.1   8.0  140  111-274    80-247 (333)
 28 PRK06932 glycerate dehydrogena  96.4   0.025 6.3E-07   35.6   7.7  146   94-264    58-233 (314)
 29 PRK11790 D-3-phosphoglycerate   96.2   0.079   2E-06   32.3   9.6  151   99-275    53-247 (409)
 30 PRK08410 2-hydroxyacid dehydro  96.1   0.033 8.3E-07   34.8   7.2  130  111-264    76-232 (311)
 31 PRK07574 formate dehydrogenase  96.0   0.048 1.2E-06   33.7   7.8  143  111-275   127-292 (385)
 32 PRK13581 D-3-phosphoglycerate   95.7    0.08   2E-06   32.2   7.8  137  114-274    78-235 (524)
 33 PRK06487 glycerate dehydrogena  95.5   0.086 2.2E-06   32.0   7.3  127  112-264    80-233 (317)
 34 PTZ00075 S-adenosyl-L-homocyst  95.4    0.25 6.5E-06   28.9  14.0  242    6-279     8-354 (476)
 35 PRK12480 D-lactate dehydrogena  95.0    0.33 8.3E-06   28.2   9.1  184   50-270    30-237 (330)
 36 pfam02826 2-Hacid_dh_C D-isome  94.8   0.043 1.1E-06   34.0   4.2  102  150-276    33-134 (176)
 37 PRK08306 dipicolinate synthase  94.3    0.49 1.2E-05   27.1   8.9  199   57-265    44-266 (296)
 38 PRK06436 glycerate dehydrogena  93.9     0.4   1E-05   27.7   7.4   61  150-223   119-179 (303)
 39 TIGR02853 spore_dpaA dipicolin  93.6    0.36 9.1E-06   27.9   6.8  193   47-261    28-238 (288)
 40 COG1052 LdhA Lactate dehydroge  91.7    0.33 8.4E-06   28.2   4.5  103  150-276   143-245 (324)
 41 pfam05221 AdoHcyase S-adenosyl  91.7     1.2   3E-05   24.6  13.5  241    9-280     8-311 (430)
 42 pfam01488 Shikimate_DH Shikima  91.6    0.19 4.8E-06   29.8   3.1  116  145-283     4-124 (134)
 43 cd01080 NAD_bind_m-THF_DH_Cycl  91.0    0.27 6.9E-06   28.8   3.5   73  130-223    21-93  (168)
 44 COG0190 FolD 5,10-methylene-te  90.8     1.4 3.6E-05   24.1  11.0  185    9-223     3-205 (283)
 45 PRK00045 hemA glutamyl-tRNA re  90.4    0.28   7E-06   28.7   3.1  115  144-281   173-294 (429)
 46 TIGR00407 proA gamma-glutamyl   90.3    0.15 3.7E-06   30.5   1.6   46   86-133   178-223 (415)
 47 pfam02882 THF_DHG_CYH_C Tetrah  90.0    0.36 9.1E-06   27.9   3.4   73  130-223    13-85  (159)
 48 PRK12862 malic enzyme; Reviewe  89.8     1.7 4.3E-05   23.5   7.3  185   86-292   121-326 (761)
 49 PRK07232 malic enzyme; Reviewe  87.6     2.4 6.1E-05   22.6   8.3  186   85-292   114-320 (753)
 50 cd05296 GH4_P_beta_glucosidase  87.2    0.41 1.1E-05   27.5   2.2  136    9-146    32-184 (419)
 51 PRK07531 bifunctional 3-hydrox  87.1    0.46 1.2E-05   27.2   2.4   29   91-119    95-125 (489)
 52 cd00401 AdoHcyase S-adenosyl-L  86.9     2.6 6.7E-05   22.3  14.5  242    9-281     1-304 (413)
 53 cd05197 GH4_glycoside_hydrolas  86.8    0.23 5.8E-06   29.2   0.7  135    9-145    32-183 (425)
 54 cd01336 MDH_cytoplasmic_cytoso  86.6    0.88 2.2E-05   25.4   3.6   61   68-129    76-154 (325)
 55 PRK10355 xylF D-xylose transpo  86.4     2.2 5.5E-05   22.8   5.5   82   44-128    25-113 (330)
 56 cd05297 GH4_alpha_glucosidase_  85.9    0.33 8.4E-06   28.2   1.1  152    9-160    32-202 (423)
 57 PRK05442 malate dehydrogenase;  85.8     1.1 2.9E-05   24.7   3.8   24   69-93     79-102 (325)
 58 PRK05476 S-adenosyl-L-homocyst  85.6       3 7.7E-05   21.9  15.6  240    9-279    10-308 (427)
 59 cd05298 GH4_GlvA_pagL_like Gly  85.4    0.35 8.8E-06   28.0   1.0  136    8-145    31-183 (437)
 60 COG0014 ProA Gamma-glutamyl ph  85.4    0.59 1.5E-05   26.5   2.2   47   86-134   184-230 (417)
 61 PRK01438 murD UDP-N-acetylmura  85.0    0.62 1.6E-05   26.4   2.2   36   41-79     11-46  (481)
 62 PRK12861 malic enzyme; Reviewe  84.5     3.4 8.7E-05   21.5   6.4  185   86-292   116-321 (762)
 63 pfam02056 Glyco_hydro_4 Family  84.5     0.4   1E-05   27.7   1.0   79  203-285    59-141 (183)
 64 cd01338 MDH_choloroplast_like   84.4     1.4 3.5E-05   24.1   3.7   24   69-93     77-100 (322)
 65 cd05212 NAD_bind_m-THF_DH_Cycl  84.1     1.4 3.6E-05   24.0   3.7   63  141-224    15-78  (140)
 66 cd06391 PBP1_iGluR_delta_2 N-t  83.8     3.6 9.3E-05   21.3   8.0  102   46-147     1-138 (400)
 67 TIGR02012 tigrfam_recA protein  83.3     3.7 9.4E-05   21.3   5.5  101   43-151    54-178 (322)
 68 pfam06506 PrpR_N Propionate ca  83.3     3.1   8E-05   21.8   5.2  101   95-207    28-128 (169)
 69 PRK07631 amidophosphoribosyltr  83.1     2.8 7.1E-05   22.1   4.9  133   49-191   235-392 (475)
 70 cd06313 PBP1_ABC_sugar_binding  82.9     1.6   4E-05   23.7   3.5   69   57-128    16-87  (272)
 71 cd01981 Pchlide_reductase_B Pc  82.5     3.8 9.7E-05   21.2   5.4   20   87-106    71-92  (430)
 72 pfam00670 AdoHcyase_NAD S-aden  81.8     4.3 0.00011   20.9   6.4  117  136-280     7-124 (162)
 73 cd06302 PBP1_LsrB_Quorum_Sensi  81.8       2 5.2E-05   23.0   3.7   70   58-129    17-89  (298)
 74 PRK06718 precorrin-2 dehydroge  81.7       1 2.6E-05   24.9   2.2   71  148-223     5-76  (202)
 75 COG1486 CelF Alpha-galactosida  81.3     1.7 4.3E-05   23.5   3.2   24   10-33     36-59  (442)
 76 cd04510 consensus               81.2     1.5 3.8E-05   23.9   2.9  126   87-221   105-257 (334)
 77 cd01540 PBP1_arabinose_binding  80.6     2.8 7.1E-05   22.1   4.1   65   59-127    18-85  (289)
 78 PRK06781 amidophosphoribosyltr  80.6     3.4 8.8E-05   21.5   4.6  131   51-191   237-392 (471)
 79 PRK01710 murD UDP-N-acetylmura  80.3     1.1 2.8E-05   24.8   1.9   37   40-79     10-46  (458)
 80 cd06316 PBP1_ABC_sugar_binding  80.2     2.1 5.3E-05   22.9   3.4   68   58-127    17-87  (294)
 81 PRK06388 amidophosphoribosyltr  80.0     3.2 8.1E-05   21.7   4.2  131   51-191   245-400 (474)
 82 PRK09246 amidophosphoribosyltr  79.9     3.5   9E-05   21.4   4.5   89  103-191   296-402 (503)
 83 cd06305 PBP1_methylthioribose_  79.9     2.6 6.7E-05   22.3   3.8   71   57-130    16-89  (273)
 84 PRK05225 ketol-acid reductoiso  79.7     1.6   4E-05   23.8   2.6   13   40-52     33-45  (489)
 85 KOG0069 consensus               79.6     3.4 8.8E-05   21.5   4.3  143  109-275    96-261 (336)
 86 COG0059 IlvC Ketol-acid reduct  79.3     1.6 4.1E-05   23.7   2.5   32   40-74     14-45  (338)
 87 cd05295 MDH_like Malate dehydr  78.1     2.4 6.1E-05   22.5   3.1  123  148-270   118-257 (452)
 88 PRK06129 3-hydroxyacyl-CoA deh  78.1     1.3 3.4E-05   24.2   1.8   14  238-251   245-258 (308)
 89 pfam07991 IlvN Acetohydroxy ac  77.9     1.8 4.6E-05   23.3   2.5   66  151-224     2-67  (165)
 90 cd05213 NAD_bind_Glutamyl_tRNA  77.6    0.89 2.3E-05   25.4   0.8  119  144-285   169-291 (311)
 91 COG0499 SAM1 S-adenosylhomocys  77.6     5.9 0.00015   20.0  13.8  239    9-278    10-308 (420)
 92 cd02812 PcrB_like PcrB_like pr  77.3       6 0.00015   19.9   5.5  164   61-227    16-207 (219)
 93 cd06312 PBP1_ABC_sugar_binding  77.1     3.3 8.3E-05   21.7   3.6   75   51-130    14-91  (271)
 94 cd06382 PBP1_iGluR_Kainate N-t  76.9     6.1 0.00016   19.9   8.6  111   47-161     2-139 (327)
 95 cd00704 MDH Malate dehydrogena  76.0     3.2 8.1E-05   21.7   3.3   23   69-92     75-97  (323)
 96 PRK06719 precorrin-2 dehydroge  76.0     1.5 3.9E-05   23.8   1.6  126  144-284     4-131 (157)
 97 COG1004 Ugd Predicted UDP-gluc  75.9     4.7 0.00012   20.6   4.1   79  144-230   302-390 (414)
 98 PRK07847 amidophosphoribosyltr  75.3     3.8 9.6E-05   21.2   3.5  128   54-191   234-386 (489)
 99 PRK05793 amidophosphoribosyltr  75.1     5.9 0.00015   20.0   4.5  130   52-191   246-400 (472)
100 TIGR01723 hmd_TIGR coenzyme F4  75.1     3.1   8E-05   21.8   3.1   91  150-263    93-184 (359)
101 cd01538 PBP1_ABC_xylose_bindin  75.0     4.2 0.00011   20.9   3.7   68   57-127    16-86  (288)
102 cd01965 Nitrogenase_MoFe_beta_  73.8     7.3 0.00019   19.4   5.3  115   66-183   178-328 (428)
103 cd06307 PBP1_uncharacterized_s  73.6     5.7 0.00014   20.1   4.1   69   59-127    18-89  (275)
104 PRK05562 precorrin-2 dehydroge  73.1     2.5 6.3E-05   22.4   2.1   68  152-223    23-90  (222)
105 COG1648 CysG Siroheme synthase  73.0     2.3 5.8E-05   22.7   1.9   71  148-223     7-78  (210)
106 TIGR00575 dnlj DNA ligase, NAD  73.0     7.7  0.0002   19.2   6.4   53   56-109   239-299 (706)
107 PRK05479 ketol-acid reductoiso  73.0     2.7 6.9E-05   22.2   2.3   33   39-74     12-44  (336)
108 cd06315 PBP1_ABC_sugar_binding  72.9     3.9 9.9E-05   21.2   3.1   66   59-127    19-87  (280)
109 cd06319 PBP1_ABC_sugar_binding  72.8       4  0.0001   21.0   3.1   68   58-128    17-87  (277)
110 cd06318 PBP1_ABC_sugar_binding  72.6     4.3 0.00011   20.9   3.3   70   58-130    17-89  (282)
111 PRK07349 amidophosphoribosyltr  72.2       8  0.0002   19.1   5.2  117   74-191   275-416 (495)
112 PRK07502 cyclohexadienyl dehyd  71.9       2 5.2E-05   23.0   1.5   77   60-137    19-109 (307)
113 cd01078 NAD_bind_H4MPT_DH NADP  71.8     2.5 6.4E-05   22.4   1.9   36  150-185    25-60  (194)
114 cd06317 PBP1_ABC_sugar_binding  71.2     5.1 0.00013   20.4   3.4   68   59-129    19-89  (275)
115 PRK09558 ushA bifunctional UDP  70.8     2.8   7E-05   22.1   1.9   82   70-161    75-171 (551)
116 pfam03807 F420_oxidored NADP o  70.4       2 5.1E-05   23.0   1.2   65  155-224     1-65  (93)
117 PRK13403 ketol-acid reductoiso  70.3       3 7.7E-05   21.9   2.0   16   40-55     12-27  (335)
118 PRK09260 3-hydroxybutyryl-CoA   70.2     3.4 8.7E-05   21.5   2.3   17   11-27     30-46  (289)
119 COG0373 HemA Glutamyl-tRNA red  69.6     5.9 0.00015   20.0   3.4  106  145-271   170-280 (414)
120 PRK08293 3-hydroxybutyryl-CoA   69.4     3.2 8.2E-05   21.7   2.0   19  100-118   112-130 (288)
121 TIGR01469 cobA_cysG_Cterm urop  69.3     7.1 0.00018   19.4   3.8   13  213-225    22-34  (242)
122 PRK10936 periplasmic sensory p  69.2     9.2 0.00024   18.7   4.4  115   45-161    46-178 (340)
123 PRK09123 amidophosphoribosyltr  68.0     9.7 0.00025   18.5   4.3  117   74-191   254-395 (480)
124 PRK13940 glutamyl-tRNA reducta  67.5     7.2 0.00018   19.4   3.5  106  144-271   172-279 (414)
125 cd01079 NAD_bind_m-THF_DH NAD   67.1     8.1 0.00021   19.1   3.7   92  131-224    31-133 (197)
126 PRK00961 H(2)-dependent methyl  66.8     3.9 9.9E-05   21.1   2.0   25  204-230   128-152 (345)
127 pfam02423 OCD_Mu_crystall Orni  66.8     3.5 8.9E-05   21.5   1.8   77  148-226   124-202 (312)
128 cd06310 PBP1_ABC_sugar_binding  66.8      10 0.00026   18.4   4.2   70   58-129    17-90  (273)
129 pfam01262 AlaDh_PNT_C Alanine   66.6     4.1 0.00011   21.0   2.1  103  150-269    17-125 (150)
130 cd06306 PBP1_TorT-like TorT-li  66.5      10 0.00026   18.4   4.1   85   58-144    17-107 (268)
131 PRK08655 prephenate dehydrogen  65.4     4.8 0.00012   20.6   2.2   91   99-189    58-167 (441)
132 PRK09701 D-allose transporter   65.2      11 0.00028   18.2   4.2   69   57-128    41-114 (311)
133 cd06309 PBP1_YtfQ_like Peripla  65.1     7.9  0.0002   19.1   3.3   67   59-128    18-87  (273)
134 TIGR02371 ala_DH_arch alanine   63.6     5.1 0.00013   20.4   2.1  113  152-268   128-259 (327)
135 pfam01861 DUF43 Protein of unk  62.6      12 0.00032   17.9   5.0   51  131-184    24-74  (243)
136 PRK08525 amidophosphoribosyltr  62.4      12 0.00032   17.8   5.0  116   74-191   243-384 (445)
137 COG0565 LasT rRNA methylase [T  62.0     8.9 0.00023   18.8   3.1   20  206-225    61-80  (242)
138 TIGR00644 recJ single-stranded  61.6     4.6 0.00012   20.7   1.6   96  131-226    30-147 (705)
139 cd06314 PBP1_tmGBP Periplasmic  61.3      12 0.00029   18.1   3.6   71   57-130    15-88  (271)
140 TIGR01035 hemA glutamyl-tRNA r  61.1     6.3 0.00016   19.8   2.2  114  145-281   175-307 (436)
141 cd06311 PBP1_ABC_sugar_binding  60.9      11 0.00029   18.1   3.5   68   59-129    18-93  (274)
142 PRK07272 amidophosphoribosyltr  60.7      13 0.00034   17.6   4.3  130   52-191   240-394 (484)
143 PRK06545 prephenate dehydrogen  60.5       6 0.00015   19.9   2.0   19   99-117    60-78  (357)
144 COG1609 PurR Transcriptional r  60.1      14 0.00035   17.6   6.1  161   13-179    26-207 (333)
145 COG2227 UbiG 2-polyprenyl-3-me  59.5      14 0.00036   17.5   3.9   94   61-172    72-172 (243)
146 cd01545 PBP1_SalR Ligand-bindi  59.5      14 0.00035   17.6   3.7  116   59-178    18-149 (270)
147 TIGR03026 NDP-sugDHase nucleot  59.3     9.9 0.00025   18.5   3.0   73  146-228   306-388 (411)
148 PRK06141 ornithine cyclodeamin  58.5     4.8 0.00012   20.6   1.2   72  152-225   124-197 (313)
149 PRK09424 pntA NAD(P) transhydr  58.4      15 0.00037   17.4   3.7   10  215-224   246-255 (510)
150 pfam01210 NAD_Gly3P_dh_N NAD-d  57.9     7.1 0.00018   19.4   2.0   20  204-223    57-76  (159)
151 PRK08291 ornithine cyclodeamin  57.9     5.7 0.00014   20.1   1.5   74  150-225   129-205 (330)
152 cd01979 Pchlide_reductase_N Pc  57.5      15 0.00038   17.3   3.7   65  117-181   114-184 (396)
153 pfam00793 DAHP_synth_1 DAHP sy  57.4     5.1 0.00013   20.4   1.2  103   12-125    23-134 (271)
154 PRK10653 D-ribose transporter   55.9      16 0.00041   17.1   5.7   83   42-128    24-114 (295)
155 PRK06823 ornithine cyclodeamin  55.7       6 0.00015   19.9   1.4   72  152-225   127-200 (315)
156 PRK05134 3-demethylubiquinone-  55.2      16 0.00042   17.1   3.5  111   40-172    45-162 (233)
157 cd06300 PBP1_ABC_sugar_binding  54.7      17 0.00043   17.0   3.6   82   59-143    18-109 (272)
158 cd06324 PBP1_ABC_sugar_binding  54.5      16 0.00042   17.1   3.4   67   59-129    19-90  (305)
159 PRK00048 dihydrodipicolinate r  54.4      11 0.00027   18.3   2.4   68   99-174    69-141 (265)
160 cd01065 NAD_bind_Shikimate_DH   53.9     8.2 0.00021   19.0   1.8   80  142-224     8-88  (155)
161 PRK13656 trans-2-enoyl-CoA red  53.7      17 0.00044   16.9   3.7   62   45-106    68-138 (400)
162 PRK06701 short chain dehydroge  53.3     5.6 0.00014   20.1   0.9   93   37-136    38-141 (289)
163 PRK06130 3-hydroxybutyryl-CoA   52.3     8.5 0.00022   18.9   1.7   18  101-118   107-124 (310)
164 PRK07589 ornithine cyclodeamin  52.1       7 0.00018   19.5   1.2   72  152-225   128-201 (346)
165 PRK07634 pyrroline-5-carboxyla  51.8      19 0.00047   16.7   4.0   31   99-129    66-100 (245)
166 COG4074 Mth H2-forming N5,N10-  51.6      11 0.00028   18.2   2.1   25  204-230   126-150 (343)
167 TIGR01759 MalateDH-SF1 malate   51.5      16 0.00041   17.1   3.0  119  154-274     4-140 (329)
168 PRK09117 consensus              51.2     9.6 0.00024   18.6   1.8   15   11-25     30-44  (282)
169 cd06322 PBP1_ABC_sugar_binding  51.0      18 0.00047   16.8   3.2  102   58-162    17-130 (267)
170 PRK06035 3-hydroxyacyl-CoA deh  51.0      12 0.00032   17.9   2.3   22  100-121   113-134 (291)
171 pfam00056 Ldh_1_N lactate/mala  50.7      13 0.00033   17.7   2.4  128  155-285     2-140 (142)
172 cd01976 Nitrogenase_MoFe_alpha  50.0      20  0.0005   16.5   4.9   37  148-185   295-331 (421)
173 cd01537 PBP1_Repressors_Sugar_  49.2      20 0.00052   16.4   5.3   80   46-129     1-87  (264)
174 PRK09519 recA recombinase A; R  49.2      20 0.00052   16.4   5.1   99   43-151    59-183 (790)
175 KOG2711 consensus               49.2      14 0.00036   17.5   2.4   44  100-143   106-159 (372)
176 cd06325 PBP1_ABC_uncharacteriz  48.7      21 0.00053   16.4   6.0   72   53-126    10-86  (281)
177 TIGR02685 pter_reduc_Leis pter  48.3      12 0.00031   18.0   1.9  130   80-223   122-258 (283)
178 KOG0068 consensus               48.2      21 0.00054   16.3   4.5  151  100-274    71-243 (406)
179 PRK00197 proA gamma-glutamyl p  48.0      21 0.00054   16.3   4.6   37   96-133   193-229 (416)
180 PRK07417 arogenate dehydrogena  47.7     9.7 0.00025   18.5   1.4   18  100-117    59-76  (280)
181 TIGR01283 nifE nitrogenase MoF  47.6      22 0.00055   16.3   4.5  112  111-226   269-416 (470)
182 KOG2431 consensus               47.6     5.3 0.00013   20.3   0.0   37  115-151   210-253 (546)
183 cd05291 HicDH_like L-2-hydroxy  47.4      22 0.00055   16.3   3.7   22  108-129   119-143 (306)
184 PRK05808 3-hydroxybutyryl-CoA   47.2      12 0.00031   17.9   1.8   30   91-120    99-130 (282)
185 TIGR02992 ectoine_eutC ectoine  47.2     9.7 0.00025   18.5   1.3   30  196-225   173-202 (326)
186 cd06282 PBP1_GntR_like_2 Ligan  47.0      20 0.00051   16.5   2.9  101   56-161    15-124 (266)
187 cd01575 PBP1_GntR Ligand-bindi  46.8      22 0.00057   16.2   3.5  101   58-162    17-125 (268)
188 PRK08618 ornithine cyclodeamin  46.5      11 0.00029   18.2   1.5   72  152-225   126-200 (325)
189 PRK08341 amidophosphoribosyltr  46.5      21 0.00053   16.4   2.9  114   74-191   239-378 (442)
190 PRK06608 threonine dehydratase  46.3      17 0.00043   17.0   2.4   38   50-87     76-113 (330)
191 PRK07660 consensus              46.1      15 0.00039   17.3   2.2   13   11-23     31-43  (283)
192 COG0034 PurF Glutamine phospho  45.0      19 0.00049   16.6   2.5  131   51-191   237-392 (470)
193 pfam02639 DUF188 Uncharacteriz  43.1      21 0.00054   16.3   2.5   21  171-191     4-24  (130)
194 pfam00532 Peripla_BP_1 family.  43.1      25 0.00064   15.8   3.2   69   57-129    18-89  (281)
195 KOG0953 consensus               42.8      14 0.00035   17.6   1.5   12   53-64    108-119 (700)
196 TIGR01304 IMP_DH_rel_2 IMP deh  42.8      25 0.00065   15.8   3.0  120   90-225   146-290 (376)
197 pfam02737 3HCDH_N 3-hydroxyacy  42.6      15 0.00038   17.3   1.7   67  155-223     1-84  (180)
198 cd07079 ALDH_F18-19_ProA-GPR G  42.2      26 0.00066   15.8   5.1  114   13-132    65-223 (406)
199 TIGR00169 leuB 3-isopropylmala  41.9      21 0.00053   16.4   2.3   45   58-105   174-223 (370)
200 PRK12825 fabG 3-ketoacyl-(acyl  41.8      11 0.00029   18.1   1.0   20  167-186   169-188 (250)
201 PRK11199 tyrA bifunctional cho  41.7      20 0.00052   16.5   2.3  166   12-189    64-246 (374)
202 PRK06407 ornithine cyclodeamin  41.6      12  0.0003   18.0   1.0   72  153-226   118-192 (302)
203 TIGR00337 PyrG CTP synthase; I  41.4      23 0.00059   16.1   2.5   95   86-181   201-343 (571)
204 cd01539 PBP1_GGBP Periplasmic   41.2      27 0.00069   15.7   4.4   67   59-127    18-88  (303)
205 PRK12779 putative bifunctional  41.1      26 0.00066   15.8   2.7  187   42-233   304-533 (944)
206 cd06380 PBP1_iGluR_AMPA N-term  41.0      27 0.00069   15.6   8.3  128   47-179     2-155 (382)
207 PRK07530 3-hydroxybutyryl-CoA   41.0      17 0.00044   16.9   1.8   30   91-120   100-131 (292)
208 PRK09354 recA recombinase A; P  40.9      27 0.00069   15.6   5.3   64   43-106    59-145 (350)
209 PRK09545 znuA high-affinity zi  40.8      27  0.0007   15.6   5.1   11  169-179   210-220 (308)
210 PRK10423 transcriptional repre  40.3      28 0.00071   15.6   6.9  146   13-162    24-183 (327)
211 PRK12549 shikimate 5-dehydroge  40.2      28 0.00071   15.6   6.1  167   55-223    17-198 (284)
212 COG0324 MiaA tRNA delta(2)-iso  40.2      28 0.00071   15.6   4.5   89   47-143     6-113 (308)
213 cd06320 PBP1_allose_binding Pe  40.1      28 0.00071   15.5   4.1   70   59-130    18-91  (275)
214 PRK10116 universal stress prot  39.5      29 0.00073   15.5   6.2  113    2-164     1-113 (142)
215 TIGR00633 xth exodeoxyribonucl  39.5      16 0.00042   17.0   1.5   51  117-170   106-169 (279)
216 PRK09982 universal stress prot  39.4      29 0.00073   15.5   4.3   29    2-32      1-29  (142)
217 pfam01113 DapB_N Dihydrodipico  38.8      25 0.00065   15.8   2.4   67  154-222     1-70  (122)
218 KOG1370 consensus               38.5      30 0.00075   15.4   5.6  242    9-280    13-315 (434)
219 cd06275 PBP1_PurR Ligand-bindi  38.4      30 0.00076   15.4   3.4  100   59-162    18-126 (269)
220 TIGR00185 rRNA_methyl_2 RNA me  38.1      19 0.00049   16.6   1.7   42  156-198     5-47  (161)
221 pfam05368 NmrA NmrA-like famil  37.9      11 0.00029   18.1   0.5   29   67-104    41-69  (232)
222 PRK11070 ssDNA exonuclease Rec  37.6      17 0.00043   17.0   1.3   11   97-107   148-158 (574)
223 cd00650 LDH_MDH_like NAD-depen  37.4      19 0.00049   16.6   1.6   40   90-129   100-145 (263)
224 PRK00258 aroE shikimate 5-dehy  37.4      31 0.00079   15.3   6.2  165   50-224    10-191 (275)
225 PRK03806 murD UDP-N-acetylmura  37.2      24 0.00061   16.0   2.1   35   42-79      4-38  (438)
226 TIGR01692 HIBADH 3-hydroxyisob  36.5      21 0.00053   16.4   1.7  149    6-178    19-180 (290)
227 PRK06019 phosphoribosylaminoim  36.1      16 0.00042   17.1   1.0   76   41-119     4-90  (377)
228 cd07615 BAR_Endophilin_A3 The   35.9     5.1 0.00013   20.4  -1.6  136   17-161     7-147 (223)
229 PRK12491 pyrroline-5-carboxyla  35.7      22 0.00057   16.2   1.7   60   55-130    35-99  (272)
230 COG4087 Soluble P-type ATPase   35.6      33 0.00084   15.1   5.1   72   87-164    33-104 (152)
231 pfam05222 AlaDh_PNT_N Alanine   35.6      33 0.00084   15.1   3.0  103  154-270    11-123 (135)
232 cd01574 PBP1_LacI Ligand-bindi  35.5      33 0.00084   15.1   3.3   99   59-161    18-124 (264)
233 PRK03369 murD UDP-N-acetylmura  35.5      32 0.00081   15.2   2.5   12   66-77     31-42  (487)
234 PRK00091 miaA tRNA delta(2)-is  35.2      33 0.00085   15.0   5.1   91   44-139     4-110 (304)
235 pfam12264 Peptidase_C03 Spheri  35.2      33 0.00085   15.0   3.2   43   40-82     84-126 (197)
236 pfam07302 AroM AroM protein. T  35.1      22 0.00057   16.2   1.6   27  163-190   112-138 (221)
237 PRK03094 hypothetical protein;  34.9      20  0.0005   16.5   1.3   60   63-137    14-74  (80)
238 pfam03698 UPF0180 Uncharacteri  34.9      20 0.00051   16.5   1.4   61   63-138    14-75  (80)
239 PRK10200 putative racemase; Pr  34.6      33 0.00083   15.1   2.4   84   86-185    61-149 (230)
240 pfam04918 DltD_M DltD central   34.4      24 0.00061   16.0   1.7   26  135-160     6-31  (163)
241 cd06294 PBP1_ycjW_transcriptio  34.3      34 0.00088   15.0   6.8  113   46-162     1-131 (270)
242 COG0345 ProC Pyrroline-5-carbo  34.3      23 0.00059   16.1   1.6   19   51-72     33-51  (266)
243 PRK08507 prephenate dehydrogen  34.3      25 0.00064   15.9   1.8   20  100-119    59-78  (275)
244 PRK12771 putative glutamate sy  34.1      35 0.00088   14.9   3.5  258   40-305   133-442 (560)
245 TIGR01292 TRX_reduct thioredox  33.5      21 0.00053   16.4   1.2   67  151-219   149-219 (321)
246 cd06284 PBP1_LacI_like_6 Ligan  33.4      36 0.00091   14.9   3.8  100   58-162    17-124 (267)
247 PRK13906 murB UDP-N-acetylenol  33.3      36 0.00091   14.9   3.9   50   47-108    36-87  (307)
248 pfam02601 Exonuc_VII_L Exonucl  32.9      36 0.00092   14.8   2.9   94   45-143    15-127 (295)
249 PRK06199 ornithine cyclodeamin  32.5      23 0.00058   16.2   1.3   76  148-225   150-231 (379)
250 TIGR00635 ruvB Holliday juncti  32.4      23 0.00058   16.1   1.3   39   63-106    48-88  (305)
251 TIGR00421 ubiX_pad polyprenyl   32.4      26 0.00066   15.7   1.6   24  245-268   126-150 (181)
252 cd01541 PBP1_AraR Ligand-bindi  31.9      38 0.00096   14.7   3.3   66   59-129    18-91  (273)
253 COG1484 DnaC DNA replication p  31.8      38 0.00096   14.7   3.1   86  134-228    88-178 (254)
254 COG1160 Predicted GTPases [Gen  31.8      33 0.00084   15.1   2.0  142   40-185    21-208 (444)
255 PRK00005 fmt methionyl-tRNA fo  31.3      38 0.00098   14.6   3.9  106    8-139     5-125 (309)
256 PRK09564 coenzyme A disulfide   31.3      32 0.00082   15.1   1.9   64  122-186   117-181 (443)
257 KOG3892 consensus               31.2      39 0.00098   14.6   2.7   41  119-159   142-187 (407)
258 PRK06198 short chain dehydroge  31.1      20 0.00052   16.5   0.9   20  167-186   169-188 (268)
259 cd01966 Nitrogenase_NifN_1 Nit  31.0      39 0.00099   14.6   5.6   32  150-182   297-328 (417)
260 PRK05579 bifunctional phosphop  30.9      33 0.00085   15.0   1.9   69  149-223   182-271 (392)
261 pfam03060 NPD 2-nitropropane d  30.6      39   0.001   14.6   3.2   22   10-31     41-62  (330)
262 pfam00389 2-Hacid_dh D-isomer   30.6      39   0.001   14.6   7.8   72  114-186    77-169 (313)
263 cd06296 PBP1_CatR_like Ligand-  30.5      40   0.001   14.6   3.2   99   59-162    18-126 (270)
264 TIGR02238 recomb_DMC1 meiotic   30.3      20  0.0005   16.6   0.7   34    1-34     29-62  (314)
265 cd07614 BAR_Endophilin_A2 The   30.3     5.3 0.00014   20.3  -2.2  134   17-159     7-145 (223)
266 PRK07424 bifunctional sterol d  29.9      24 0.00061   16.0   1.1  115  139-253   162-289 (410)
267 PRK07680 late competence prote  29.9      35 0.00089   14.9   1.9   31  100-130    63-98  (273)
268 pfam00148 Oxidored_nitro Nitro  29.9      41   0.001   14.5   4.7   36  149-185   268-303 (398)
269 PRK08268 3-hydroxybutyryl-CoA   29.7      37 0.00095   14.7   2.0   22  100-121   110-131 (503)
270 PRK11064 wecC UDP-N-acetyl-D-m  29.6      28 0.00072   15.5   1.4   72  149-228   316-398 (415)
271 cd01974 Nitrogenase_MoFe_beta   29.6      41   0.001   14.4   4.9   98   85-183   213-332 (435)
272 PRK10433 putative RNA methyltr  29.2      23  0.0006   16.1   0.9   29   48-76      4-33  (228)
273 TIGR00050 rRNA_methyl_1 RNA me  29.1      28 0.00072   15.5   1.3   73  152-225     3-83  (253)
274 CHL00076 chlB photochlorophyll  29.0      42  0.0011   14.4   4.1   41   86-126   203-243 (510)
275 PRK10717 cysteine synthase A;   29.0      35 0.00089   14.9   1.8   51   50-106    67-117 (334)
276 COG1064 AdhP Zn-dependent alco  28.8      32 0.00081   15.2   1.5   71  148-224   162-236 (339)
277 KOG1805 consensus               28.7      42  0.0011   14.4   2.5   12   13-24    669-680 (1100)
278 COG0031 CysK Cysteine synthase  28.5      43  0.0011   14.3   2.2   57   42-107    60-116 (300)
279 KOG3420 consensus               28.4      23 0.00057   16.2   0.7   47  133-179    29-78  (185)
280 COG0287 TyrA Prephenate dehydr  28.2      41  0.0011   14.4   2.1   60   60-119    16-84  (279)
281 cd01543 PBP1_XylR Ligand-bindi  28.2      43  0.0011   14.3   4.3   94   60-163    18-119 (265)
282 pfam02873 MurB_C UDP-N-acetyle  28.2      43  0.0011   14.3   4.4   83   29-149     8-92  (103)
283 KOG0523 consensus               28.1      43  0.0011   14.3   3.6   55  155-209   507-565 (632)
284 pfam04309 G3P_antiterm Glycero  28.1      35  0.0009   14.9   1.7   65   58-128    78-146 (174)
285 PRK06476 pyrroline-5-carboxyla  28.0      23 0.00058   16.1   0.7   11  100-110    62-72  (255)
286 pfam02548 Pantoate_transf Keto  28.0      43  0.0011   14.3   2.1   21   86-106    94-115 (261)
287 cd06323 PBP1_ribose_binding Pe  27.8      44  0.0011   14.2   3.6   84   56-143    15-105 (268)
288 PRK06128 oxidoreductase; Provi  27.8      27 0.00068   15.7   1.0   86   39-130    50-145 (300)
289 PRK10481 hypothetical protein;  27.7      36 0.00091   14.9   1.6   28  162-190   114-141 (224)
290 cd06285 PBP1_LacI_like_7 Ligan  27.7      44  0.0011   14.2   3.5  100   59-163    18-124 (265)
291 PTZ00082 L-lactate dehydrogena  27.5      42  0.0011   14.4   2.0   39   91-129   111-155 (322)
292 cd06368 PBP1_iGluR_non_NMDA_li  27.4      45  0.0011   14.2   8.7  131   47-181     2-158 (324)
293 PRK06585 holA DNA polymerase I  27.4      45  0.0011   14.2   4.3   84   45-129    20-117 (343)
294 COG1830 FbaB DhnA-type fructos  27.4      45  0.0011   14.2   3.1   99   87-190    43-157 (265)
295 COG2423 Predicted ornithine cy  27.3      38 0.00098   14.6   1.7   70  154-225   131-203 (330)
296 PRK05565 fabG 3-ketoacyl-(acyl  27.2      27 0.00068   15.7   0.9   20  167-186   167-186 (247)
297 cd01536 PBP1_ABC_sugar_binding  27.0      45  0.0012   14.2   2.8  101   57-161    16-129 (267)
298 COG2098 Uncharacterized protei  26.9      38 0.00096   14.7   1.7   44   50-94      4-47  (116)
299 PRK05724 acetyl-CoA carboxylas  26.6      19 0.00048   16.7   0.0   99   87-191    45-165 (318)
300 TIGR01748 rhaA L-rhamnose isom  26.6      24 0.00062   15.9   0.6   14  287-300   361-374 (415)
301 PRK11880 pyrroline-5-carboxyla  26.2      37 0.00095   14.7   1.5   32   99-130    62-96  (267)
302 cd06557 KPHMT-like Ketopantoat  26.0      47  0.0012   14.0   2.4   27  100-126   172-198 (254)
303 PRK09518 bifunctional cytidyla  25.7      45  0.0011   14.2   1.8   24   41-64    298-322 (714)
304 PRK12367 short chain dehydroge  25.7      33 0.00083   15.1   1.1   37   39-77     12-48  (250)
305 pfam00533 BRCT BRCA1 C Terminu  25.6      48  0.0012   14.0   5.0   34   39-74      3-36  (77)
306 PRK03003 engA GTP-binding prot  25.5      39 0.00099   14.6   1.5   36   41-78     57-93  (474)
307 PRK00141 murD UDP-N-acetylmura  25.2      44  0.0011   14.3   1.7   24   57-80     27-50  (476)
308 CHL00194 ycf39 Ycf39; Provisio  25.2      29 0.00073   15.5   0.8  122   61-182    92-227 (319)
309 cd06281 PBP1_LacI_like_5 Ligan  25.0      49  0.0013   13.9   3.2  101   57-162    16-125 (269)
310 COG1794 RacX Aspartate racemas  25.0      49  0.0013   13.9   2.5   67   49-129    38-106 (230)
311 PRK02048 4-hydroxy-3-methylbut  24.9      40   0.001   14.6   1.5   12  290-301   430-441 (613)
312 pfam04723 GRDA Glycine reducta  24.9      50  0.0013   13.9   2.1   40  150-189     2-42  (150)
313 KOG4165 consensus               24.8      49  0.0012   14.0   1.9   46   86-133   179-224 (433)
314 PRK12831 putative oxidoreducta  24.8      46  0.0012   14.2   1.7  258   39-305   135-463 (464)
315 PRK00124 hypothetical protein;  24.8      50  0.0013   13.9   2.9   26  160-185     7-32  (149)
316 TIGR03466 HpnA hopanoid-associ  24.6      29 0.00073   15.5   0.7   12   55-66     51-62  (328)
317 PRK13265 glycine/sarcosine/bet  24.6      50  0.0013   13.9   2.1   41  149-189     2-43  (157)
318 cd00983 recA RecA is a  bacter  24.5      50  0.0013   13.9   5.0   38   43-80     54-93  (325)
319 TIGR01369 CPSaseII_lrg carbamo  24.5      28 0.00072   15.5   0.6  113   59-178   128-316 (1089)
320 TIGR03590 PseG pseudaminic aci  24.3      51  0.0013   13.8   2.8  106   17-140    16-125 (280)
321 cd00640 Trp-synth-beta_II Tryp  24.0      51  0.0013   13.8   2.6   53   50-108    53-105 (244)
322 PRK00311 panB 3-methyl-2-oxobu  24.0      52  0.0013   13.8   2.1   17   61-77     28-44  (266)
323 TIGR01963 PHB_DH 3-hydroxybuty  23.8      52  0.0013   13.8   2.7  135   59-204    40-205 (258)
324 PRK09526 lacI lac repressor; R  23.8      52  0.0013   13.8   6.9  147   13-162    31-190 (342)
325 PRK07985 oxidoreductase; Provi  23.8      35 0.00089   14.9   1.0   20  167-186   211-230 (294)
326 PRK07201 short chain dehydroge  23.6      28 0.00072   15.5   0.5   39  148-186   371-409 (663)
327 PRK13530 arsenate reductase; P  23.5      53  0.0013   13.7   2.6   73  152-225     2-82  (133)
328 PRK11749 putative oxidoreducta  23.4      34 0.00086   15.0   0.9  260   39-305   135-457 (460)
329 PRK11303 DNA-binding transcrip  23.1      54  0.0014   13.7   6.3  165   14-182    30-214 (330)
330 COG2719 SpoVR Uncharacterized   22.9      54  0.0014   13.7   2.2   17   14-30    153-169 (495)
331 PRK00080 ruvB Holliday junctio  22.8      38 0.00098   14.6   1.1   53   49-106    54-109 (328)
332 PRK10703 DNA-binding transcrip  22.8      54  0.0014   13.7   9.0  147   12-162    26-187 (335)
333 cd06393 PBP1_iGluR_Kainate_Glu  22.8      54  0.0014   13.7   8.1  133   46-182     4-171 (384)
334 TIGR00195 exoDNase_III exodeox  22.7      55  0.0014   13.6   2.4  102   66-170    49-172 (281)
335 PRK09492 treR trehalose repres  22.4      55  0.0014   13.6   8.3  145   13-163    30-186 (315)
336 TIGR01258 pgm_1 phosphoglycera  22.4      39 0.00099   14.6   1.0   20  151-171   173-192 (248)
337 PRK13609 diacylglycerol glucos  22.3      56  0.0014   13.6   3.9   42   93-135    97-142 (388)
338 pfam03721 UDPG_MGDP_dh_N UDP-g  22.2      56  0.0014   13.6   3.1   19   61-79     14-32  (185)
339 TIGR01169 rplA_bact ribosomal   22.1      25 0.00063   15.9  -0.0   27  182-218   128-154 (227)
340 PRK10754 quinone oxidoreductas  22.0      57  0.0014   13.5   3.6   84  133-222   121-214 (327)
341 PRK02910 light-independent pro  21.9      57  0.0014   13.5   4.6  140   66-212   184-352 (524)
342 PRK08213 gluconate 5-dehydroge  21.8      42  0.0011   14.4   1.1   21  166-186   177-197 (259)
343 COG1879 RbsB ABC-type sugar tr  21.6      57  0.0015   13.5   4.6   83   45-130    34-125 (322)
344 COG2515 Acd 1-aminocyclopropan  21.5      50  0.0013   13.9   1.4  136   46-185    66-213 (323)
345 cd06556 ICL_KPHMT Members of t  21.5      58  0.0015   13.5   2.2   18   62-79     24-41  (240)
346 cd06283 PBP1_RegR_EndR_KdgR_li  21.4      58  0.0015   13.5   3.4  100   58-162    17-125 (267)
347 TIGR00513 accA acetyl-CoA carb  21.3      43  0.0011   14.3   1.1   17  113-129   151-167 (329)
348 pfam11339 DUF3141 Protein of u  21.3      52  0.0013   13.8   1.5   31  128-159   307-340 (581)
349 PRK07791 short chain dehydroge  21.3      42  0.0011   14.4   1.0   21  166-186   181-201 (285)
350 cd01019 ZnuA Zinc binding prot  21.2      52  0.0013   13.8   1.5   14  167-180   187-200 (286)
351 PTZ00123 phosphoglycerate muta  21.2      41   0.001   14.5   0.9   51   12-73     13-63  (235)
352 cd06277 PBP1_LacI_like_1 Ligan  21.2      59  0.0015   13.4   3.8  117   56-178    18-149 (268)
353 TIGR03451 mycoS_dep_FDH mycoth  21.1      59  0.0015   13.4   2.1   82  135-222   159-250 (358)
354 KOG1191 consensus               21.1      59  0.0015   13.4   2.0  143   41-187   121-300 (531)
355 TIGR03594 GTPase_EngA ribosome  20.9      55  0.0014   13.6   1.5   15  153-168   172-186 (429)
356 cd01542 PBP1_TreR_like Ligand-  20.9      59  0.0015   13.4   3.4   98   59-161    18-122 (259)
357 COG0771 MurD UDP-N-acetylmuram  20.8      60  0.0015   13.4   2.8   17   61-77     21-37  (448)
358 KOG3042 consensus               20.8      60  0.0015   13.4   2.4   13   43-55     50-62  (283)
359 PRK08703 short chain dehydroge  20.8      46  0.0012   14.1   1.1   15  173-187   178-193 (239)
360 PRK05557 fabG 3-ketoacyl-(acyl  20.7      47  0.0012   14.1   1.1   20  167-186   167-186 (248)
361 PRK07819 3-hydroxybutyryl-CoA   20.6      50  0.0013   13.9   1.3   16   10-25     29-44  (284)
362 cd00468 HIT_like HIT family: H  20.5      60  0.0015   13.4   3.8   31    5-35     26-56  (86)
363 PRK06223 malate dehydrogenase;  20.5      60  0.0015   13.3   1.8   39   91-129   100-144 (312)
364 PRK06721 threonine synthase; R  20.5      61  0.0015   13.3   2.1  105   50-164    78-189 (352)
365 PRK07806 short chain dehydroge  20.4      45  0.0011   14.2   1.0   14  172-185   170-183 (248)
366 TIGR00433 bioB biotin synthase  20.3      61  0.0016   13.3   3.2   23   17-39      7-29  (350)
367 cd06308 PBP1_sensor_kinase_lik  20.2      61  0.0016   13.3   3.7   70   58-130    17-90  (270)
368 PRK13982 bifunctional SbtC-lik  20.2      61  0.0016   13.3   2.3   59  133-191   235-312 (476)
369 PRK08936 glucose-1-dehydrogena  20.1      48  0.0012   14.0   1.1   21  167-187   170-190 (261)
370 PRK06124 gluconate 5-dehydroge  20.1      45  0.0012   14.2   1.0   20  167-186   175-194 (259)
371 TIGR02025 BchH magnesium chela  20.1      55  0.0014   13.6   1.4   12  165-176   506-517 (1384)
372 cd01018 ZntC Metal binding pro  20.0      51  0.0013   13.8   1.2   12  254-265   239-250 (266)
373 cd06387 PBP1_iGluR_AMPA_GluR3   20.0      62  0.0016   13.3   7.9  100   46-147     1-124 (372)

No 1  
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase; InterPro: IPR002292 The ornithine carbamoyltransferases are a family of enzymes that catalyse the production of citrulline from carbamoyl-phosphate and ornithine . This reaction is part of the arginine biosynthetic pathway, and in some organisms the reaction is also part of the arginine deaminase pathway . In most prokaryotes, and some lower eukaryotes, the enzyme is found in the cytoplasm, but in higher eukaryotes, such as mammals, the enzyme is found in the mitochondrial matrix and functions as part of the urea cycle. In most organisms analysed to date, the enzyme has been shown to consist of a trimer of identical or nonidentical subunits . Extensive similarity has been found within the ornithine carbamoyltransferase family, some of the conserved areas being important in catalysis .   The C-terminal region of these enzymes shows a degree of similarity to the aspartate carbamoyltransferases, which are also known to bind carbamoyl- phosphate . This region contains a highly conserved Cys residue (in a His-Cys-Lys-Pro motif) implicated in ornithine binding . ; GO: 0004585 ornithine carbamoyltransferase activity, 0006520 amino acid metabolic process, 0009348 ornithine carbamoyltransferase complex.
Probab=100.00  E-value=0  Score=760.60  Aligned_cols=299  Identities=51%  Similarity=0.857  Sum_probs=290.9

Q ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCC------CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             771784458999999999999999966523666------54437987999942888357899998986347543333210
Q gi|255764473|r    6 KHFADLSNISSSNLSCIIEVAKKIKNSSENIFE------NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGS   79 (306)
Q Consensus         6 k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~------~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~   79 (306)
                      ||||++.|||++|+..||++|..+|+..+.+..      .+.|+||||||||++||||||+|||.|+.+||||++||+++
T Consensus         1 rhLL~l~Dl~~~E~~~ll~~a~~~K~~~~~~~~ndfqsn~~~L~GKtlAliFeK~STRTRvSFEvA~y~lGg~~lyL~~~   80 (341)
T TIGR00658         1 RHLLSLADLSPEEIRELLQLAKKLKKGKKKGKENDFQSNEKKLKGKTLALIFEKPSTRTRVSFEVAAYQLGGQPLYLNPS   80 (341)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCEEEEEECCCCCCCCCHHHHHHHCCCCEEECCCC
T ss_conf             96220025898899999999998645754487442000213234881666652698652100779998649821224875


Q ss_pred             CCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCC--CCCCC---
Q ss_conf             0001232107999997530010111210132006776301244124043332024678765576642001--33677---
Q gi|255764473|r   80 EMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRG--SVKGK---  154 (306)
Q Consensus        80 ~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g--~l~~~---  154 (306)
                      ++|+++|||++|||||||+|+|+|++|...|..+.+||+|++||||||+|+.+||||+|+|++||+|++|  .|+|+   
T Consensus        81 ~~QlG~gEsi~DTARVLsRyVD~I~~R~~~h~~v~~lA~yasVPVINgLtD~~HPcQ~LADllTI~E~~g~~~l~g~nkG  160 (341)
T TIGR00658        81 DLQLGRGESIKDTARVLSRYVDGIMARVYKHEDVEELAKYASVPVINGLTDLFHPCQALADLLTIKEHFGEKKLKGVNKG  160 (341)
T ss_pred             CCEECCCCCCCCHHHHHCCEEEEEEEECCCHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHCCC
T ss_conf             32003688700011020315656777325537899998548985460556855237999998889874679560000035


Q ss_pred             -----CEEEECCC-CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHH----HCCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             -----30461045-555431010012331257652000013210000243----20133222136646630687332221
Q gi|255764473|r  155 -----LFSWSGDG-NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTD  224 (306)
Q Consensus       155 -----~i~~vGd~-~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~----~~~g~~i~~~~d~~eal~~aD~V~~~  224 (306)
                           |++|+||+ |||+||++.+++++|+++.+++|++|.|...+++.+    +.+|++|+.++|+.+|+++|||||||
T Consensus       161 insklk~vy~GDgRNNVcnSL~la~a~~Gm~~~v~tP~gyeP~~~~v~~A~~~a~e~Gg~~~lt~Dp~eAv~gADv~YTD  240 (341)
T TIGR00658       161 INSKLKVVYVGDGRNNVCNSLLLAAAKLGMDVVVATPEGYEPDAEIVKKAKKIAKENGGSVELTHDPKEAVKGADVIYTD  240 (341)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHCCCCEEEEE
T ss_conf             24421689973785126889999999728547887888888787899999999971798599963779861289789974


Q ss_pred             CEEECCC-CCHHHHH-HCCCCCCCCHHHHHCC-CCCCEEECCCCCCC------------------CCCCCHHHHCCCCCH
Q ss_conf             0000002-2013331-0011123368899628-98729925999874------------------873576796799710
Q gi|255764473|r  225 TWISMNQ-EFKAREE-HVFQPFQVNLSLMSMA-HPDALFMHCLPAHR------------------GEEVINEVLDGPQSV  283 (306)
Q Consensus       225 ~~~~~~~-~~~~~~~-~~~~~y~i~~~~l~~a-~~~~~vmHplP~~r------------------g~EI~~~v~d~~~s~  283 (306)
                      +|.|||+ +.+..++ +.|+|||||.++|+.| +|+++||||||++|                  |.|||+||+++|+|+
T Consensus       241 VWvSMGe~e~~~~eR~~~F~PYQVN~~Ll~~aG~p~~~fMHCLPA~r~~~T~~G~~~AE~~~L~~G~EvTdeV~eg~~S~  320 (341)
T TIGR00658       241 VWVSMGEAEDKKEERLKIFRPYQVNEELLELAGKPEVIFMHCLPAHRDDETKLGKKIAEKYGLANGEEVTDEVIEGPHSI  320 (341)
T ss_pred             EEEECCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCCCEEECCCCCCCCCCCHHHHHHHHHCCCCCCEEECHHHCCCCCCE
T ss_conf             12356983667888998368988787998413889817833788875752136788887547888814008673599983


Q ss_pred             HHHHHHHHHHHHHHHHHHHHC
Q ss_conf             686877559999999999625
Q gi|255764473|r  284 VFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       284 ~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
                      +|+|||||+|+|||||.++||
T Consensus       321 VfDqAENRlHaqKAvm~~~l~  341 (341)
T TIGR00658       321 VFDQAENRLHAQKAVMVALLG  341 (341)
T ss_pred             EHHHHHHHHHHHHHHHHHHHC
T ss_conf             130264479999999999819


No 2  
>PRK00779 ornithine carbamoyltransferase; Provisional
Probab=100.00  E-value=0  Score=687.74  Aligned_cols=302  Identities=58%  Similarity=0.915  Sum_probs=286.0

Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88771784458999999999999999966523666544379879999428883578999989863475433332100001
Q gi|255764473|r    4 YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQL   83 (306)
Q Consensus         4 ~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~   83 (306)
                      ++||||+++||++++|+.||++|.++|+.++++...++|+||+++++|+|||||||+|||+|+++|||+++++++.+||+
T Consensus         4 ~~k~llsi~dls~~~i~~ll~~A~~~k~~~~~~~~~~~L~gk~v~~lF~epSTRTr~SFe~A~~~LGg~~i~~~~~~ss~   83 (308)
T PRK00779          4 MGRHFLSLSDLTPEELRELLELAAELKAKRKAGELYKPLKGKTLAMIFEKPSTRTRVSFEVGMAQLGGHAIFLSPRDTQL   83 (308)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHCCCEEEECCCCCCCC
T ss_conf             88785860009999999999999999866645876766899889999706874255739998862893899668765656


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCC
Q ss_conf             23210799999753001011121013200677630124412404333202467876557664200133677304610455
Q gi|255764473|r   84 GRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGN  163 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~  163 (306)
                      +||||++||+++|+.|+|++|+||++++.+.++++++++|||||+++++||||||+|+|||+|++|+++|++|+||||++
T Consensus        84 ~kgEsl~Dt~~~l~~~~D~iviR~~~~~~~~~~a~~~~vPVINa~~d~~HPtQaL~Dl~Ti~e~~g~l~gl~i~~vGD~~  163 (308)
T PRK00779         84 GRGEPIEDTARVLSRYVDAIMIRTFEHETLEELAEYSTVPVINGLTDLSHPCQILADLLTIYEHRGSIKGKTVAWVGDGN  163 (308)
T ss_pred             CCCCCHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             78978999999998547799993243011899987489878967888767389999999999983867787599983874


Q ss_pred             CCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCC-CCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHH-HHCC
Q ss_conf             554310100123312576520000132100002432013-32221366466306873322210000002201333-1001
Q gi|255764473|r  164 NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQG-ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-EHVF  241 (306)
Q Consensus       164 ~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g-~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~-~~~~  241 (306)
                      ||+||+++++++||+++.+++|+++.|+++++++++..+ .++.+++|++++++++|+||||+|.+|+.+....+ .+.+
T Consensus       164 nV~~Sl~~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~~~~~i~~~~d~~ea~~~aDviytd~w~sm~~~~~~~~~~~~~  243 (308)
T PRK00779        164 NVANSLLLAAALLGFDLRVATPKGYEPDPEIVAKARAIAEASIEVTHDPEEAVKGADVVYTDVWVSMGQEAEAEERLKAF  243 (308)
T ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHCCCCEEEECCHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             53999999999779989998883027899999999974689589983999996259999850410255378999999876


Q ss_pred             CCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             1123368899628987299259998748735767967997106868775599999999996255
Q gi|255764473|r  242 QPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       242 ~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
                      .+||||.++|+.++++++||||||+|||+||+++|+|+|+|+||+||+||+|+|||||+|+||-
T Consensus       244 ~~y~vt~~~l~~ak~~~ivMHplP~~Rg~EI~~~V~d~p~s~i~~Qa~Ngl~vrmAiL~~lLgg  307 (308)
T PRK00779        244 APYQVNAELMALAKPDAIFMHCLPAHRGEEVTDEVIDGPQSVVWDEAENRLHAQKALLAWLLGG  307 (308)
T ss_pred             HHCCCCHHHHHHCCCCCEEECCCCCCCCCEECHHHHCCCCCHHHHHHHCCHHHHHHHHHHHHCC
T ss_conf             5356589999726999899798988888636676756986569999860599999999998579


No 3  
>PRK02255 putrescine carbamoyltransferase; Provisional
Probab=100.00  E-value=0  Score=681.67  Aligned_cols=303  Identities=41%  Similarity=0.626  Sum_probs=283.2

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             98887717844589999999999999999665236665443798799994288835789999898634754333321000
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM   81 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s   81 (306)
                      |..+||||+++||+++||..||++|.++|+.++++.....|+||+++++|+|||||||+|||+|+++|||+++++++++|
T Consensus         1 M~k~kh~L~~~Dls~~ei~~ll~~A~~~K~~~~~~~~~~~L~gk~v~~lF~epSTRTR~SFE~A~~~LGg~~i~l~~~~~   80 (341)
T PRK02255          1 MNKKRDFIDTQDYSKEEILYMIDLGLKLKEAIKNGAYPQLLKNKSLGMIFEQPSTRTRVSFETAMTQLGGHAQYLAPGQI   80 (341)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEECCCCCC
T ss_conf             99875647222199999999999999998777558887557999899996789710799999999985997998276544


Q ss_pred             CCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHC---CCCCCCCEEE
Q ss_conf             0123210799999753001011121013200677630124412404333202467876557664200---1336773046
Q gi|255764473|r   82 QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHR---GSVKGKLFSW  158 (306)
Q Consensus        82 s~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~---g~l~~~~i~~  158 (306)
                      |++||||++||+++||+|+|+||+||+.++.+.++++++++|||||+++.+||||+|+|+|||+|++   |.++|++|+|
T Consensus        81 sl~kgEsl~DT~~vls~~~D~iviR~~~~~~~~~la~~~~vPVINg~~~~~HPtQaL~Dl~Ti~e~~~~~~~l~glkva~  160 (341)
T PRK02255         81 HLGGHESIEDTARVLSRMVDIIMARVLRHQTVVELAKYATVPVINGMSDYNHPTQELGDVFTMLEHLPAGKKLEDCKVVF  160 (341)
T ss_pred             CCCCCCCHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             57887669999999986378899993484679999986799989789988772789998999999860179845656887


Q ss_pred             ECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHH----CCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCH
Q ss_conf             10455554310100123312576520000132100002432----01332221366466306873322210000002201
Q gi|255764473|r  159 SGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK  234 (306)
Q Consensus       159 vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~----~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~  234 (306)
                      |||++||+||++.++++||+++.+++|+++.+++++++.++    ..|.++.+++|++++++++|+||||+|.+|.....
T Consensus       161 vGD~~nv~~S~~~~~~~~g~~~~~~~P~~~~~~~~~~~~~~~~~~~~g~~i~~~~d~~ea~~~aDvvytd~w~~~~~~~~  240 (341)
T PRK02255        161 VGDATQVCSSLMFITTKMGMDFVHFGPKGFQLPEEHLAIARENCEVSGGSVLVTDDADEAVKDADFIYTDVWYGLYEQEL  240 (341)
T ss_pred             ECCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHCCCCEEEEHHHHHHHHHHH
T ss_conf             26853448899999997599899987974689999999999999973997999978888725798785107888632165


Q ss_pred             HH---HHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             33---31001112336889962898729925999874873576796799710686877559999999999625
Q gi|255764473|r  235 AR---EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       235 ~~---~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
                      ..   ...++..||||.++|+.++++++||||||+|||+||+++|+|+|+|+||+||+||+|+|||||+|+|.
T Consensus       241 ~~~~~~~~~~~~y~v~~~~m~~a~~~ai~MHplPa~Rg~EIs~eV~d~p~S~i~~QaeNgl~vrmAlL~~lL~  313 (341)
T PRK02255        241 SEEERMKIFYPKYQVNPELMAKAGPHAKFMHCLPASRGEEVTDEVMDSPQSIIFDEAENRLTAMRALLVYFLN  313 (341)
T ss_pred             HHHHHHHHHCCCCEECHHHHHCCCCCCEEECCCCCCCCCEECHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             5899987634465777999945898989989998988873077885899877999997309999999999848


No 4  
>PRK02102 ornithine carbamoyltransferase; Validated
Probab=100.00  E-value=0  Score=673.61  Aligned_cols=301  Identities=41%  Similarity=0.689  Sum_probs=284.9

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87717844589999999999999999665236665443798799994288835789999898634754333321000012
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG   84 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~   84 (306)
                      +||||+++||+++||..||++|.++|+.+.++...+.|+||+++++|+|||||||+|||+|+++|||+++++++++||++
T Consensus         7 ~kh~L~~~dls~~ei~~il~~A~~~k~~~~~~~~~~~L~gk~v~~lF~epSTRTR~SFe~A~~~LGg~~i~l~~~~s~~~   86 (331)
T PRK02102          7 GRSFLKLLDFTPAEIEYLIDLSIELKAAKKAGIEHQYLKGKNIALIFEKTSTRTRCAFEVAAIDLGAHVTYLGPNDIQLG   86 (331)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             99818500099999999999999998766458877667999899995589730599999999985990995787556377


Q ss_pred             CCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCC-C
Q ss_conf             321079999975300101112101320067763012441240433320246787655766420013367730461045-5
Q gi|255764473|r   85 RAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-N  163 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~-~  163 (306)
                      ||||++||+++||.|+|+||+||++++.+.++++++++|||||+++.+||||+|+|+|||+|++|.++|++|+||||. +
T Consensus        87 kGEs~~Dt~~~Ls~~~D~iviR~~~~~~~~~~a~~~~vPVIN~~~~~~HPtQ~L~Dl~Ti~e~~g~l~gl~i~~vGD~~n  166 (331)
T PRK02102         87 KKESMEDTARVLGRMYDGIEYRGFSQEIVEELAKYSGVPVWNGLTDEWHPTQMLADFMTMKEHFGPLKGLKLAYLGDGRN  166 (331)
T ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCC
T ss_conf             89898999999997516789962772899999974798645488876487999999999999838756773899788764


Q ss_pred             CCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHH----HCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHH-HHH
Q ss_conf             55431010012331257652000013210000243----2013322213664663068733222100000022013-331
Q gi|255764473|r  164 NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-REE  238 (306)
Q Consensus       164 ~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~----~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~-~~~  238 (306)
                      ||+||++.++++||+++++++|++|.|++.++..+    +..|..+.+++|+.+|+++||+||||+|.+|+++... +..
T Consensus       167 nVa~S~~~~~~~lG~~v~~~~P~~~~p~~~~~~~~~~~~~~~g~~i~~~~d~~ea~~~aDVvytdvw~sm~~~~~~~~r~  246 (331)
T PRK02102        167 NMANSLLVGGAKLGMDVRICAPKSLWPEEELVAQAKEIAKETGAKITITEDVEEAVKGADVIYTDVWVSMGEEEKWEERI  246 (331)
T ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCEEEEEECHHHHHCCCCEEEEEHHHCCCHHHHHHHHH
T ss_conf             24668999998559859997586448897999999999998299389995666663357656530332233477799999


Q ss_pred             HCCCCCCCCHHHHHCC-CCCCEEECCCCC-----------------CCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             0011123368899628-987299259998-----------------7487357679679971068687755999999999
Q gi|255764473|r  239 HVFQPFQVNLSLMSMA-HPDALFMHCLPA-----------------HRGEEVINEVLDGPQSVVFDEAENRLHTQKAILL  300 (306)
Q Consensus       239 ~~~~~y~i~~~~l~~a-~~~~~vmHplP~-----------------~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~  300 (306)
                      +++.+||+|.++|+.+ |++++||||||+                 +||+||+++|+|+|+|+||+||+||+|+|||||+
T Consensus       247 ~~~~~y~v~~~l~~~a~k~~ai~MH~LPa~~n~~~~~~~~~~~~~~~RG~EI~~~V~d~p~S~i~~QaeNrl~~r~AvL~  326 (331)
T PRK02102        247 KLLKPYQVNMDLMKATGNPDVIFMHCLPAFHDTETKVGKEIAEKYGLKGLEVTDEVFESKYSIVFDEAENRMHTIKAVMV  326 (331)
T ss_pred             HHHCCCEECHHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHCCCCCCCCEEECHHHHCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             87407637899997347999489734877532232100222013577753866888488763025477521999999999


Q ss_pred             HHHCC
Q ss_conf             96255
Q gi|255764473|r  301 WCFGI  305 (306)
Q Consensus       301 ~~lG~  305 (306)
                      ++||.
T Consensus       327 ~~LGd  331 (331)
T PRK02102        327 ATLGD  331 (331)
T ss_pred             HHHCC
T ss_conf             98478


No 5  
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional
Probab=100.00  E-value=0  Score=663.66  Aligned_cols=302  Identities=39%  Similarity=0.633  Sum_probs=283.0

Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88771784458999999999999999966523666544379879999428883578999989863475433332100001
Q gi|255764473|r    4 YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQL   83 (306)
Q Consensus         4 ~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~   83 (306)
                      ++||||+++||+++||..||++|.++|+.+.++...+.|+||+++++|+|||||||+|||+|+++|||+++++++++||+
T Consensus         5 ~~k~~l~~~Dls~~ei~~il~~A~~lK~~~~~~~~~~~L~gk~i~~lF~epSTRTR~SFE~A~~~LGg~~i~l~~~~s~~   84 (334)
T PRK03515          5 YQKHFLKLLDFTPAELNALLQLAAKLKADKKSGKEEQKLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPSGSQI   84 (334)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             78884760119999999999999999867654887756799889999648870379999999998299299967753436


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHC--CCCCCCCEEEECC
Q ss_conf             23210799999753001011121013200677630124412404333202467876557664200--1336773046104
Q gi|255764473|r   84 GRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHR--GSVKGKLFSWSGD  161 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~--g~l~~~~i~~vGd  161 (306)
                      +||||++||+++||+|+|+||+||++++.+.++++++++|||||+++++||||+|+|+|||+|++  |+++|++|+||||
T Consensus        85 ~kgEsl~DTarvLs~~~D~Iv~R~~~~~~~~~~a~~s~vPVINg~~~~~HPtQaL~Dl~Ti~E~~~~~~l~~lkia~vGD  164 (334)
T PRK03515         85 GHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLAYAGD  164 (334)
T ss_pred             CCCCCHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             68987899999999618879996755489999998769876648988878679999999999985689756648999578


Q ss_pred             C-CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHH----HHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHH
Q ss_conf             5-5554310100123312576520000132100002----4320133222136646630687332221000000220133
Q gi|255764473|r  162 G-NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR  236 (306)
Q Consensus       162 ~-~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~----~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~  236 (306)
                      . |||+||++.++++||+++++++|++|.|+.+++.    .++..|.++.+++|+.+++++||+||||+|.+|+++.+..
T Consensus       165 ~~nnv~~Sl~~~~~~~g~~~~~~~P~~~~p~~~~~~~~~~~~~~~g~~i~~~~d~~ea~~~aDviytd~w~smg~~~~~~  244 (334)
T PRK03515        165 ARNNMGNSLLEAAALTGLDLRLVAPKACWPEAALVTECQALAQKNGGNITLTEDIAEGVKGADFIYTDVWVSMGEPKEKW  244 (334)
T ss_pred             CCCCHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEECCHHHHHCCCCEEEEEHHHHCCCHHHHH
T ss_conf             76545899999998549749997797568887899999999997199189960456551578788730213223246668


Q ss_pred             --HHHCCCCCCCCHHHHHCC-CCCCEEECCCCC------------------CCCCCCCHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             --310011123368899628-987299259998------------------74873576796799710686877559999
Q gi|255764473|r  237 --EEHVFQPFQVNLSLMSMA-HPDALFMHCLPA------------------HRGEEVINEVLDGPQSVVFDEAENRLHTQ  295 (306)
Q Consensus       237 --~~~~~~~y~i~~~~l~~a-~~~~~vmHplP~------------------~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr  295 (306)
                        ..+.+++||+|.++|+.+ +++++||||||+                  |||+||+++|+|+|+|+||+||+||+|+|
T Consensus       245 ~er~~~~~~y~v~~~l~~~~~~~~~~~mHclPa~~~~~~~~~~~~~~~~p~~rG~EI~~~V~d~~~S~i~~QaeNrl~~~  324 (334)
T PRK03515        245 AERIALLRDYQVNSKMMQLTGNPQVKFLHCLPAFHDDQTTLGKKMAEEYGLHGGMEVTDEVFESAASIVFDQAENRLHTI  324 (334)
T ss_pred             HHHHHHHHCCEECHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHCCCCCCCCCEECHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             98987612525249999622799908957888775211100022202478888618788885788646999987059999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999996255
Q gi|255764473|r  296 KAILLWCFGI  305 (306)
Q Consensus       296 ~AiL~~~lG~  305 (306)
                      ||||+++||.
T Consensus       325 ~AvL~~~L~k  334 (334)
T PRK03515        325 KAVMVATLSK  334 (334)
T ss_pred             HHHHHHHHCC
T ss_conf             9999998667


No 6  
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional
Probab=100.00  E-value=0  Score=662.11  Aligned_cols=302  Identities=39%  Similarity=0.631  Sum_probs=282.3

Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88771784458999999999999999966523666544379879999428883578999989863475433332100001
Q gi|255764473|r    4 YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQL   83 (306)
Q Consensus         4 ~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~   83 (306)
                      ++||||+++||+++||..||++|.++|..+.++.....|+||+++++|||||||||+|||+|+++|||+++++++++||+
T Consensus         5 ~~kh~L~i~dls~~ei~~il~~A~~~k~~~~~~~~~~~L~gK~v~~lF~e~STRTR~SFE~A~~~LGg~~i~l~~~~s~~   84 (334)
T PRK12562          5 YHKHFLKLLDFTPAELNSLLQLAAKLKADKKNGKEVARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPSGSQI   84 (334)
T ss_pred             CCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             88885771006999999999999999866645886767899989999678970479999999998599789858764527


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHC--CCCCCCCEEEECC
Q ss_conf             23210799999753001011121013200677630124412404333202467876557664200--1336773046104
Q gi|255764473|r   84 GRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHR--GSVKGKLFSWSGD  161 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~--g~l~~~~i~~vGd  161 (306)
                      +||||++||+++||+|+|+||+||++++.+.++++++++|||||+++.+||||+|+|+|||+|++  +.++|++|+|+||
T Consensus        85 ~kgEsl~Dt~~vLs~~~D~iv~R~~~~~~~~~la~~s~vPVINg~~~~~HPtQaL~Dl~Ti~E~~~g~~l~~l~i~~vGD  164 (334)
T PRK12562         85 GHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLVYAGD  164 (334)
T ss_pred             CCCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             89988899999998607778973557389999999759998889987767179999999999984689867718999688


Q ss_pred             C-CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHH----HHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHH-
Q ss_conf             5-55543101001233125765200001321000024----32013322213664663068733222100000022013-
Q gi|255764473|r  162 G-NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA-  235 (306)
Q Consensus       162 ~-~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~----~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~-  235 (306)
                      . |||+||++.++++||+++.+++|+++.|++.++..    ++..|.++++++|+++++++||+||||+|.+|+++.+. 
T Consensus       165 ~~n~va~S~i~~~~~lG~~v~~~~P~~~~p~~~~~~~~~~~~~~~g~~i~~~~d~~~a~~~aDvvytd~w~sm~~~~e~~  244 (334)
T PRK12562        165 ARNNMGNSMLEAAALTGLDLRLVAPQACWPEASLVAECSALAQKHGGKITLTEDIAAGVKGADFIYTDVWVSMGEPKEKW  244 (334)
T ss_pred             CCCCHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCEEEEEHHHHCCCHHHHH
T ss_conf             86635799999999749869997897668888999999999997099289984688870578789864265525466778


Q ss_pred             -HHHHCCCCCCCCHHHHHCC-CCCCEEECCCCC------------------CCCCCCCHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             -3310011123368899628-987299259998------------------74873576796799710686877559999
Q gi|255764473|r  236 -REEHVFQPFQVNLSLMSMA-HPDALFMHCLPA------------------HRGEEVINEVLDGPQSVVFDEAENRLHTQ  295 (306)
Q Consensus       236 -~~~~~~~~y~i~~~~l~~a-~~~~~vmHplP~------------------~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr  295 (306)
                       +....+.+||+|.++++.+ +++++||||||+                  |||+||+++|+|+|+|+||+||+||+|+|
T Consensus       245 ~e~~~~~~~y~v~~~~~~~~~~~~~~~mHclPa~r~~~~~~~~~~~~~~~~~RG~EIt~~V~d~~~S~i~~QaeNrl~vr  324 (334)
T PRK12562        245 AERIALLRDYQVNSKMMALTGNPQVKFLHCLPAFHDDQTTLGKKMAAEFGLHGGMEVTDEVFESPASIVFDQAENRMHTI  324 (334)
T ss_pred             HHHHHHHHCCEECHHHHHHCCCCCCEEECCCCCCCCCCCCHHHHHHCCCCCCCCCEECHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             99998730862259999621899919958998887322110012200257888728568885888666999987139999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999996255
Q gi|255764473|r  296 KAILLWCFGI  305 (306)
Q Consensus       296 ~AiL~~~lG~  305 (306)
                      ||||+++||.
T Consensus       325 ~AvL~~~Lgk  334 (334)
T PRK12562        325 KAVMVATLAK  334 (334)
T ss_pred             HHHHHHHHCC
T ss_conf             9999998575


No 7  
>PRK04284 ornithine carbamoyltransferase; Provisional
Probab=100.00  E-value=0  Score=658.79  Aligned_cols=301  Identities=36%  Similarity=0.596  Sum_probs=281.8

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87717844589999999999999999665236665443798799994288835789999898634754333321000012
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG   84 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~   84 (306)
                      +||||+++||+++||+.||++|.++|+....+...++|+||+++++|+|||||||+|||+|+++|||+++++++++||++
T Consensus         6 ~rh~l~~~dls~~ei~~il~~A~~~k~~~~~~~~~~~L~gk~v~~lF~epSTRTR~SFE~A~~~LGg~~i~l~~~~s~~~   85 (332)
T PRK04284          6 NRSFLTLLDFSRQEVEFLLTLSEDLKRAKYAGTEKPMLKGKNIALLFEKDSTRTRCAFEVAAHDQGAHVTYLGPTGSQMG   85 (332)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             88868711089999999999999997555458878678999899996379720699999999985996898488645278


Q ss_pred             CCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCC-CCCCCEEEECCC-
Q ss_conf             321079999975300101112101320067763012441240433320246787655766420013-367730461045-
Q gi|255764473|r   85 RAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGS-VKGKLFSWSGDG-  162 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~-l~~~~i~~vGd~-  162 (306)
                      ||||++||+++||+|+|+||+||+.+..+.++++++++|||||.++++||||+|+|++||+|++|. ++|++|+||||. 
T Consensus        86 kgEsi~DT~~vls~~~D~iv~R~~~~~~~~~~a~~s~vPViNg~~~~~HPtQ~L~D~~Ti~E~~~~~~~~lkva~vGD~~  165 (332)
T PRK04284         86 KKETTKDTARVLGGMYDGIEYRGFSQRTVETLAEYSGVPVWNGLTDEDHPTQVLADFLTAKEVLKKPYADINFTYVGDGR  165 (332)
T ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
T ss_conf             87789999999996288899953461899999986799988689987772689988899999713665672899967988


Q ss_pred             CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHH----HHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHH--H
Q ss_conf             55543101001233125765200001321000024----32013322213664663068733222100000022013--3
Q gi|255764473|r  163 NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNW----ARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA--R  236 (306)
Q Consensus       163 ~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~----~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~--~  236 (306)
                      +||+||++.++++||+++++++|+++.|++++++.    +++.|.++.+++|+++++++||+||||+|++|+++.+.  .
T Consensus       166 nnVa~S~~~~~~~~g~~~~~~~P~~~~p~~~~~~~~~~~~~~~g~~~~~~~d~~~av~~aDviytd~w~s~~~~~~~~~~  245 (332)
T PRK04284        166 NNVANALMQGAAIMGMNFHLVCPKELNPTDELLNRCKNIAAENGGNILITDDIDQGVKGSDVIYTDVWVSMGEPDEVWKE  245 (332)
T ss_pred             CCHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHCCCCEEEEEEEEECCCCHHHHHH
T ss_conf             65115799999975993799758555889999999999999719908995149888525889987644315770355788


Q ss_pred             HHHCCCCCCCCHHHHHCCC-CCCEEECCCCCC-----------------CCCCCCHHHHCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             3100111233688996289-872992599987-----------------4873576796799710686877559999999
Q gi|255764473|r  237 EEHVFQPFQVNLSLMSMAH-PDALFMHCLPAH-----------------RGEEVINEVLDGPQSVVFDEAENRLHTQKAI  298 (306)
Q Consensus       237 ~~~~~~~y~i~~~~l~~a~-~~~~vmHplP~~-----------------rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~Ai  298 (306)
                      ..+++.+||||.++|+.++ ++++||||||++                 ||+||+++|+|+|+|+||+||+||+|+||||
T Consensus       246 r~~~~~~y~v~~elm~~~~~~~~ifmHcLPa~~~~~~~~g~~~~~~~~~Rg~EIt~eV~d~~~S~if~QAeNrl~~~~Al  325 (332)
T PRK04284        246 RIELLKPYQVTKEMMDKTGNPNVIFEHCLPSFHNADTKIGQQIFEKYGLREMEVTDEVFESKASVVFQEAENRMHTIKAV  325 (332)
T ss_pred             HHHHHHCCEECHHHHHHCCCCCEEEECCCCCCCCCCCCCCCHHCCCCCCCCCEECHHHHCCCCCEEHHHHHCCHHHHHHH
T ss_conf             88664174773999974589894997888888754432230000034886868778895798740010854409999999


Q ss_pred             HHHHHCC
Q ss_conf             9996255
Q gi|255764473|r  299 LLWCFGI  305 (306)
Q Consensus       299 L~~~lG~  305 (306)
                      |+++||-
T Consensus       326 L~~~LG~  332 (332)
T PRK04284        326 MVATLGE  332 (332)
T ss_pred             HHHHHCC
T ss_conf             9997088


No 8  
>PRK08192 aspartate carbamoyltransferase; Provisional
Probab=100.00  E-value=0  Score=656.66  Aligned_cols=304  Identities=24%  Similarity=0.358  Sum_probs=281.4

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCC-CCCCC
Q ss_conf             98887717844589999999999999999665236665443798799994288835789999898634754333-32100
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIF-LSGSE   80 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~-~~~~~   80 (306)
                      .-..||||+++||+++||..||++|.++|....+.....+|+||+++++|+|||||||+|||+|+++|||+++. ++..+
T Consensus         2 ~l~grhlLsi~Dls~~ei~~ll~~A~~lk~~~~~~~~~~~L~gk~la~lF~kpSTRTR~SFE~A~~~LGg~~~~~~~~~~   81 (338)
T PRK08192          2 QFEGSHILSVNQLDLDSIQTIFNVASRMMPYALRQKRTTVLDGAILGNLFFEPSTRTRVSFGCAFNLLGGHVRETTGMAS   81 (338)
T ss_pred             CCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEECCCCCCC
T ss_conf             89987859700189999999999999998787478878668999899996289744699999999984998602578332


Q ss_pred             CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCC-CCHHHHHHHHHHHHHHHC----CCCCCCC
Q ss_conf             00123210799999753001011121013200677630124412404333-202467876557664200----1336773
Q gi|255764473|r   81 MQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD-NTHPCQIIADIMTFEEHR----GSVKGKL  155 (306)
Q Consensus        81 ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~----g~l~~~~  155 (306)
                      ||++||||++||+++||+|+|+||+||++++.+.++++++++||||||++ ++||||+|+|+|||+|++    |+++|++
T Consensus        82 s~l~kGEsi~DTarvls~y~D~iviR~~~~~~~~e~a~~s~vPVINa~~~~~~HPtQaLaDl~Ti~e~~~~~~~~l~glk  161 (338)
T PRK08192         82 SSLSKGESLYDTARVLSTYSDVIAMRHPDAYSVKEFAEGSRVPVINGGDGSNEHPTQALLDLFTIQKELAHAGRGIDGMH  161 (338)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             44678978999999986159899998851004899874189878967889876827898889999999874089855748


Q ss_pred             EEEECC--CCCCCCCHHHCCCCC-CEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCC
Q ss_conf             046104--555543101001233-12576520000132100002432013322213664663068733222100000022
Q gi|255764473|r  156 FSWSGD--GNNILHSLIEGAARF-NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE  232 (306)
Q Consensus       156 i~~vGd--~~~v~hS~i~~~~~~-g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~  232 (306)
                      |+||||  ++|++||++.++.++ |+++++++|+++.|+++.+..+++.|.++.+++|++++++++|+||+++|+.++..
T Consensus       162 ia~vGD~~~~r~~~s~~~ll~~~~g~~~~l~~P~~~~~p~~~~~~~~~~g~~i~~~~d~~~a~~~aDvvy~~~~q~e~~~  241 (338)
T PRK08192        162 IAMVGDLKFGRTVHSLSRLLCMYKNISFTLISPKELAMPDYVISDIENAGHKITITDQLEGNLDKADILYLTRIQEERFP  241 (338)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHCCCEEEEEECHHHHHCCCEEEEECCEEECCCC
T ss_conf             99976777563899999999965598899989987789999999999849949997288897236849995754553565


Q ss_pred             CHHHHHHCCCCCCCCHHHHH-CCCCCCEEECCCCCC---CCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             01333100111233688996-289872992599987---48735767967997106868775599999999996255
Q gi|255764473|r  233 FKAREEHVFQPFQVNLSLMS-MAHPDALFMHCLPAH---RGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       233 ~~~~~~~~~~~y~i~~~~l~-~a~~~~~vmHplP~~---rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
                      ...+...++.+||||.+++. .+++|++||||||+|   ||.||+++|+|+|+|+||+||+||+|+|||||+|+||.
T Consensus       242 ~~~~~~~~~~~y~v~~~ll~~~ak~dai~MHcLP~n~~~rg~EIt~eV~d~p~S~vf~QAeNrl~~r~AlL~~lLG~  318 (338)
T PRK08192        242 SQEEANKYRGKFRLNQSIYTQHCKSNTVIMHPLPRDSRAQANELDNDLNSHPNLAIFRQADNGLLIRMALFALTLGV  318 (338)
T ss_pred             CHHHHHHHHHCCCCCHHHHHHCCCCCCEEECCCCCCCCCCEEEECHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             77899999746713799998308999999799999999770483777756998737999873099999999997299


No 9  
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism]
Probab=100.00  E-value=0  Score=659.95  Aligned_cols=302  Identities=52%  Similarity=0.812  Sum_probs=284.7

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             98887717844589999999999999999665236665443798799994288835789999898634754333321000
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM   81 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s   81 (306)
                      +..+||||++.||+++|+..|+++|.++|...+.+....+ +||+++|+|+++|||||+|||.|+.+|||++++++++++
T Consensus         3 ~~~~rhfL~l~D~t~~El~~ll~~A~~lK~~~~~~~~~~~-~gk~laliFeK~STRTR~SFe~a~~qlGg~~~~l~~~~~   81 (310)
T COG0078           3 NLAGRHFLSLLDFTPEELEALLDLAAELKAAKKAGKELKL-KGKNLALIFEKTSTRTRVSFEVAATQLGGHAIYLGPGDS   81 (310)
T ss_pred             CCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCC-CCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             6643330405209999999999999999874515874256-896599996489840454499999976896487088755


Q ss_pred             CCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             01232107999997530010111210132006776301244124043332024678765576642001336773046104
Q gi|255764473|r   82 QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus        82 s~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd  161 (306)
                      |+++|||++||+++||+|+|+|++|+++|..+.++++++.+|||||+++.+||||+|+|++||+|++|.++|+|++|+||
T Consensus        82 Qlgr~Esi~DTArVLsr~~D~I~~R~~~~~~v~~lA~~s~VPViNgLtD~~HP~Q~LADl~Ti~E~~g~l~g~k~a~vGD  161 (310)
T COG0078          82 QLGRGESIKDTARVLSRMVDAIMIRGFSHETLEELAKYSGVPVINGLTDEFHPCQALADLMTIKEHFGSLKGLKLAYVGD  161 (310)
T ss_pred             CCCCCCCHHHHHHHHHHHHHEEEEECCCHHHHHHHHHHCCCCEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             26789967889999985502577853548999999972799667254566681899999999999638666857999767


Q ss_pred             CCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHC----CCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHH
Q ss_conf             555543101001233125765200001321000024320----1332221366466306873322210000002201333
Q gi|255764473|r  162 GNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARN----QGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE  237 (306)
Q Consensus       162 ~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~----~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~  237 (306)
                      +|||+||++.+++++|+++++++|+++.|.+++++.+++    +|+++++++|+.+|+++||+||||+|.||+++.+..+
T Consensus       162 gNNv~~Sl~~~~a~~G~dv~ia~P~~~~p~~~~~~~a~~~a~~sg~~i~~t~d~~eAv~gADvvyTDvWvSMGee~e~~~  241 (310)
T COG0078         162 GNNVANSLLLAAAKLGMDVRIATPKGYEPDPEVVEKAKENAKESGGKITLTEDPEEAVKGADVVYTDVWVSMGEEAEAEE  241 (310)
T ss_pred             CCHHHHHHHHHHHHHCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHCCCCEEEECCCCCCCCHHHHHH
T ss_conf             63699999999998298689978986786989999999999853984898639889857899998367656762234078


Q ss_pred             -H-HCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             -1-001112336889962898729925999874873576796799710686877559999999999625
Q gi|255764473|r  238 -E-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       238 -~-~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
                       + .++++||||.++|+.++++++||||||++||.||+++|+|+|+|++|+|||||+|++||||.|++|
T Consensus       242 ~~~~~~~~yQVn~~lm~~a~~~~ifmHCLPA~rG~EVTdeV~dg~~svvfdeAENRlH~qKAvl~~~l~  310 (310)
T COG0078         242 RRIAFLPPYQVNEELMALAGPDAIFMHCLPAHRGEEVTDEVFEGPASVVFDEAENRLHTQKAVLAALLG  310 (310)
T ss_pred             HHHHHCCCCEECHHHHHHCCCCEEEEECCCCCCCCCCCHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHC
T ss_conf             888537785357999950379828974788777871579895787514730632108999999999639


No 10 
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=100.00  E-value=0  Score=654.63  Aligned_cols=293  Identities=30%  Similarity=0.437  Sum_probs=270.6

Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88771784458999999999999999966523666544379879999428883578999989863475433332100001
Q gi|255764473|r    4 YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQL   83 (306)
Q Consensus         4 ~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~   83 (306)
                      .+||||+++||+++++..||++|.++|+.+.... ...|+||+++++|+|||||||+|||+|+++|||+++++++.+||+
T Consensus         5 ~~k~~lsi~Dls~~ei~~ll~~A~~~K~~~~~~~-~~~L~gk~v~~lF~epSTRTR~SFe~A~~~LGg~~i~l~~~~s~~   83 (304)
T PRK00856          5 KMKHLLSIEDLSREEIELLLDTAEQFKAVPRVKK-VPLLRGKTVANLFFEPSTRTRLSFELAAKRLGADVINFSASTSSV   83 (304)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCEEEEEEECCCCHHHHHHHHHHHHCCCEEEECCCCCCCC
T ss_conf             7688087221999999999999999973321267-865689889999715874057889999983896698706664655


Q ss_pred             CCCCCHHHHHHHHHHC-CCEEEEEECCCCHHHHHHCCCCCCEECCCCC-CCHHHHHHHHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             2321079999975300-1011121013200677630124412404333-2024678765576642001336773046104
Q gi|255764473|r   84 GRAETIGDTAKVLSRY-VDAIVMRTTNHSRLLELTEYATVPVINALTD-NTHPCQIIADIMTFEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~-~D~iviR~~~~~~~~~~~~~~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd  161 (306)
                      +||||++||+++||+| +|+||+||++++.++++++++++|||||||| ++||||+|+|+|||+|++|+++|+||+|+||
T Consensus        84 ~kgEsi~DTarvls~y~~D~iv~R~~~~~~~~~~a~~s~vPVINagdg~~eHPtQaLaDl~Ti~e~~g~l~glki~~vGD  163 (304)
T PRK00856         84 SKGETLADTIRTLSAMGADAIVIRHPQSGAARLLAEKVNVPVINAGDGSHQHPTQALLDLLTIREEFGRLEGLKVAIVGD  163 (304)
T ss_pred             CCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             68978999999999727979999168656999999868998897999977684699987999998638777876999847


Q ss_pred             CC--CCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEE--CCCCCHHHH
Q ss_conf             55--55431010012331257652000013210000243201332221366466306873322210000--002201333
Q gi|255764473|r  162 GN--NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS--MNQEFKARE  237 (306)
Q Consensus       162 ~~--~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~--~~~~~~~~~  237 (306)
                      .+  ||+|||++++++||+++++++|+++.|+.        .+.++.+++|++++++++|+||+++++.  +++....+.
T Consensus       164 ~~n~rv~~Sl~~~~~~~g~~~~~~~P~~~~p~~--------~~~~~~~~~d~~~av~~aDvvy~trvq~Er~~~~~~~~~  235 (304)
T PRK00856        164 IKHSRVARSNIQALTRLGAEVRLIAPPTLLPEG--------IELGVRVHTDLEEVIEEADVVMMLRVQKERMDGGLLPSY  235 (304)
T ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCCCHH--------HCCCEEEECCHHHHHCCCCEEEEEHHHHHHHCCCCCHHH
T ss_conf             874567999999999769869997785338844--------469839986999996269899985577776114210368


Q ss_pred             HHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             10011123368899628987299259998748735767967997106868775599999999996255
Q gi|255764473|r  238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       238 ~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
                      ++++.+||||.++|++++++++||||||+|||.||+++|+++|+|+||+||+||+|+|||||+|+||-
T Consensus       236 ~~~~~~y~v~~~~m~~a~~~ai~mHcLPa~Rg~Ei~~~V~d~~~s~v~~QaeNrl~~~~AvL~~llgg  303 (304)
T PRK00856        236 EEYHRQYGLTAERLALAKPDAIVMHPGPVNRGVEIASDVADGPQSRIFEQVTNGVAVRMAVLELLLGG  303 (304)
T ss_pred             HHHCCCEEECHHHHHCCCCCCEEECCCCCCCCCEECHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             87255234589999607999899897998788603787757984679999871599999999998679


No 11 
>PRK01713 ornithine carbamoyltransferase; Provisional
Probab=100.00  E-value=0  Score=651.16  Aligned_cols=299  Identities=36%  Similarity=0.605  Sum_probs=279.7

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87717844589999999999999999665236665443798799994288835789999898634754333321000012
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG   84 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~   84 (306)
                      +||||++.||+++||..||++|.++|+.+..+...+.|+||+++++|+|||||||+|||+|+++|||+++++++++||++
T Consensus         7 ~rhlL~~~d~s~~ei~~il~~A~~~K~~~~~~~~~~~L~gK~v~~lF~epSTRTR~SFE~A~~~LGg~~i~l~~~~s~~~   86 (334)
T PRK01713          7 NRHLLSLVNHTEREIKYLLDLSRDLKRAKYAGTEQQRLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDPTSSQIG   86 (334)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             99838700099999999999999998665268878778999899984799626899999999985990998475124578


Q ss_pred             CCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCC-CCCCCEEEECCC-
Q ss_conf             321079999975300101112101320067763012441240433320246787655766420013-367730461045-
Q gi|255764473|r   85 RAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGS-VKGKLFSWSGDG-  162 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~-l~~~~i~~vGd~-  162 (306)
                      ||||++||+++||+|+|+||+||++++.+.++++++++|||||+++.+||||+|+|+|||+|++|. ++|++|+|+||. 
T Consensus        87 kgEsl~Dta~vls~~~D~iv~R~~~~~~~~~~a~~~~vPVINg~~~~~HPtQ~LaDl~Ti~E~~~~~l~gl~ia~vGD~~  166 (334)
T PRK01713         87 HKESMKDTARVLGRMYDAIEYRGFKQSIVNELAKYAGVPVFNGLTDEFHPTQMLADVLTMIEHCEKPLSEISYVYIGDAR  166 (334)
T ss_pred             CCCCHHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCC
T ss_conf             99899999999996285899954672899999986599889389787775899988999999841654674999938975


Q ss_pred             CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHH----HHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHH-
Q ss_conf             5554310100123312576520000132100002----43201332221366466306873322210000002201333-
Q gi|255764473|r  163 NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN----WARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE-  237 (306)
Q Consensus       163 ~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~----~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~-  237 (306)
                      +||+||++.++++||+++++++|+++.|++.+++    +++..|.++.+++|++++++++|+||||+|.+|+++.+... 
T Consensus       167 nnv~~S~~~~~~~lG~~v~i~~P~~~~p~~~~~~~~~~~~~~~g~~i~~~~d~~~a~~~aDvvytd~w~smg~~~~~~~e  246 (334)
T PRK01713        167 NNMGNSLLLIGAKLGMDVRICAPKALLPEDSLVEMCEKFAKESGARITVTDDIDTAVKGVDFVHTDVWVSMGEPLETWGE  246 (334)
T ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHCCCCEEEEEEEEECCCHHHHHHH
T ss_conf             41889999999977997999889765878899999999999719908996078888567868987667636645777889


Q ss_pred             -HHCCCCCCCCHHHHHCC-CCCCEEECCCCC-------------------CCCCCCCHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             -10011123368899628-987299259998-------------------748735767967997106868775599999
Q gi|255764473|r  238 -EHVFQPFQVNLSLMSMA-HPDALFMHCLPA-------------------HRGEEVINEVLDGPQSVVFDEAENRLHTQK  296 (306)
Q Consensus       238 -~~~~~~y~i~~~~l~~a-~~~~~vmHplP~-------------------~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~  296 (306)
                       .+.+.+||||.++|+++ +++++||||||+                   +||+||+++|+|+|+|+||+||+||+|+||
T Consensus       247 r~~~~~~y~v~~elm~~~~~~~~~fmHcLPa~~~~e~~~~~~~~~~~P~~~rG~EIt~~V~d~p~S~if~QAeNrlh~~k  326 (334)
T PRK01713        247 RIDLLMPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKVGRQIAEKYPALANGIEVTEEVFESPMNIAFEQAENRMHTIK  326 (334)
T ss_pred             HHHHHCCCEEHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHCCCCCCCEEECHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             98775178362999975289992996888666531000002456526888787286589968898732689875599999


Q ss_pred             HHHHHHH
Q ss_conf             9999962
Q gi|255764473|r  297 AILLWCF  303 (306)
Q Consensus       297 AiL~~~l  303 (306)
                      |||+++|
T Consensus       327 AvL~~~L  333 (334)
T PRK01713        327 AVMVASL  333 (334)
T ss_pred             HHHHHHH
T ss_conf             9999986


No 12 
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase; InterPro: IPR002082   Aspartate carbamoyltransferase (ATCase) catalyses the formation of carbamoyl-aspartate in the pyrimidine biosynthesis pathway, by the association of aspartate and carbamoyl-phosphate. This is the commitment step in the Escherichia coli pathway and is regulated by feedback inhibition by CTP, the final product of the pathway.   The structural organisation of the ATCase protein varies considerably between different organisms. In bacteria such as E. coli, Salmonella typhimurium and Serratia marcescens, the ATCase is a dodecamer of 2 catalytic (c) trimers and 3 regulatory (r) dimers. The catalytic domains are coded for by the pyrB gene, and the regulatory domains by pyrI. In Gram-positive bacteria such as Bacillus subtilis, ATCase exists as a trimer of catalytic subunits, but unlike in E. coli, it neither contains nor binds to regulatory subunits. In eukaryotes, ATCase is found as a single domain in a multifunctional enzyme that contains activity for glutamine amidotransferase, carbamoylphosphate synthetase, dihydroorotase, and aspartate carbamoyltransferase. ; GO: 0004070 aspartate carbamoyltransferase activity, 0006207 'de novo' pyrimidine base biosynthetic process.
Probab=100.00  E-value=0  Score=656.03  Aligned_cols=299  Identities=30%  Similarity=0.417  Sum_probs=286.9

Q ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCC-CCCCCEEEE--EECCCCCHHHHHHHHHHHHCCC--CCCCCCC-C
Q ss_conf             77178445899999999999999996652366654-437987999--9428883578999989863475--4333321-0
Q gi|255764473|r    6 KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK-PLSGKVLAM--IFEKPSTRTRVSFEVAMKHLGG--DTIFLSG-S   79 (306)
Q Consensus         6 k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~-~l~gk~i~~--lF~e~StRTR~SFe~A~~~LG~--~~~~~~~-~   79 (306)
                      ||+++++||++|||..||+.|.++|+.+....+.. .|+||+|++  +|||||||||+|||+|++||||  .|++|++ .
T Consensus         1 rhli~i~Dl~~Eei~~lL~~A~~l~~~~~~~~~~~~~L~gKi~a~YilFFEPSTRTR~SFE~A~KRLGgPn~v~~~~~~~   80 (336)
T TIGR00670         1 RHLISISDLSREEIELLLETAEELEQVASGEKKLKEALKGKIVANYILFFEPSTRTRLSFETAMKRLGGPNDVVNFSDSE   80 (336)
T ss_pred             CCCEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHHCCCCCEEECCCCC
T ss_conf             96223155785569999999999986315766215866397799999986078550135889888727985456225563


Q ss_pred             CCCCCCCCCHHHHHHHHHHC--CCEEEEEECC----CCHHHHHHCCC-----CCC-EECCCCC-CCHHHHHHHHHHHHHH
Q ss_conf             00012321079999975300--1011121013----20067763012-----441-2404333-2024678765576642
Q gi|255764473|r   80 EMQLGRAETIGDTAKVLSRY--VDAIVMRTTN----HSRLLELTEYA-----TVP-VINALTD-NTHPCQIIADIMTFEE  146 (306)
Q Consensus        80 ~ss~~kgEsl~Dt~~~ls~~--~D~iviR~~~----~~~~~~~~~~~-----~vp-vINa~~~-~~HPtQaL~D~~Ti~e  146 (306)
                      +||++||||+.||++|++.|  +|+|||||+.    .++...+|+++     +|| ||||||| ++||||+|+|+|||.+
T Consensus        81 ~sS~~KGEtL~DTi~~~~~y~D~D~iViRH~~~GvCegaar~~ae~~~R~~~~vPsviNAGDG~~qHPTQ~LLDLyTi~~  160 (336)
T TIGR00670        81 TSSVAKGETLADTIKTLSAYGDSDAIVIRHPLEGVCEGAARLAAEVSDRLGIEVPSVINAGDGSGQHPTQTLLDLYTIYE  160 (336)
T ss_pred             CCCHHCCCCHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             41121054478899988540475569983586541346889998863110457871663687878797534788999998


Q ss_pred             HCC-------CCCCCCEEEECC--CCCCCCCHHHCCCCCC-EEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCC
Q ss_conf             001-------336773046104--5555431010012331-257652000013210000243201332221366466306
Q gi|255764473|r  147 HRG-------SVKGKLFSWSGD--GNNILHSLIEGAARFN-YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVK  216 (306)
Q Consensus       147 ~~g-------~l~~~~i~~vGd--~~~v~hS~i~~~~~~g-~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~  216 (306)
                      .||       .++|+||+++||  ++||+||++.++++|| .++++++|+.+..|+++++..+..|.++.++..++|++.
T Consensus       161 ~fGPDnP~l~~~~Gl~iA~vGDlkygRtvhS~~~~L~~f~~~~v~l~sP~~LrmP~~~~e~~~~~G~~~~~~~~l~e~~~  240 (336)
T TIGR00670       161 EFGPDNPALERLDGLKIALVGDLKYGRTVHSLIKALALFGNAEVYLISPEELRMPKEILEDLKAKGVKVRETESLEEVID  240 (336)
T ss_pred             HHCCCCCCHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCHHHHCHHHHHHHHHHCCCEEEEEEEHHHHHC
T ss_conf             71888630322288579998431202476678899865189569986772430617889998528962899522434421


Q ss_pred             CCCCC---CCCCEEECCCC--CHHHHHHCCCCCCCCHHHHHCCCCC--CEEECCCCCCCCCCCCHHHHCCCCCHHHH-HH
Q ss_conf             87332---22100000022--0133310011123368899628987--29925999874873576796799710686-87
Q gi|255764473|r  217 GAHCV---FTDTWISMNQE--FKAREEHVFQPFQVNLSLMSMAHPD--ALFMHCLPAHRGEEVINEVLDGPQSVVFD-EA  288 (306)
Q Consensus       217 ~aD~V---~~~~~~~~~~~--~~~~~~~~~~~y~i~~~~l~~a~~~--~~vmHplP~~rg~EI~~~v~d~~~s~~~~-Qa  288 (306)
                      .+||+   |++|.|..+.+  ...+..++...|+||.+.|+.++++  ++||||||+||++||+.+|+++|++.||+ ||
T Consensus       241 ~~DVlkiWY~tRiQkER~~~~d~~ey~~~~~~Y~i~~~~L~~~~~~~e~ivlHPlPv~RvdEI~~~vd~~~~~~~f~~Q~  320 (336)
T TIGR00670       241 EADVLKIWYVTRIQKERFPEDDPEEYEKVRGSYGITAERLEAAKKGKEVIVLHPLPVHRVDEIDPEVDDTPHAKYFKDQA  320 (336)
T ss_pred             CCCEEEEEEEECCCCCCCCCCCHHHHHHHHCEEEEEHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             57847886420011123788788999841001466288986306899368847889788566774323664467888875


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             7559999999999625
Q gi|255764473|r  289 ENRLHTQKAILLWCFG  304 (306)
Q Consensus       289 ~Ngl~vr~AiL~~~lG  304 (306)
                      .||++||||||..+++
T Consensus       321 ~nGV~vRMAlL~~~~~  336 (336)
T TIGR00670       321 FNGVPVRMALLSLLLG  336 (336)
T ss_pred             HCCHHHHHHHHHHHCC
T ss_conf             1568999999999629


No 13 
>TIGR03316 ygeW probable carbamoyltransferase YgeW. Members of this protein family include the ygeW gene product of Escherichia coli. The function is unknown. Members show homology to ornithine carbamoyltransferase (TIGR00658) and aspartate carbamoyltransferase (carbamoyltransferase), and therefore may belong to the carbamoyltransferases in function. Members often are found in a large, conserved genomic region associated with purine catabolism.
Probab=100.00  E-value=0  Score=638.44  Aligned_cols=299  Identities=28%  Similarity=0.421  Sum_probs=266.8

Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88771784458999999999999999966523666544379879999428883578999989863475433332100001
Q gi|255764473|r    4 YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQL   83 (306)
Q Consensus         4 ~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~   83 (306)
                      .+||||++.|||++||..||++|.++|..+.++...++|+||+++++|+|||||||+|||+|+++|||+++++++++||+
T Consensus         2 ~~kh~L~~~dls~~ei~~ll~~A~~lK~~~~~~~~~~~L~gk~~~~lF~epSTRTR~SFe~A~~~LGg~~i~l~~~~ss~   81 (357)
T TIGR03316         2 REKDFILTWEWTRDELDTVLDVAFDLKRLRALNISTKLFESGLGISLFRDNSTRTRFSFASAMNLLGLHAQDLDEGKSQI   81 (357)
T ss_pred             CCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             98882881128999999999999999877646887755789889999738984038999999998599599978322447


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCC-----CHHHHHHCC-----------CCCCEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             232107999997530010111210132-----006776301-----------2441240433320246787655766420
Q gi|255764473|r   84 GRAETIGDTAKVLSRYVDAIVMRTTNH-----SRLLELTEY-----------ATVPVINALTDNTHPCQIIADIMTFEEH  147 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~~D~iviR~~~~-----~~~~~~~~~-----------~~vpvINa~~~~~HPtQaL~D~~Ti~e~  147 (306)
                      +||||++||+++||+|+|+||+||..+     ..+.+++++           ++||||||+++.+||||+|+|+|||+|+
T Consensus        82 ~kGEsv~DTarvls~y~D~IviR~~~~~~~~~~~~~e~a~~~~~~~~~~~~~s~vPVINal~d~~HPtQaLaDl~Ti~e~  161 (357)
T TIGR03316        82 GHGETVRETAEMISFFADGIGIRDDMYIGVGNAYMREVAKYVQEGYKDGVLEQRPPLVNLQCDIDHPTQAMADIMTLQEK  161 (357)
T ss_pred             CCCCCHHHHHHHHHHHCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             68988799999999638889998243334037889999987655443102236898783788877836999999999998


Q ss_pred             CCCCC---CCCEEEEC-------CCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHH----CCCCCCCCCCCHHH
Q ss_conf             01336---77304610-------455554310100123312576520000132100002432----01332221366466
Q gi|255764473|r  148 RGSVK---GKLFSWSG-------DGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQ  213 (306)
Q Consensus       148 ~g~l~---~~~i~~vG-------d~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~----~~g~~i~~~~d~~e  213 (306)
                      ||.++   |++|+++|       +++||+||++.++++||+++++++|+++.|++++++.++    +.|.++.+++|+++
T Consensus       162 ~G~~~~l~g~~v~i~~~~~~~~g~~~~Va~Sl~~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~~~~~g~~~~~~~d~~e  241 (357)
T TIGR03316       162 FGGIENLKGKKFAMTWAYSPSYGKPLSVPQGIIGLMTRFGMDVTLAHPEGYHLLPEVIEVAKKNAAENGGKFNIVNSMDE  241 (357)
T ss_pred             HCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHH
T ss_conf             48722467774899986125565153799999999997598099977842367879999999999981992899759999


Q ss_pred             HCCCCCCCCCCCEEECCCCC--------------------HHHHHHCCCCCCCCHHHHHCCCC-CCEEECCCCCC-----
Q ss_conf             30687332221000000220--------------------13331001112336889962898-72992599987-----
Q gi|255764473|r  214 AVKGAHCVFTDTWISMNQEF--------------------KAREEHVFQPFQVNLSLMSMAHP-DALFMHCLPAH-----  267 (306)
Q Consensus       214 al~~aD~V~~~~~~~~~~~~--------------------~~~~~~~~~~y~i~~~~l~~a~~-~~~vmHplP~~-----  267 (306)
                      ++++||+||||+|.||+...                    ......++++||+|.++|+.+++ +++||||||+|     
T Consensus       242 av~~aDVvytd~W~sm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~v~~~~m~~a~~~~ai~MHclPa~~RGv~  321 (357)
T TIGR03316       242 AFKDADIVYPKSWAPIAAMEKRTELYTGSDTEGAELLEQELLSQNKKHKDWVCTEERMALTHDGEALYMHCLPADIRGVS  321 (357)
T ss_pred             HHCCCCEEEECCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHCCCCCEEEECCCCCCCCCCC
T ss_conf             95689999836640137888899886011056788877766656775047511699997478979699799979877888


Q ss_pred             -CCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -48735767967997106868775599999999996
Q gi|255764473|r  268 -RGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC  302 (306)
Q Consensus       268 -rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~  302 (306)
                       ||.||+++|+|+|+|+||+||+||+|+|||||+..
T Consensus       322 ~R~~EIt~eV~d~~~S~i~~QAeNrl~~~~AvLaat  357 (357)
T TIGR03316       322 CEEGEVTEEVFDGYRSVIYKEASNKPYTIAAMIAAT  357 (357)
T ss_pred             CCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             877714899967999709988750499999998529


No 14 
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=100.00  E-value=0  Score=633.03  Aligned_cols=297  Identities=24%  Similarity=0.327  Sum_probs=270.6

Q ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             9988877178445899999999999999996652-366654437987999942888357899998986347543333210
Q gi|255764473|r    1 MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE-NIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGS   79 (306)
Q Consensus         1 ~m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~-~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~   79 (306)
                      |-+++||||+++|||++||+.||++|..+++.+. +.....+|+||+++++|+|||||||+|||+|+++|||++++++.+
T Consensus         1 m~~~prH~L~l~dls~~ei~~ll~~A~~~~~~~~~~~~~~~~L~gk~la~lF~kpSTRTR~SFE~a~~~LGg~~i~l~~~   80 (310)
T PRK13814          1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK   80 (310)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             99888443753219999999999999999986641477776679998999984687324999999999849980576644


Q ss_pred             CCCCCCCCCHHHHHHHHHHC-CCEEEEEECCCCHHHHHHC-CCCCCEECCCCC-CCHHHHHHHHHHHHHHHCCCCCCCCE
Q ss_conf             00012321079999975300-1011121013200677630-124412404333-20246787655766420013367730
Q gi|255764473|r   80 EMQLGRAETIGDTAKVLSRY-VDAIVMRTTNHSRLLELTE-YATVPVINALTD-NTHPCQIIADIMTFEEHRGSVKGKLF  156 (306)
Q Consensus        80 ~ss~~kgEsl~Dt~~~ls~~-~D~iviR~~~~~~~~~~~~-~~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~~~i  156 (306)
                      +||++||||++||+++|+.| +|++|+||++++.++++++ ++++||||||++ .+||||+|+|+|||+|++|+++|++|
T Consensus        81 ~s~l~kgEsi~DTa~vls~~~~d~iv~R~~~~~~~~~la~~~s~~pvINag~~~~~HP~QaLaDl~Ti~E~~g~~~~l~i  160 (310)
T PRK13814         81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV  160 (310)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             35455797789999998741856999976874489999971788874768789877716999989999998397135668


Q ss_pred             EEECC--CCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCC
Q ss_conf             46104--55554310100123312-5765200001321000024320133222136646630687332221000000220
Q gi|255764473|r  157 SWSGD--GNNILHSLIEGAARFNY-LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF  233 (306)
Q Consensus       157 ~~vGd--~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~  233 (306)
                      +||||  +|||+||++.++.++|+ ++++++|..+.|+.       ..+..+..++++.+++.++|+||+++|+.++.+.
T Consensus       161 a~vGD~~~~~va~Sl~~~~~~~g~~~~~~~~P~~~~p~~-------~~~~~~~~~~~~~~a~~~aDvi~t~~~~~e~~~~  233 (310)
T PRK13814        161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDK-------VGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDN  233 (310)
T ss_pred             EEECCCCCCHHHHHHHHHHHHCCCCCEEECCCHHHCCHH-------HCCCCEEEEECCHHHHCCCCEEEECCCHHHHHCC
T ss_conf             996774246999999999997599835852800219166-------7088549981416765479879977306533032


Q ss_pred             HHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             13331001112336889962898729925999874873576796799710686877559999999999625
Q gi|255764473|r  234 KAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       234 ~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
                      ..+...+..+||||.++|+.+++|++||||||+|||+||+++|+|+|+|+||+||+||+|+|||||+++|+
T Consensus       234 ~~~~~~~~~~y~v~~~~l~~a~~dai~MHcLPa~Rg~EIt~eV~d~~~S~v~~QAeNrl~~q~AlL~~lL~  304 (310)
T PRK13814        234 SVDIDAFRGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLL  304 (310)
T ss_pred             HHHHHHHHHCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             55399886526718999961898989989898989986587773698675999997239999999999972


No 15 
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed
Probab=100.00  E-value=0  Score=619.17  Aligned_cols=297  Identities=34%  Similarity=0.555  Sum_probs=260.3

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             98887717844589999999999999999665236665443798799994288835789999898634754333321000
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM   81 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s   81 (306)
                      |+ +||||++.||+++||+.||++|..+|+.+    ..+.|+||+++++|||||||||+|||+|+++|||+++++++++|
T Consensus         1 m~-mkhllsi~dls~~ei~~ll~~A~~~k~~~----~~~~L~gk~v~~lF~epSTRTR~SFE~A~~rLGg~~i~l~~~~s   75 (335)
T PRK04523          1 MS-LKHFLNTQDWSRAELDALLTQAAAFKRNK----LGHALKGKSIALVFFNPSLRTRTSFELGAFQLGGHAIVLQPGKD   75 (335)
T ss_pred             CC-CCCCCCHHHCCHHHHHHHHHHHHHHHCCC----CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99-55417611189999999999999997089----98778999899997379830499999999986998898468776


Q ss_pred             C------------CCCCCCHHHHHHHHHHCCCEEEEEECCC----------CHHHHHHCCCCCCEECCCCCCCHHHHHHH
Q ss_conf             0------------1232107999997530010111210132----------00677630124412404333202467876
Q gi|255764473|r   82 Q------------LGRAETIGDTAKVLSRYVDAIVMRTTNH----------SRLLELTEYATVPVINALTDNTHPCQIIA  139 (306)
Q Consensus        82 s------------~~kgEsl~Dt~~~ls~~~D~iviR~~~~----------~~~~~~~~~~~vpvINa~~~~~HPtQaL~  139 (306)
                      +            ..||||++||+++||+|+|+||+|++.+          ..+.++++++++||||||+ .+||||+|+
T Consensus        76 s~~~~~~~g~~~~~~~~Esl~Dt~~vls~y~D~iviR~~~~~~~~~~~~~~~~~~~~a~~s~vPVIN~g~-~~HPtQaL~  154 (335)
T PRK04523         76 AWPIEFNLGTVMDGDTEEHIAEVARVLSRYVDLIGVRAFPKFVDWEEDRQDPVLNSFAKYSTVPVINMET-ITHPCQELA  154 (335)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEECCCC-CCCCHHHHH
T ss_conf             4322245553225777766999999998439899993253234200001368999999866887306888-888489999


Q ss_pred             HHHHHHHHCCC-CCCCCEE--EECC----CCCCCCCHHHCCCCCCEEEEEECHH-CCCCCCCCHHHH----HCCCCCCCC
Q ss_conf             55766420013-3677304--6104----5555431010012331257652000-013210000243----201332221
Q gi|255764473|r  140 DIMTFEEHRGS-VKGKLFS--WSGD----GNNILHSLIEGAARFNYLLNIATPI-GSEPRNEYLNWA----RNQGASVAL  207 (306)
Q Consensus       140 D~~Ti~e~~g~-l~~~~i~--~vGd----~~~v~hS~i~~~~~~g~~v~~~~P~-~~~~~~~~~~~~----~~~g~~i~~  207 (306)
                      |+|||+|++|. ++|++++  |+||    ++||+||++.++.+||+++++++|. ++.+++.+.+++    +..|.++.+
T Consensus       155 Dl~Ti~e~~g~~~~~~~~~i~~~~~~~~~~~~va~S~~~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~~~~~~g~~v~~  234 (335)
T PRK04523        155 HALALQEHFGTPLRGKKYVLTWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAEQNAAESGGSVQV  234 (335)
T ss_pred             HHHHHHHHHCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999998386336987999985147744146989999999974990899817854679989999999999972985999


Q ss_pred             CCCHHHHCCCCCCCCCCCEEECCCC----CHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCH
Q ss_conf             3664663068733222100000022----013331001112336889962898729925999874873576796799710
Q gi|255764473|r  208 FHDAVQAVKGAHCVFTDTWISMNQE----FKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSV  283 (306)
Q Consensus       208 ~~d~~eal~~aD~V~~~~~~~~~~~----~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~  283 (306)
                      ++|+++++++||+||+++|++|...    .....+.++++|++|.++++.++ |++||||||+|||+||+++|+|+|+|+
T Consensus       235 ~~d~~~al~~aDvvyt~~w~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~-d~i~MHplP~~Rg~Ei~~~V~d~p~s~  313 (335)
T PRK04523        235 SHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTN-NGVFSHCLPLRRNVKATDAVMDSPNCI  313 (335)
T ss_pred             ECCHHHHHHCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCHHHHHCCCC-CCEEECCCCCCCCCCCCHHHHCCCCCH
T ss_conf             8189999732324666666311211561025999998763782499971799-979989999999880278885799876


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             6868775599999999996255
Q gi|255764473|r  284 VFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       284 ~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
                      ||+||+||+|+|||||+|+||-
T Consensus       314 v~~Qa~Ngv~~rmAiL~~ll~~  335 (335)
T PRK04523        314 AIDEAENRLHVQKAIMAALASQ  335 (335)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9999873099999999998486


No 16 
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism]
Probab=100.00  E-value=0  Score=617.22  Aligned_cols=302  Identities=31%  Similarity=0.443  Sum_probs=274.4

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             98887717844589999999999999999665236665443798799994288835789999898634754333321000
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM   81 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s   81 (306)
                      +-++||+|++.||+++|+..||+.|.+++...........|+||+++++|||||||||+|||+|++||||+|++++.++|
T Consensus         4 ~~~~rhlisi~dls~~ei~~ll~~A~~~~~~~~~~~~~~~l~gk~v~~lFFEpSTRTr~SFE~A~krLG~~Vv~~~~~~s   83 (316)
T COG0540           4 PFKMRHLISIEDLSREELELLLDTADEFKAVARAEKKLDLLKGKVVANLFFEPSTRTRLSFETAMKRLGADVVNFSDSES   83 (316)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCHHCCCEEEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             66666250167589999999999999998665024775021276799998458773066499999972993896458766


Q ss_pred             CCCCCCCHHHHHHHHHHC-CCEEEEEECCCCHHHHHHCCCCC-CEECCCCC-CCHHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             012321079999975300-10111210132006776301244-12404333-2024678765576642001336773046
Q gi|255764473|r   82 QLGRAETIGDTAKVLSRY-VDAIVMRTTNHSRLLELTEYATV-PVINALTD-NTHPCQIIADIMTFEEHRGSVKGKLFSW  158 (306)
Q Consensus        82 s~~kgEsl~Dt~~~ls~~-~D~iviR~~~~~~~~~~~~~~~v-pvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~~~i~~  158 (306)
                      |.+||||+.||++++++| +|+||+||+.+++...+++++++ |||||||| ++||||+|+|+|||+|.+|.++|++|++
T Consensus        84 Ss~KGEtL~DT~~tl~ayg~D~iViRH~~egaa~~~a~~~~~~pvINaGDG~~qHPTQ~LLDl~TI~~~~G~~~gl~iai  163 (316)
T COG0540          84 SSKKGETLADTIRTLSAYGVDAIVIRHPEEGAARLLAEFSGVNPVINAGDGSHQHPTQALLDLYTIREEFGRLDGLKIAI  163 (316)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             54466109999999986079989994764148999987358885478888999895289999999999848767947999


Q ss_pred             ECC--CCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEE--CCCCCH
Q ss_conf             104--5555431010012331257652000013210000243201332221366466306873322210000--002201
Q gi|255764473|r  159 SGD--GNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS--MNQEFK  234 (306)
Q Consensus       159 vGd--~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~--~~~~~~  234 (306)
                      |||  ++||+||++.++++||.++++++|+.+.||.++++.....|..+.+.+..+++++++|++|+.|.|.  |.++..
T Consensus       164 vGDlkhsRva~S~~~~L~~~ga~v~lvsP~~L~~p~~i~~~l~~~~~~~~~~~~~e~~i~~~DVl~~lRvQ~ER~~~~~~  243 (316)
T COG0540         164 VGDLKHSRVAHSNIQALKRFGAEVYLVSPETLLPPEYILEELEEKGGVVVEHDSDEEVIEEADVLYMLRVQKERFNDPEE  243 (316)
T ss_pred             ECCCCCHHHHHHHHHHHHHCCCEEEEECCHHHCCCHHHHHHHHHCCCEEEEECCHHHHHCCCCEEEEEHHHHHHCCCCCC
T ss_conf             82544118888779999981987999886586794657888762485279814666642337789852234754478632


Q ss_pred             HH-HHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             33-310011123368899628987299259998748735767967997106868775599999999996255
Q gi|255764473|r  235 AR-EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       235 ~~-~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
                      .. .++|+..|+++.+.+  +|++++||||||+||++||+++|+++|+|+||+||+||+++|||||+.++|-
T Consensus       244 ~s~~~~y~~~~~~~~~~~--~k~~~ivmHP~PvnR~~EI~~~v~~~p~s~~f~Q~~nGV~vRMAlL~~~l~~  313 (316)
T COG0540         244 YSKVKEYYKLYGLTLERL--AKPDAIVMHPLPVNRVVEIASEVDDTPQSRYFQQVKNGVAVRMALLELLLGG  313 (316)
T ss_pred             HHHHHHHHHHHHHHHHHH--CCCCCEEECCCCCCCCCCCCHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHCC
T ss_conf             588888999978899962--6899689788875678757665644617789999962799999999998533


No 17 
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated
Probab=100.00  E-value=0  Score=599.84  Aligned_cols=301  Identities=25%  Similarity=0.349  Sum_probs=270.4

Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88771784458999999999999999966523666544379879999428883578999989863475433332100001
Q gi|255764473|r    4 YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQL   83 (306)
Q Consensus         4 ~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~   83 (306)
                      +.||||++.|||++||..||++|.++|..++.+...++|+||+++++|++||||||+|||+|+.+|||+++++++++||+
T Consensus        19 ~grdfL~l~D~t~eEi~~lldlA~~LK~~k~~g~~~~~l~gk~~~~IFeK~STRTR~SFEva~~~LGg~~~yL~p~~~Ql   98 (395)
T PRK07200         19 HEKDFLLTWEQTPDELKQVLDVAAALKALRAENISTKVFNSGLGISVFRDNSTRTRFSYASALNLLGLAQQDLDEGKSQI   98 (395)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             68877720139999999999999999999976997744589738999706983468999999997799769738987627


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEE-----ECCCCHHHHHHCCC-------C----CCEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             23210799999753001011121-----01320067763012-------4----41240433320246787655766420
Q gi|255764473|r   84 GRAETIGDTAKVLSRYVDAIVMR-----TTNHSRLLELTEYA-------T----VPVINALTDNTHPCQIIADIMTFEEH  147 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~~D~iviR-----~~~~~~~~~~~~~~-------~----vpvINa~~~~~HPtQaL~D~~Ti~e~  147 (306)
                      ++|||++||+|+||+|+|+|++|     +..+....++++++       .    +|||||.++.+||||+|+|++||+|+
T Consensus        99 G~gEsi~DTArVLsR~~D~I~~R~~~~~g~g~~~~~e~a~~~~~~~~~~~vp~~~pViN~LTD~~HPtQ~LADllTi~E~  178 (395)
T PRK07200         99 AHGETVRETANMISFCADAIGIRDDMYLGAGNAYMREVGAALDDGYKQGVLPQRPALVNLQCDIDHPTQSMADLAWLREH  178 (395)
T ss_pred             CCCCCHHHHHHHHHHHHHEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCHHHHHHHHHHHHH
T ss_conf             79988899999998550258873033345414899999999988887346765551232555577858999999999998


Q ss_pred             CCCC---CCCCEEEE-------CCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHH----CCCCCCCCCCCHHH
Q ss_conf             0133---67730461-------0455554310100123312576520000132100002432----01332221366466
Q gi|255764473|r  148 RGSV---KGKLFSWS-------GDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWAR----NQGASVALFHDAVQ  213 (306)
Q Consensus       148 ~g~l---~~~~i~~v-------Gd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~----~~g~~i~~~~d~~e  213 (306)
                      +|.+   +|++++++       ||.+||+||++.++++||+++++++|++|+|.+++++.++    ..|.++++++|+.+
T Consensus       179 ~G~l~~lkg~k~~~~~~y~~~~g~~~nv~~sl~~~~a~lGmdv~ia~P~gy~p~~~~v~~A~~~A~~sG~~i~iT~D~~e  258 (395)
T PRK07200        179 FGSLENLKGKKIAMTWAYSPSYGKPLSVPQGIIGLMTRFGMDVTLAHPEGYDLIPDVVEVAKNNAKASGGSFRQVTSMEE  258 (395)
T ss_pred             HCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCEEEEECCHHH
T ss_conf             18732457863899974146677422689999999977497499978987798989999999999983998999679999


Q ss_pred             HCCCCCCCCCCCEEECC---CCCHH-----------------HHHHCCCCCCCCHHHHHCC-CCCCEEECCCCCC-----
Q ss_conf             30687332221000000---22013-----------------3310011123368899628-9872992599987-----
Q gi|255764473|r  214 AVKGAHCVFTDTWISMN---QEFKA-----------------REEHVFQPFQVNLSLMSMA-HPDALFMHCLPAH-----  267 (306)
Q Consensus       214 al~~aD~V~~~~~~~~~---~~~~~-----------------~~~~~~~~y~i~~~~l~~a-~~~~~vmHplP~~-----  267 (306)
                      |+++||+||||+|.||.   +..+.                 .....+++||||.++|+++ +++++||||||++     
T Consensus       259 Av~gADvIYTDvW~sm~~~~e~~e~l~~~~~~~~~~~e~e~~~r~~~~~~yqVn~~lm~~a~~~~aifMHCLPA~~~~~~  338 (395)
T PRK07200        259 AFKDADIVYPKSWAPYKVMEERTELLRANDHEGLKALEKQCLAQNAQHKDWHCTEEMMELTKDGEALYMHCLPADISGVS  338 (395)
T ss_pred             HHCCCCEEECCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCEECHHHHHHCCCCCEEEEECCCCCCCCCC
T ss_conf             95799999727877765443106653123102344567777655304789546799998427998599836899876667


Q ss_pred             -CCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             -4873576796799710686877559999999999625
Q gi|255764473|r  268 -RGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       268 -rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
                       ||.||+++|+|+|+|++|+|||||+|+++|||..+++
T Consensus       339 ~r~~EVTdeVfd~p~SvVFdEAENRlHtiKAvMvat~~  376 (395)
T PRK07200        339 CKEGEVTEGVFEKYRIATYKEASWKPYIIAAMILSRKY  376 (395)
T ss_pred             CCCCEECHHHHCCCCCCEECHHCCHHHHHHHHHHHHHC
T ss_conf             76760127540577762433121228999999999530


No 18 
>PRK11891 aspartate carbamoyltransferase; Provisional
Probab=100.00  E-value=0  Score=586.85  Aligned_cols=300  Identities=25%  Similarity=0.400  Sum_probs=281.3

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCC-CCCCC
Q ss_conf             87717844589999999999999999665236665443798799994288835789999898634754333321-00001
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSG-SEMQL   83 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~-~~ss~   83 (306)
                      .+|+||+++|+++++..||..|+++....++......|+||+++++|||||||||+|||+|+++|||+|+.++. ..||+
T Consensus        88 ~~HiLSv~qf~R~~l~~lF~vA~~m~~~a~r~~~~~vL~GkILa~LFfEpSTRTr~SFe~Am~RLGG~Vi~~~~~~~SS~  167 (430)
T PRK11891         88 KPQLLSVDQFSRDSVEALFRVADMMQPIARRQKISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSM  167 (430)
T ss_pred             CCEEEEHHHCCHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCEEEEEECCCCCCCHHHHHHHHHHCCCEEECCCCCCCCCC
T ss_conf             85177455428989999999999988988662331131475788862378675066899999977981836788874642


Q ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCC-CCHHHHHHHHHHHHHHHCC----CCCCCCEEE
Q ss_conf             23210799999753001011121013200677630124412404333-2024678765576642001----336773046
Q gi|255764473|r   84 GRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD-NTHPCQIIADIMTFEEHRG----SVKGKLFSW  158 (306)
Q Consensus        84 ~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~g----~l~~~~i~~  158 (306)
                      .||||++||++++++|+|+||+||+..+....+++++.+|||||||| ++||||||+|+|||++.+|    .++|++|++
T Consensus       168 ~KGEsl~DT~r~l~~Y~D~iV~RHp~~Gs~~~aa~~s~vPVINaGDG~~eHPTQaLLDl~TI~~e~g~~~~~idGl~Ial  247 (430)
T PRK11891        168 AKGESIYDTSRVMSGYVDALVIRHPEQGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKIVDGAHIAL  247 (430)
T ss_pred             CCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEE
T ss_conf             37777999999996269899991898358999986479873635788666832677777889987532235557857998


Q ss_pred             ECC--CCCCCCCHHHCCCCC-CEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHH
Q ss_conf             104--555543101001233-12576520000132100002432013322213664663068733222100000022013
Q gi|255764473|r  159 SGD--GNNILHSLIEGAARF-NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA  235 (306)
Q Consensus       159 vGd--~~~v~hS~i~~~~~~-g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~  235 (306)
                      |||  ++|++||++.++++| +.++++++|+++.+|+++.+.....|..+.+++++++++.++|++|+++.|...... .
T Consensus       248 vGDLKyGRTVHSL~klLs~y~~v~~~lVSP~~L~mP~~i~~~l~~~g~~~~e~~~L~e~i~~~DVlY~TRIQkERF~~-e  326 (430)
T PRK11891        248 VGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIVDQISTNGHVIEQTDDLAAGLRGADVVYATRIQKERFTD-E  326 (430)
T ss_pred             ECCCCCCCCHHHHHHHHHHCCCCEEEEECCHHHCCCHHHHHHHHHCCCEEEEECCHHHHCCCCCEEEECCCCCCCCCC-H
T ss_conf             645456600989999998546946999892130798899999997798699937875740347989857733144897-6


Q ss_pred             HHHHCCCCCCCCHHHHH-CCCCCCEEECCCCCCC---CCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             33100111233688996-2898729925999874---8735767967997106868775599999999996255
Q gi|255764473|r  236 REEHVFQPFQVNLSLMS-MAHPDALFMHCLPAHR---GEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       236 ~~~~~~~~y~i~~~~l~-~a~~~~~vmHplP~~r---g~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
                      ++..+...|.++.+.+. .+|+|++||||||.|+   ..||+.||+++|++.||+|++||+|+|||||+.+||+
T Consensus       327 e~~~~~~~~~l~~~~l~~~aK~~~iIMHPLPRnsr~~vnEIs~eVD~dPRAaYFRQa~nGv~VRMALLalvLGV  400 (430)
T PRK11891        327 SFEGYTPDFQINQALVDAVCKPDTLIMHPLPRDSRPGANDLSTDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGV  400 (430)
T ss_pred             HHHHHHCCEEECHHHHHHHCCCCCEEECCCCCCCCCCCCCCCHHHCCCCCHHHHHHHHCCHHHHHHHHHHHHCC
T ss_conf             78887478778799998526999788799898988887817752458961038888751899999999998293


No 19 
>KOG1504 consensus
Probab=100.00  E-value=0  Score=536.56  Aligned_cols=301  Identities=44%  Similarity=0.693  Sum_probs=283.6

Q ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHC-CCC-CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             888771784458999999999999999966523-666-544379879999428883578999989863475433332100
Q gi|255764473|r    3 TYPKHFADLSNISSSNLSCIIEVAKKIKNSSEN-IFE-NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSE   80 (306)
Q Consensus         3 ~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~-~~~-~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~   80 (306)
                      +..||||+|+||+.++|..++++|.++|..-++ +.. ..+|+||+++|+|.++|||||+|||.|..-||||+.+++..+
T Consensus        37 s~~r~llsikd~s~eeik~ll~rase~K~~~Kqn~e~n~~~l~gks~amIF~KrStRTRvStEt~~~~lGg~~mfLg~~D  116 (346)
T KOG1504          37 SDLRDLLSIKDFSTEEIKTLLDRASEVKALLKQNGERNYLPLKGKSMAMIFAKRSTRTRVSTETGFFLLGGHPMFLGKND  116 (346)
T ss_pred             CCHHHEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCCEEEEECHHHHHHCCCCEEECCHH
T ss_conf             56455053014776899999988899999998468534555567546788862665157750012454278520205312


Q ss_pred             CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCC-CCCCCEEEE
Q ss_conf             0012321079999975300101112101320067763012441240433320246787655766420013-367730461
Q gi|255764473|r   81 MQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGS-VKGKLFSWS  159 (306)
Q Consensus        81 ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~-l~~~~i~~v  159 (306)
                      .++++.||+.||+|++|.|+|+|+.|...|..+..+++++++||||+++++.||+|+|+|++||.|++|. ++|+|++|+
T Consensus       117 IqlGvnEs~~DtarVlSsm~d~I~ARV~khsDi~tlak~sSvPiINgL~D~~HPlQ~laD~LTi~E~f~ks~~glkvawi  196 (346)
T KOG1504         117 IQLGVNESLYDTARVLSSMVDIIMARVNKHSDILTLAKYSSVPIINGLCDHFHPLQILADLLTIIEHFGKSVEGLKVAWI  196 (346)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             10244222676999999988999998762335999864268863324202467489999999999987343455079997


Q ss_pred             CCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHH----HCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHH
Q ss_conf             045555431010012331257652000013210000243----2013322213664663068733222100000022013
Q gi|255764473|r  160 GDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKA  235 (306)
Q Consensus       160 Gd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~----~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~  235 (306)
                      ||+|||.|||+.+++++|+.+.+++|+++.|+.+.+..+    +.+|.++.+++|+.+|..++|+++||.|.||+++++.
T Consensus       197 GD~NNvlhs~mia~ak~gih~s~atPkg~e~d~div~~akq~a~eNgsk~eltnDp~eA~~~anvlvtDtwiSMGqe~ek  276 (346)
T KOG1504         197 GDGNNVLHSWMIAAAKFGIHFSCATPKGYEPDKDIVSKAKQAAEENGSKFELTNDPLEAVIGANVLVTDTWISMGQEDEK  276 (346)
T ss_pred             CCCCHHHHHHHHHHHHCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHCCCCEEEEEHHHHCCHHHHH
T ss_conf             26508899999986331437885289998856689999999987058778974582886348867997314442637799


Q ss_pred             HHH-HCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             331-001112336889962898729925999874873576796799710686877559999999999625
Q gi|255764473|r  236 REE-HVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       236 ~~~-~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
                      +.+ +.|+.||||.++++.+++++.||||||+++ +|++++|+.+|+|++|+|||||+|++||++..+||
T Consensus       277 earlkaFqGfQV~~el~kvA~~~~~FmHCLPr~~-eEVsdeVfy~~~SiVF~eAENR~~a~mavm~~ll~  345 (346)
T KOG1504         277 EARLKAFQGFQVTEELMKVAGPKAKFMHCLPRHP-EEVSDEVFYGPYSIVFPEAENRKWAQMAVMLHLLG  345 (346)
T ss_pred             HHHHHHHCCCEEHHHHHHHHCCCCEEEECCCCCH-HHCCCCEEECCCEEECCHHHHHHHHHHHHHHHHHC
T ss_conf             9999862372230899964178745762168880-22367526545405551333057899999999843


No 20 
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional
Probab=100.00  E-value=0  Score=402.84  Aligned_cols=302  Identities=20%  Similarity=0.243  Sum_probs=253.6

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCC---CCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCC-CCCC
Q ss_conf             877178445899999999999999996652366654---437987999942888357899998986347543333-2100
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENK---PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFL-SGSE   80 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~---~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~-~~~~   80 (306)
                      .|.+.-++||+.++-..|++.++++|..|++...-.   .-++-.|..+|||||||||+||+.|+++|||.++.+ +..+
T Consensus         7 grsl~vi~d~sv~eq~fly~~tk~lk~~~~~~~d~~ef~ik~d~~iyivFfEPSTRTRlSFesAa~~lgG~vV~~~~~~s   86 (524)
T PRK13376          7 GRSLTVIEDLSVEEQLFLYEKTKELKQKWYNKEDVSEFQIKKDVGIYIVFVEPSTRTKESFINAAKFHKNAKVNIFDSEH   86 (524)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEECCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             65035430356588899999899999986340332120451544289999668773077799999984897675337665


Q ss_pred             CCCCCCCCHHHHHHHHHHCCC--EEEEEECCCCH-------HHHHHCCCCC---CEECCCCC-CCHHHHHHHHHHHHHHH
Q ss_conf             001232107999997530010--11121013200-------6776301244---12404333-20246787655766420
Q gi|255764473|r   81 MQLGRAETIGDTAKVLSRYVD--AIVMRTTNHSR-------LLELTEYATV---PVINALTD-NTHPCQIIADIMTFEEH  147 (306)
Q Consensus        81 ss~~kgEsl~Dt~~~ls~~~D--~iviR~~~~~~-------~~~~~~~~~v---pvINa~~~-~~HPtQaL~D~~Ti~e~  147 (306)
                      ||++||||+.||++++++|+|  +||+||+..++       +.++|....+   |||||||| ++||||+|+|+|||+|.
T Consensus        87 SS~~KGESL~DTirvlsgYsDasIIVmRHP~eGaaRll~e~v~efA~~~~v~vp~~INAGDG~nEHPTQaLLDLfTI~ee  166 (524)
T PRK13376         87 SSFNKQESYVDTFNMLTGYSDYSIFIVRTRLEGVCRLLERKVSEFASRHGIERPAFINAGDGKHEHPTQELLDEFTFLEQ  166 (524)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             52015850999999986336762799947887721456788998886448987853778889888832899999999998


Q ss_pred             CC-CCCCCCEEEECC--CCCCCCCHHHCCCCC-CEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCC--
Q ss_conf             01-336773046104--555543101001233-125765200001321000024320133222136646630687332--
Q gi|255764473|r  148 RG-SVKGKLFSWSGD--GNNILHSLIEGAARF-NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCV--  221 (306)
Q Consensus       148 ~g-~l~~~~i~~vGd--~~~v~hS~i~~~~~~-g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V--  221 (306)
                      .| .+++++|+.|||  ++|++||++.++++| +.++.+++|+.+..|+.+++..+.+|..+.++.+.+|.++..|+-  
T Consensus       167 ~g~~~~~I~IAlVGDLK~GRTVHSL~~aL~~fkNV~~~LISPeEL~MP~~yiekmk~~G~evr~f~si~eyl~~~~~a~i  246 (524)
T PRK13376        167 NNFDNSFIHIALVGDLLHGRTVHSKVNGLKIFKNVKVDLIAPEELQMPEHYIEKMKKNGFEVRIFSSIEEYLKQKDVAKI  246 (524)
T ss_pred             HCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCEEEEECHHHHCCCHHHHHHHHHCCCEEEECCHHHHHHHCCCCHHE
T ss_conf             38777855999974434571188899888762483899988788069889999998669148851049998704761124


Q ss_pred             -CCCCE--EECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCC-CCCCHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             -22100--0000220133310011123368899628987299259998748-7357679679971068687755999999
Q gi|255764473|r  222 -FTDTW--ISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRG-EEVINEVLDGPQSVVFDEAENRLHTQKA  297 (306)
Q Consensus       222 -~~~~~--~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg-~EI~~~v~d~~~s~~~~Qa~Ngl~vr~A  297 (306)
                       |-++.  .+|++.-...+.-..+.--.+.+.|++.+.++.|.||||.++- -+|...+++.|-.-.=+|+.||.|+|+-
T Consensus       247 wyftrlqlermge~ilek~~~lr~~vtf~k~~l~~~pe~~kfyhplpr~~~~ptip~fld~~plngwe~qa~ngy~~r~v  326 (524)
T PRK13376        247 WYFTRLQLERMGEDILEKEHILRKSVTFRKEFLDKLPEGVKFYHPLPRHKVYPTIPTFLDTLPLNGWETQAINGYWVRIV  326 (524)
T ss_pred             EEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCEEHHHH
T ss_conf             77508889877788888899987652027878753636660036688555689876423578887155553055446999


Q ss_pred             HHHHHHCCC
Q ss_conf             999962559
Q gi|255764473|r  298 ILLWCFGII  306 (306)
Q Consensus       298 iL~~~lG~~  306 (306)
                      +|.++-|.+
T Consensus       327 llsmlgga~  335 (524)
T PRK13376        327 LLSMLGGAL  335 (524)
T ss_pred             HHHHHCCCC
T ss_conf             999854642


No 21 
>pfam02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain.
Probab=100.00  E-value=0  Score=339.95  Aligned_cols=140  Identities=46%  Similarity=0.762  Sum_probs=135.3

Q ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             77178445899999999999999996652366654437987999942888357899998986347543333210000123
Q gi|255764473|r    6 KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGR   85 (306)
Q Consensus         6 k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~k   85 (306)
                      ||||++.||++++|..|+++|..+|+.+.++.  ++|+||+++++|+|||||||+|||.|+++|||+++++++.+||++|
T Consensus         1 kh~l~i~dls~~ei~~ll~~A~~~k~~~~~~~--~~l~gk~i~~lF~epSTRTR~SFe~A~~~LGg~~i~l~~~~s~~~k   78 (140)
T pfam02729         1 RHLLSLDDLSREELEALLDLAAELKKKPRSGS--PLLRGKTLALLFFEPSTRTRLSFEAAAKRLGGHVIYLDPGSSSLGK   78 (140)
T ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCC--CCCCCCEEEEEECCCCCCCEEEHHHHHHHCCCCEEECCCCCCCCCC
T ss_conf             99786022599999999999999984232167--5578988999853788741122076898669846873633355778


Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             21079999975300101112101320067763012441240433320246787655766420
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEH  147 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~  147 (306)
                      |||++||+++|++|+|++|+||++++.+.++++++++||||||++.+||||+|+|+|||+|+
T Consensus        79 gEsi~Dt~~vls~~~D~iv~R~~~~~~~~~~a~~~~vPVINa~~~~~HPtQaL~Dl~Ti~e~  140 (140)
T pfam02729        79 GESLKDTARVLSRYVDAIVIRHPSHGALEELAKYSSVPVINAGDDHEHPTQALADLLTIREH  140 (140)
T ss_pred             CCCHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHC
T ss_conf             84799999999985999999899611699999868978898999998748999999998609


No 22 
>pfam00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain.
Probab=100.00  E-value=8.9e-41  Score=287.39  Aligned_cols=148  Identities=41%  Similarity=0.659  Sum_probs=133.2

Q ss_pred             CCCCEEEECCC--CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHC-----CCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             67730461045--55543101001233125765200001321000024320-----133222136646630687332221
Q gi|255764473|r  152 KGKLFSWSGDG--NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARN-----QGASVALFHDAVQAVKGAHCVFTD  224 (306)
Q Consensus       152 ~~~~i~~vGd~--~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~-----~g~~i~~~~d~~eal~~aD~V~~~  224 (306)
                      +|++|+||||.  |||+||++.++++||+++++++|+++.|+++..+.++.     .+..+.+++|+.++++++|+|||+
T Consensus         1 ~g~~i~~vGD~~~~rv~~S~~~~~~~~g~~v~i~~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~al~~aDvvyt~   80 (155)
T pfam00185         1 DGLKVAIVGDGKHNRVAHSLILALAKFGMEVVLVAPKGLPPDPELVDEAKKNALKSGGISITVTDDLEEALKGADVVYTD   80 (155)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHCCCCEEEEE
T ss_conf             99899998378727499999999998499899987852388889999999998862897499984999984539999997


Q ss_pred             CEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             000000220133310011123368899628987299259998748735767967997106868775599999999996
Q gi|255764473|r  225 TWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWC  302 (306)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~  302 (306)
                      +|+....   ...++++++||||.++|++++++++||||||+|||.||+++|+++|+|+||+||+||+|+|||||+|+
T Consensus        81 ~wq~e~~---~~~~~~~~~y~v~~~ll~~~~~~~i~mH~LP~~R~~Ei~~~V~~~p~s~v~~Qa~Nr~~~r~AlL~~l  155 (155)
T pfam00185        81 RWQKERE---ERLEEFKPDYQVTAELLKKAKPDAIVMHPLPAHRGEEITDDVDDGPRSVIFDQAENGLHVRMALLALL  155 (155)
T ss_pred             EEEHHHH---HHHHHCCCCCEECHHHHHHCCCCCEEECCCCCCCCEEECHHHHCCCCCHHHHHHHHCHHHHHHHHHHC
T ss_conf             6541055---56764176947999999614899489668776668196577855874689999983899999999769


No 23 
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated
Probab=97.55  E-value=0.00051  Score=46.56  Aligned_cols=140  Identities=15%  Similarity=0.203  Sum_probs=88.9

Q ss_pred             HHHCCCCCCEECC-CCCC-CHHHHHHHHHHHHHHHCCC-CCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCC
Q ss_conf             7630124412404-3332-0246787655766420013-36773046104555543101001233125765200001321
Q gi|255764473|r  115 ELTEYATVPVINA-LTDN-THPCQIIADIMTFEEHRGS-VKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPR  191 (306)
Q Consensus       115 ~~~~~~~vpvINa-~~~~-~HPtQaL~D~~Ti~e~~g~-l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~  191 (306)
                      +..+...|+|.|| |++. +=---+++=++.+.+..|. +.|+++.++|-++ |..-....+..||+++..+.|....  
T Consensus        75 ~~l~~~gI~v~naPG~Na~sVaEyvl~~ll~la~~~g~~l~gktvGIIG~G~-IG~~va~~l~afG~~vl~~DP~~~~--  151 (379)
T PRK00257         75 DYFAEAGITWSNAPGCNARGVVDYVLGSLLTLAEREGVDLAERTYGIVGVGH-VGGRLVRVLRGLGWKVLVCDPPRQE--  151 (379)
T ss_pred             HHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCHHHCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCHHHH--
T ss_conf             9998699789969987779999999999999998508665198799977167-9999999999779989997845766--


Q ss_pred             CCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCC
Q ss_conf             00002432013322213664663068733222100000022013331001112336889962898729925999874873
Q gi|255764473|r  192 NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEE  271 (306)
Q Consensus       192 ~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~E  271 (306)
                              ..  ....+.++++.++.+|+|.--+  .+..+     ..+-...-+|.+.++..++++++.-+.   ||.=
T Consensus       152 --------~~--~~~~~~sleell~~sDiIslHv--PLt~~-----g~~~T~~Li~~~~L~~mk~~aiLINts---RG~V  211 (379)
T PRK00257        152 --------AE--GDGDFVSLERILEECDIISLHT--PLTKE-----GEHPTWHLLDEAFLASLRPGAWLINAS---RGAV  211 (379)
T ss_pred             --------HH--CCCCEECHHHHHHHCCEEEEEC--CCCCC-----CCCCCCCCCCHHHHHHCCCCCEEEECC---CCHH
T ss_conf             --------43--3860334999987499999925--77778-----875320471999996079980999889---7300


Q ss_pred             CCHHHH
Q ss_conf             576796
Q gi|255764473|r  272 VINEVL  277 (306)
Q Consensus       272 I~~~v~  277 (306)
                      |+.+.+
T Consensus       212 VDe~AL  217 (379)
T PRK00257        212 VDNQAL  217 (379)
T ss_pred             CCHHHH
T ss_conf             199999


No 24 
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Probab=96.73  E-value=0.034  Score=34.60  Aligned_cols=187  Identities=12%  Similarity=0.058  Sum_probs=107.0

Q ss_pred             CCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             1784458999999999999999966523666544379879999428883578999-989863475433332100001232
Q gi|255764473|r    8 FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF-EVAMKHLGGDTIFLSGSEMQLGRA   86 (306)
Q Consensus         8 ~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SF-e~A~~~LG~~~~~~~~~~ss~~kg   86 (306)
                      +|+=+.+.++--..+-+...+++.   +......|   .+.++=..|+.++.... +.+|.++|..+..+.-.+. . ..
T Consensus         5 ildGk~iA~~i~~~l~~~v~~~~~---~~~~~P~L---avilvg~d~aS~~Yv~~K~k~a~~~Gi~~~~~~l~~~-~-s~   76 (288)
T PRK10792          5 IIDGKTIAQQVRSEVAQKVQARIA---AGLRAPGL---AVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPET-T-SE   76 (288)
T ss_pred             EEEHHHHHHHHHHHHHHHHHHHHH---CCCCCCCE---EEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEECCCC-C-CH
T ss_conf             725699999999999999999997---38999857---9999589844799999999999975997999866889-9-99


Q ss_pred             CCHHHHHHHHHH--CCCEEEEEECC--C---CH-HHHHHCCCCC---CEECCC-----CCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             107999997530--01011121013--2---00-6776301244---124043-----3320246787655766420013
Q gi|255764473|r   87 ETIGDTAKVLSR--YVDAIVMRTTN--H---SR-LLELTEYATV---PVINAL-----TDNTHPCQIIADIMTFEEHRGS  150 (306)
Q Consensus        87 Esl~Dt~~~ls~--~~D~iviR~~~--~---~~-~~~~~~~~~v---pvINa~-----~~~~HPtQaL~D~~Ti~e~~g~  150 (306)
                      |.+.+.++-|+.  -+|+|.+-.|-  +   .. +..+.-..++   .-.|.|     .....||-+++=+.-+.++.-.
T Consensus        77 ~el~~~I~~LN~d~~V~GIiVQlPLP~~id~~~i~~~I~p~KDVDGl~~~N~G~L~~~~~~~~PcTp~av~~lL~~y~i~  156 (288)
T PRK10792         77 AELLALIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNID  156 (288)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             99999999996799878637836899885779998514988898879988998770699866787199999999974756


Q ss_pred             CCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             3677304610455554310100123312576520000132100002432013322213664663068733222
Q gi|255764473|r  151 VKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       151 l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                      ++|++++++|..+-|..-+..++..-|+.+++|.-.                     +.|+.+..+.||+|.+
T Consensus       157 ~~Gk~vvVvGrS~iVGkPla~lL~~~~atVTichs~---------------------T~nl~~~~~~ADIvIs  208 (288)
T PRK10792        157 TFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRF---------------------TKNLRHHVENADLLIV  208 (288)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHCCCEEEEECCC---------------------CCCHHHHHHHCCEEEE
T ss_conf             378889995676634389999998669959862578---------------------8788999985789764


No 25 
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]
Probab=96.62  E-value=0.011  Score=37.74  Aligned_cols=140  Identities=17%  Similarity=0.196  Sum_probs=89.0

Q ss_pred             HHHHCCCCCCEECCCCCCCHHHH--HHHHHHHHHH-----------------HCC--CCCCCCEEEECCCCCCCCCHHHC
Q ss_conf             77630124412404333202467--8765576642-----------------001--33677304610455554310100
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHPCQ--IIADIMTFEE-----------------HRG--SVKGKLFSWSGDGNNILHSLIEG  172 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HPtQ--aL~D~~Ti~e-----------------~~g--~l~~~~i~~vGd~~~v~hS~i~~  172 (306)
                      .+.+....++|.|+.+.+..+..  +++=++.+.+                 .+.  .+.|+++.++|-+ ++..-....
T Consensus        82 ~~~~~~~gi~V~nap~~na~~vAE~~~~~~L~~~R~~~~~~~~~~~g~W~~~~~~g~el~gkTvGIiG~G-~IG~~va~~  160 (324)
T COG0111          82 LEAATKRGILVVNAPGGNAISVAELVLALLLALARRIPDADASQRRGEWDRKAFRGTELAGKTVGIIGLG-RIGRAVAKR  160 (324)
T ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCC-HHHHHHHHH
T ss_conf             3553137437996798653769999999999996056477899872867523566510169889998987-899999999


Q ss_pred             CCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHH
Q ss_conf             12331257652000013210000243201332221366466306873322210000002201333100111233688996
Q gi|255764473|r  173 AARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMS  252 (306)
Q Consensus       173 ~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~  252 (306)
                      +..||+++....|..-....      ..  ..+....++++.+..+|+|..-  ....++         ..-.+|.+.++
T Consensus       161 l~afgm~v~~~d~~~~~~~~------~~--~~~~~~~~Ld~lL~~aDiv~lh--~PlT~e---------T~g~i~~~~~a  221 (324)
T COG0111         161 LKAFGMKVIGYDPYSPRERA------GV--DGVVGVDSLDELLAEADILTLH--LPLTPE---------TRGLINAEELA  221 (324)
T ss_pred             HHHCCCEEEEECCCCCCCCC------CC--CCCEECCCHHHHHHHCCEEEEC--CCCCCH---------HHCCCCHHHHH
T ss_conf             98679869998898860001------23--5631102699998769999983--899812---------22137999994


Q ss_pred             CCCCCCEEECCCCCCCCCCCCHHH
Q ss_conf             289872992599987487357679
Q gi|255764473|r  253 MAHPDALFMHCLPAHRGEEVINEV  276 (306)
Q Consensus       253 ~a~~~~~vmHplP~~rg~EI~~~v  276 (306)
                      ++|+.+++..|.   ||.=|+.+.
T Consensus       222 ~MK~gailIN~a---RG~vVde~a  242 (324)
T COG0111         222 KMKPGAILINAA---RGGVVDEDA  242 (324)
T ss_pred             CCCCCCEEEECC---CCCEECHHH
T ss_conf             489981999888---752035899


No 26 
>PRK08605 D-lactate dehydrogenase; Validated
Probab=96.51  E-value=0.074  Score=32.41  Aligned_cols=129  Identities=18%  Similarity=0.217  Sum_probs=71.6

Q ss_pred             HHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHHHC-------------------C-CCCCCCEEEECCCCCCCCCHHH
Q ss_conf             7763012441240433320246--7876557664200-------------------1-3367730461045555431010
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHPC--QIIADIMTFEEHR-------------------G-SVKGKLFSWSGDGNNILHSLIE  171 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e~~-------------------g-~l~~~~i~~vGd~~~v~hS~i~  171 (306)
                      .+.++...|+|.|.-+......  .+++=++.+.++.                   | .+.++++.++|- +|+......
T Consensus        85 l~~a~~~gI~V~n~P~~~~~aVAE~ai~liL~l~R~i~~~~~~~~~~~~~w~~~~~g~~l~~ktvGIiG~-G~IG~~vak  163 (332)
T PRK08605         85 LELANKYNIIISNVPSYSPESIAEFTVTQAINLVRHFNLIQTKVREHDFRWEPPILSRSIKDLKVAVIGT-GRIGLAVAK  163 (332)
T ss_pred             HHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCEECCCCEEEEEEE-EHHHHHHHH
T ss_conf             9999979998995998684899999999999998565999999982587647765754503778999974-368899999


Q ss_pred             C-CCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHH
Q ss_conf             0-123312576520000132100002432013322213664663068733222100000022013331001112336889
Q gi|255764473|r  172 G-AARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSL  250 (306)
Q Consensus       172 ~-~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~  250 (306)
                      . +..||+++....|.   +.+..     ..  .+.+..++++.++.+|+|..-+  ....+         ....++.+.
T Consensus       164 ~~a~~fgm~vi~yd~~---~~~~~-----~~--~~~~~~~l~ell~~sDiIslh~--Plt~~---------T~~lI~~~~  222 (332)
T PRK08605        164 IFAKGYGCDVVAYDPF---PNAKA-----AT--YVDYKDTIEEAVEGADIVTLHM--PATKY---------NTYLFNADL  222 (332)
T ss_pred             HHHHHCCCEEEEECCC---CCHHH-----HH--CCEECCCHHHHHHHCCEEEEEC--CCCHH---------HHHHCCHHH
T ss_conf             9987569826787788---76556-----62--0702168999986499999933--68835---------501218999


Q ss_pred             HHCCCCCCEEECCC
Q ss_conf             96289872992599
Q gi|255764473|r  251 MSMAHPDALFMHCL  264 (306)
Q Consensus       251 l~~a~~~~~vmHpl  264 (306)
                      ++++|+++++--+.
T Consensus       223 l~~MK~~a~lINta  236 (332)
T PRK08605        223 FKHFKKGAVFVNCA  236 (332)
T ss_pred             HHHCCCCCEEEEEC
T ss_conf             97224796899906


No 27 
>PRK13243 glyoxylate reductase; Reviewed
Probab=96.50  E-value=0.02  Score=36.14  Aligned_cols=140  Identities=16%  Similarity=0.166  Sum_probs=85.1

Q ss_pred             CHHHHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHHH-------------------------CC-CCCCCCEEEECCC
Q ss_conf             0067763012441240433320246--787655766420-------------------------01-3367730461045
Q gi|255764473|r  111 SRLLELTEYATVPVINALTDNTHPC--QIIADIMTFEEH-------------------------RG-SVKGKLFSWSGDG  162 (306)
Q Consensus       111 ~~~~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e~-------------------------~g-~l~~~~i~~vGd~  162 (306)
                      ..-.+.++.-.|+|.|+-+....+.  .+++=++.+.++                         .| .+.|+++.++|-+
T Consensus        80 ~ID~~~a~~~gI~V~ntpg~~~~sVAE~~~~liL~~~R~i~~~~~~~r~g~w~~~~~~~~p~~~~g~eL~gktlGIiG~G  159 (333)
T PRK13243         80 NIDVEEATKRGIYVTNTPGVLTEATADFAFALLLATARRVVEADKFVRSGEWKRRGVAWHPMMFLGYDVYGKTIGIVGFG  159 (333)
T ss_pred             CCCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             30599999699789968996847999999999999986499999999849866456666763445646678899997925


Q ss_pred             CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCC
Q ss_conf             55543101001233125765200001321000024320133222136646630687332221000000220133310011
Q gi|255764473|r  163 NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQ  242 (306)
Q Consensus       163 ~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~  242 (306)
                       |+.......+.-||+++....|..  . +   +..+..|.+   +.++++.++.+|+|..-+  .+..+         .
T Consensus       160 -~IG~~vak~~~~fgm~V~~~d~~~--~-~---~~~~~~~~~---~~~l~ell~~sDiIslh~--Plt~e---------T  218 (333)
T PRK13243        160 -RIGQAIARRAKGFGMRILYYSRTR--K-P---EVEKELGAE---YRPLEDLLRESDFVVLAV--PLTKE---------T  218 (333)
T ss_pred             -HHHHHHHHHHHHCCCEEEEECCCC--C-H---HHHHHCCCE---EECHHHHHHHCCEEEECC--CCCCC---------C
T ss_conf             -668999999997699999989989--8-6---678760968---811999742165266425--58601---------3


Q ss_pred             CCCCCHHHHHCCCCCCEEECCCCCCCCCCCCH
Q ss_conf             12336889962898729925999874873576
Q gi|255764473|r  243 PFQVNLSLMSMAHPDALFMHCLPAHRGEEVIN  274 (306)
Q Consensus       243 ~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~  274 (306)
                      ...++.+.++++|+++++..+.   ||.=|+.
T Consensus       219 ~~li~~~~~~~MK~~a~lIN~a---RG~iVde  247 (333)
T PRK13243        219 YHMINEERLKLMKKTAILVNIA---RGKVVDT  247 (333)
T ss_pred             CCCCCHHHHHHCCCCEEEEECC---CCHHCCH
T ss_conf             4613699997179981999858---8400399


No 28 
>PRK06932 glycerate dehydrogenase; Provisional
Probab=96.36  E-value=0.025  Score=35.55  Aligned_cols=146  Identities=13%  Similarity=0.143  Sum_probs=78.7

Q ss_pred             HHHHHCCCE-EEEEE-C-CCCHHHHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHH------------HC--------
Q ss_conf             975300101-11210-1-320067763012441240433320246--78765576642------------00--------
Q gi|255764473|r   94 KVLSRYVDA-IVMRT-T-NHSRLLELTEYATVPVINALTDNTHPC--QIIADIMTFEE------------HR--------  148 (306)
Q Consensus        94 ~~ls~~~D~-iviR~-~-~~~~~~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e------------~~--------  148 (306)
                      .+++....+ +|.|. . -+..-.+.++...|+|.|+.+-...+.  .+++=++.+.+            .+        
T Consensus        58 ~vl~~ap~LK~I~~~g~G~D~ID~~aa~~~gI~V~n~pg~~~~~VAE~~i~liL~l~r~i~~~~~~~~~~~W~~~~~~~~  137 (314)
T PRK06932         58 ETLQQLPKLKLIAITATGTNNVDLVAAKELGITVKNVTGYSSTTVPEHVLGLIFALKHSLMGWYRDQLSAKWAECKQFCY  137 (314)
T ss_pred             HHHHCCCCCEEEEECCCCCCCCCHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99953999809988983456478999974997999389867278999999999999977999999998386432466432


Q ss_pred             -----CCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             -----133677304610455554310100123312576520000132100002432013322213664663068733222
Q gi|255764473|r  149 -----GSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       149 -----g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                           ..+.|+++.++|- +++.......+.-||+++....+....          ...   ..+.++++.++.+|+|..
T Consensus       138 ~~~~~~~L~gktvGIiG~-G~IG~~va~~~~~fGm~V~~~~~~~~~----------~~~---~~~~~l~ell~~sDiIsl  203 (314)
T PRK06932        138 FDYPITDVRGSTLGVFGK-GCLGSEVGRLATALGMKVLYAEHKGAT----------ECR---EGYTPFEEVLKQADIVTL  203 (314)
T ss_pred             CCCCCCEECCCEEEEECC-CHHHHHHHHHHHCCCCEEEEECCCCCH----------HHC---CCCCCHHHHHHCCCEEEE
T ss_conf             577544003868899763-528889999985289889997876612----------323---465759999623583689


Q ss_pred             CCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCC
Q ss_conf             10000002201333100111233688996289872992599
Q gi|255764473|r  224 DTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCL  264 (306)
Q Consensus       224 ~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHpl  264 (306)
                      -+  ...++         ...-++.+.++++|+++++.-..
T Consensus       204 h~--Plt~e---------T~~li~~~~l~~MK~~a~lIN~a  233 (314)
T PRK06932        204 HC--PLTES---------TQNLINAETLALMKPTAFLINTG  233 (314)
T ss_pred             EE--CCCCC---------CCCHHHHHHHHCCCCCCEEEECC
T ss_conf             51--13010---------23366699973578871999826


No 29 
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=96.21  E-value=0.079  Score=32.25  Aligned_cols=151  Identities=17%  Similarity=0.184  Sum_probs=86.9

Q ss_pred             CCCEEEEEECC-----------------------CCHHHHHHCCCCCCEECCCCCCC--HHHHHHHHHHHHHHH------
Q ss_conf             01011121013-----------------------20067763012441240433320--246787655766420------
Q gi|255764473|r   99 YVDAIVMRTTN-----------------------HSRLLELTEYATVPVINALTDNT--HPCQIIADIMTFEEH------  147 (306)
Q Consensus        99 ~~D~iviR~~~-----------------------~~~~~~~~~~~~vpvINa~~~~~--HPtQaL~D~~Ti~e~------  147 (306)
                      -+|++++|...                       +..-.+.++...|+|.|+-+...  =--.+++=++.+.++      
T Consensus        53 ~~d~liiRS~t~vt~~vi~~a~~Lk~I~r~GvG~dnIDl~aa~~~GI~V~NtPg~Na~aVAEl~i~l~L~l~R~i~~~~~  132 (409)
T PRK11790         53 DAHFIGIRSRTQLTEEVLEAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVLGEIILLLRGIPEKNA  132 (409)
T ss_pred             CCCEEEECCCCCCCHHHHHCCCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             79899991798739999943999719998321577408999986994899699977288999999999999864799999


Q ss_pred             -----------CC--CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHH
Q ss_conf             -----------01--33677304610455554310100123312576520000132100002432013322213664663
Q gi|255764473|r  148 -----------RG--SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQA  214 (306)
Q Consensus       148 -----------~g--~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~ea  214 (306)
                                 ++  .+.|+++.++|-+ ++..-....+..||+++....|....+.           .......++++.
T Consensus       133 ~~~~G~W~k~~~~~~El~GKtlGIIG~G-~IG~~VA~~a~~fGm~Vi~yD~~~~~~~-----------~~~~~~~sl~el  200 (409)
T PRK11790        133 KAHRGGWNKSAAGSFEVRGKTLGIVGYG-HIGTQLSVLAESLGMRVIFYDIEDKLPL-----------GNATQVGSLEEL  200 (409)
T ss_pred             HHHCCCCCCCCCCCEEECCCEEEEECCC-HHHHHHHHHHHHCCCEEEEECCHHHCCC-----------CCCEECCCHHHH
T ss_conf             9982998756777556358789863675-4769999999876998999786021256-----------684674889999


Q ss_pred             CCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHH
Q ss_conf             0687332221000000220133310011123368899628987299259998748735767
Q gi|255764473|r  215 VKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINE  275 (306)
Q Consensus       215 l~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~  275 (306)
                      ++.+|+|-.-+  .+.++         ....++.+.++.+|+++++.-+.   ||.=|+.+
T Consensus       201 l~~sD~IslH~--Plt~~---------T~~lIn~~~l~~MK~ga~LIN~A---RG~iVDe~  247 (409)
T PRK11790        201 LAQSDVVSLHV--PETPS---------TKNMIGAEELALMKPGAILINAS---RGTVVDID  247 (409)
T ss_pred             HHHCCEEEECC--CCCHH---------HHCCCCHHHHHHCCCCCEEEECC---CCHHCCHH
T ss_conf             87599999826--79846---------63104399997269998999868---85103999


No 30 
>PRK08410 2-hydroxyacid dehydrogenase; Provisional
Probab=96.10  E-value=0.033  Score=34.76  Aligned_cols=130  Identities=16%  Similarity=0.172  Sum_probs=73.5

Q ss_pred             CHHHHHHCCCCCCEECCCCCCCHH-H-HHHHHHHHHHHHC-------------------------CCCCCCCEEEECCCC
Q ss_conf             006776301244124043332024-6-7876557664200-------------------------133677304610455
Q gi|255764473|r  111 SRLLELTEYATVPVINALTDNTHP-C-QIIADIMTFEEHR-------------------------GSVKGKLFSWSGDGN  163 (306)
Q Consensus       111 ~~~~~~~~~~~vpvINa~~~~~HP-t-QaL~D~~Ti~e~~-------------------------g~l~~~~i~~vGd~~  163 (306)
                      ..-.+.++-..|+|.|.-+....+ . .+++=++.+.+..                         ..+.|+++.++|-+ 
T Consensus        76 ~ID~~aa~~~gI~V~n~p~~~~~aVAE~~l~~iL~l~r~i~~~~~~~~~g~w~~~~~~~~~~~~~~~L~gktlGIvG~G-  154 (311)
T PRK08410         76 NVDLEYAKKRGIAVKNVAGYSTESVAQHTFAMLLSLLGRINYYDNYVKSGEYSKSPIFTHISRPLGEIKGKKWGIIGLG-  154 (311)
T ss_pred             HHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEECCC-
T ss_conf             4219999979968992799784889999999999998557999999971653346522224765351058889998447-


Q ss_pred             CCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCC
Q ss_conf             55431010012331257652000013210000243201332221366466306873322210000002201333100111
Q gi|255764473|r  164 NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP  243 (306)
Q Consensus       164 ~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~  243 (306)
                      ++.......+.-||+++....|.....         ..+  + ..-++++.++.+|+|..-+  ....+         ..
T Consensus       155 ~IG~~va~~l~~fGm~V~~~d~~~~~~---------~~~--~-~~~~l~ell~~sDivslh~--Plt~~---------T~  211 (311)
T PRK08410        155 TIGKRVAKIAQAFGAEVVYYSTSGKNK---------NSE--Y-ERLSLEELLKTSDIISIHA--PLNEK---------TK  211 (311)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCCC---------CCC--C-EECCHHHHHHHCCEEEEEC--CCCCC---------CC
T ss_conf             489999999997699899989843124---------578--1-3578999987378014533--57622---------23


Q ss_pred             CCCCHHHHHCCCCCCEEECCC
Q ss_conf             233688996289872992599
Q gi|255764473|r  244 FQVNLSLMSMAHPDALFMHCL  264 (306)
Q Consensus       244 y~i~~~~l~~a~~~~~vmHpl  264 (306)
                      .-+|.+.++.+|+++++--..
T Consensus       212 ~li~~~~l~~Mk~~a~lIN~a  232 (311)
T PRK08410        212 NLINYEELKLLKDGAILINVG  232 (311)
T ss_pred             CHHHHHHHHHCCCCCEEEEEC
T ss_conf             401289996304575599925


No 31 
>PRK07574 formate dehydrogenase; Provisional
Probab=96.02  E-value=0.048  Score=33.68  Aligned_cols=143  Identities=13%  Similarity=0.154  Sum_probs=87.5

Q ss_pred             CHHHHHHCCCCCCEECCC-CC-CCHHHHHHHHHHHHHHHC---------C------------CCCCCCEEEECCCCCCCC
Q ss_conf             006776301244124043-33-202467876557664200---------1------------336773046104555543
Q gi|255764473|r  111 SRLLELTEYATVPVINAL-TD-NTHPCQIIADIMTFEEHR---------G------------SVKGKLFSWSGDGNNILH  167 (306)
Q Consensus       111 ~~~~~~~~~~~vpvINa~-~~-~~HPtQaL~D~~Ti~e~~---------g------------~l~~~~i~~vGd~~~v~h  167 (306)
                      +.=.+.+.--.|.|.|+- ++ .+=.-+++.-++.+.+++         |            .++|+++.++|- +|+..
T Consensus       127 nIDL~AA~erGI~V~nvpG~Ns~SVAEhtv~liLal~R~i~~~~~~v~~G~W~~a~~~~~~~EL~GKTlGIVG~-GrIG~  205 (385)
T PRK07574        127 HVDLQAASEHNITVAEVTGSNSISVAEHVVMMILALVRNYLPSHRQVVDGGWNIADCVSRSYDLEGMTVGTVGA-GRIGL  205 (385)
T ss_pred             HHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHCCCCCEECCCCEEEEECC-CHHHH
T ss_conf             45499899789999959998719999999999999975888899999849985121256643268998999897-88999


Q ss_pred             CHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCC
Q ss_conf             10100123312576520000132100002432013322213664663068733222100000022013331001112336
Q gi|255764473|r  168 SLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVN  247 (306)
Q Consensus       168 S~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~  247 (306)
                      .....+.-||+++....|-..  +.+   ..+..  .++...++++.++.+|+|..-+  ....+         ..--+|
T Consensus       206 ~VArra~aFgm~Vl~yDp~~l--~~~---~e~~l--g~~~~~sldeLl~~sDvVslh~--PLt~e---------T~~Lin  267 (385)
T PRK07574        206 AVLRRLKPFDVTLHYTDRHRL--PAE---VEQEL--GLTYHPDVDSLVSVCDVVTIHC--PLHPE---------TEHLFD  267 (385)
T ss_pred             HHHHHHHHCCCEEEEECCCCC--CHH---HHHHC--CCCCCCCHHHHHHHCCEEEECC--CCCHH---------HHHHCC
T ss_conf             999999977998998588669--889---99971--9865689999986289699866--79857---------740102


Q ss_pred             HHHHHCCCCCCEEECCCCCCCCCCCCHH
Q ss_conf             8899628987299259998748735767
Q gi|255764473|r  248 LSLMSMAHPDALFMHCLPAHRGEEVINE  275 (306)
Q Consensus       248 ~~~l~~a~~~~~vmHplP~~rg~EI~~~  275 (306)
                      .+.++++|+++++.-+.   ||--|+.+
T Consensus       268 ~~~l~~MK~ga~LVNtA---RG~iVDe~  292 (385)
T PRK07574        268 KDVLSRMKRGSYLVNTA---RGKIVDRD  292 (385)
T ss_pred             HHHHHCCCCCCEEEECC---CCHHCCHH
T ss_conf             99994389981899888---61101999


No 32 
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=95.69  E-value=0.08  Score=32.21  Aligned_cols=137  Identities=18%  Similarity=0.218  Sum_probs=82.4

Q ss_pred             HHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHHHC------------------C-CCCCCCEEEECCCCCCCCCHHHC
Q ss_conf             7763012441240433320246--7876557664200------------------1-33677304610455554310100
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHPC--QIIADIMTFEEHR------------------G-SVKGKLFSWSGDGNNILHSLIEG  172 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e~~------------------g-~l~~~~i~~vGd~~~v~hS~i~~  172 (306)
                      .+.++...|+|.|+-+.....+  .+++=++.+.++.                  | .+.|+++.++|- +|+..-....
T Consensus        78 ~~aa~~~GI~V~ntP~~n~~svAE~~i~l~l~l~R~i~~~~~~~~~g~W~r~~~~G~eL~gktlGIiG~-G~IG~~vA~~  156 (524)
T PRK13581         78 IPAATRRGIIVVNAPTGNTISAAEHTIALMLALARNIPQADASLKAGKWERKKFMGVELYGKTLGVIGL-GRIGSEVAKR  156 (524)
T ss_pred             HHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECC-CHHHHHHHHH
T ss_conf             999987899899489977288999999999998489779999998399675565662136988999776-7578999999


Q ss_pred             CCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHH
Q ss_conf             12331257652000013210000243201332221366466306873322210000002201333100111233688996
Q gi|255764473|r  173 AARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMS  252 (306)
Q Consensus       173 ~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~  252 (306)
                      +.-||+++....|  |.++    +.++..|.+.   .++++.++.+|+|..-  ..+.++         ..-.++.+.++
T Consensus       157 ~~~fgm~Vi~yDP--~~~~----~~~~~~gv~~---~~l~ell~~sD~IslH--~Plt~e---------T~~li~~~~~~  216 (524)
T PRK13581        157 AKAFGMKVIAYDP--YISP----ERAAQLGVEL---VELDELLARADFITLH--TPLTPE---------TRNLIGAEELA  216 (524)
T ss_pred             HHHCCCEEEEECC--CCCH----HHHHHCCCEE---EEHHHHHHHCCEEEEC--CCCCHH---------HHHHCCHHHHH
T ss_conf             9854974788777--6446----6798719668---6089973108899993--678615---------54430799996


Q ss_pred             CCCCCCEEECCCCCCCCCCCCH
Q ss_conf             2898729925999874873576
Q gi|255764473|r  253 MAHPDALFMHCLPAHRGEEVIN  274 (306)
Q Consensus       253 ~a~~~~~vmHplP~~rg~EI~~  274 (306)
                      ++|+++++.-|.   ||.=|+.
T Consensus       217 ~MK~ga~lIN~a---RG~iVde  235 (524)
T PRK13581        217 KMKPGVRIINCA---RGGIIDE  235 (524)
T ss_pred             HCCCCCEEEECC---CCCEECH
T ss_conf             068998699748---8760589


No 33 
>PRK06487 glycerate dehydrogenase; Provisional
Probab=95.48  E-value=0.086  Score=32.00  Aligned_cols=127  Identities=13%  Similarity=0.142  Sum_probs=71.9

Q ss_pred             HHHHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHHHC-------------------------CCCCCCCEEEECCCCC
Q ss_conf             067763012441240433320246--7876557664200-------------------------1336773046104555
Q gi|255764473|r  112 RLLELTEYATVPVINALTDNTHPC--QIIADIMTFEEHR-------------------------GSVKGKLFSWSGDGNN  164 (306)
Q Consensus       112 ~~~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e~~-------------------------g~l~~~~i~~vGd~~~  164 (306)
                      .-.+.++...|+|.|+-+-...+.  ++++=++.+.++.                         ..+.|+++.++|-+ +
T Consensus        80 ID~~aa~~~gI~V~n~pg~~~~~VAE~~l~liL~l~R~~~~~~~~~~~g~W~~~~~~~~~~~~~~eL~gktvGIiG~G-~  158 (317)
T PRK06487         80 VDLAAARERGITVCNCQGYGTPSVAQHTLALLLALATRLPDYQQAVAAGRWQQSSQFCLLDFPIVELEGKTLGLLGHG-E  158 (317)
T ss_pred             CCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEECCCEEEEECCC-H
T ss_conf             069999978998997898683799999999999998545899999982843336555534776543059789997867-6


Q ss_pred             CCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCC
Q ss_conf             54310100123312576520000132100002432013322213664663068733222100000022013331001112
Q gi|255764473|r  165 ILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF  244 (306)
Q Consensus       165 v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y  244 (306)
                      +..-....+.-||+++.+..+......          .    ..-++++.++.+|+|..-+  ....+         ...
T Consensus       159 IG~~va~~~~~fg~~V~~~~~~~~~~~----------~----~~~~l~ell~~sDivslh~--Plt~~---------T~~  213 (317)
T PRK06487        159 LGGAVARLAEAFGMRVLIGQLPGRPAR----------P----DRLPLDELLPQVDALTLHC--PLTEH---------TRH  213 (317)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCC----------C----CCCCHHHHHHHCCEEEEEC--CCCCC---------CHH
T ss_conf             899999999748999999928888642----------4----5057999987388568733--57611---------211


Q ss_pred             CCCHHHHHCCCCCCEEECCC
Q ss_conf             33688996289872992599
Q gi|255764473|r  245 QVNLSLMSMAHPDALFMHCL  264 (306)
Q Consensus       245 ~i~~~~l~~a~~~~~vmHpl  264 (306)
                      -+|.+.++.+|+++++.-..
T Consensus       214 li~~~~l~~Mk~~a~lIN~a  233 (317)
T PRK06487        214 LIGARELALMKPGALLINTA  233 (317)
T ss_pred             HHHHHHHHHCCCCCEEEEEC
T ss_conf             57999998538997899706


No 34 
>PTZ00075 S-adenosyl-L-homocysteine hydrolase; Provisional
Probab=95.38  E-value=0.25  Score=28.91  Aligned_cols=242  Identities=17%  Similarity=0.125  Sum_probs=134.6

Q ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE-ECCCCCHHHHHHHHHHHHCCCCCCCCCC--CC--
Q ss_conf             771784458999999999999999966523666544379879999-4288835789999898634754333321--00--
Q gi|255764473|r    6 KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMI-FEKPSTRTRVSFEVAMKHLGGDTIFLSG--SE--   80 (306)
Q Consensus         6 k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~l-F~e~StRTR~SFe~A~~~LG~~~~~~~~--~~--   80 (306)
                      |+ +++.++.+.+|+.--..---+....++....+||+|..|+.- -.++-|-.   +-..-+.+|+.|..-+.  -+  
T Consensus         8 kD-~~LA~~G~~~i~wA~~~MPvL~~ir~~~~~~kPlkG~rI~~~LHlt~kTAv---L~~tL~~~GA~V~~~~~Np~STQ   83 (476)
T PTZ00075          8 KD-ISLAEFGRKAIELAENEMPGLMELRREYGPSKPLKGAKIAGCLHMTVETAV---LIETLVALGAEVRWCSCNIFSTQ   83 (476)
T ss_pred             CC-CHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCCCCCEEEEEEECHHHHHH---HHHHHHHCCCEEEEECCCCCCCC
T ss_conf             67-135467589999999779899999999635699899989999822899999---99999985986999647975436


Q ss_pred             --------------CCCCCCCCHHHHH----HHHH----HCCCEEE--------EEEC----------------------
Q ss_conf             --------------0012321079999----9753----0010111--------2101----------------------
Q gi|255764473|r   81 --------------MQLGRAETIGDTA----KVLS----RYVDAIV--------MRTT----------------------  108 (306)
Q Consensus        81 --------------ss~~kgEsl~Dt~----~~ls----~~~D~iv--------iR~~----------------------  108 (306)
                                    .--.||||.++.-    ++|.    ...|+|+        +=|.                      
T Consensus        84 DdvaAAL~~~~gi~VfA~kget~eey~~~~~~~L~~~~~~~P~iiiDDGgDl~~llH~~~~~e~~~~~~~~~~~~~~~~~  163 (476)
T PTZ00075         84 DNAAAAIAKKGGVTVFAWKGETIEEYWWCIEQTLKWSDDGGPNLIVDDGGDLTNLVHDGVKLEKMYEKKGKLPDPSVAEP  163 (476)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             69999988607926999579998999999999973466889877981561277887521121012001356778766751


Q ss_pred             -------------------------------CC------CHHHHHHCC--CCCCEECCCCC-------CCHHH-HHHHHH
Q ss_conf             -------------------------------32------006776301--24412404333-------20246-787655
Q gi|255764473|r  109 -------------------------------NH------SRLLELTEY--ATVPVINALTD-------NTHPC-QIIADI  141 (306)
Q Consensus       109 -------------------------------~~------~~~~~~~~~--~~vpvINa~~~-------~~HPt-QaL~D~  141 (306)
                                                     .+      ..+..+++.  ..+|+||--|.       +-|=| |.+.|-
T Consensus       164 ~~~~~~~~~l~~~~~~~~~~~~~l~~~i~G~sEETTTGV~RL~am~~~g~L~fP~i~VNDs~tK~~FDNrYGtgqS~~dg  243 (476)
T PTZ00075        164 EDNRCLLTFLNHLVTKNPNKWPNLVKKIVGVSEETTTGVKNLYKMLKKGKLLFPAINVNDSVTKSKFDNLYGCRESLVDG  243 (476)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHEECCCCCHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHCCCCCHHHHHHHH
T ss_conf             78899999999887415520146785100400054475999999987796021189987655523402222113659999


Q ss_pred             HHHHHHCCC-CCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCC
Q ss_conf             766420013-3677304610455554310100123312576520000132100002432013322213664663068733
Q gi|255764473|r  142 MTFEEHRGS-VKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHC  220 (306)
Q Consensus       142 ~Ti~e~~g~-l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~  220 (306)
                      +-  +.-+- +.|++++.+|-+ -+..-....+.-+|+.|.++-.....     .-.+.-.|..+   ..++++++.+|+
T Consensus       244 i~--raTn~liaGK~vVV~GYG-~~GkG~A~~~rg~GA~ViVtEiDPi~-----ALqA~MdGf~V---~~m~ea~~~~Di  312 (476)
T PTZ00075        244 IK--RATDVMIAGKTVVVCGYG-DVGKGCAQALRGFGARVVVTEIDPIC-----ALQAAMEGYQV---VLLEDVVETADI  312 (476)
T ss_pred             HH--HHHCCEECCCEEEEEECC-CCCHHHHHHHCCCCCEEEEECCCCHH-----HHHHHHCCCEE---EEHHHHHHHCCE
T ss_conf             99--862834547589995045-30121476653589789996168078-----99987458787---569998833999


Q ss_pred             CCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCC
Q ss_conf             22210000002201333100111233688996289872992599987487357679679
Q gi|255764473|r  221 VFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDG  279 (306)
Q Consensus       221 V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~  279 (306)
                      ++|-.    +   .        .=-|+.+.++..|+++++--.|-  -+.||+-+.+..
T Consensus       313 fVTaT----G---n--------~~VI~~~H~~~MKdgaIl~N~GH--fd~EId~~~L~~  354 (476)
T PTZ00075        313 FVTAT----G---N--------DDIITLEHFPRMKDDAIVGNIGH--FDTEIQVAWLKA  354 (476)
T ss_pred             EEEEC----C---C--------CCCCCHHHHHHHCCCEEEEECCC--CCHHEEHHHHHH
T ss_conf             99934----9---9--------77468999986537809994587--841040898873


No 35 
>PRK12480 D-lactate dehydrogenase; Provisional
Probab=95.00  E-value=0.33  Score=28.21  Aligned_cols=184  Identities=14%  Similarity=0.108  Sum_probs=99.2

Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-CCCEEEEEECC-CCHHHHHHCCCCCCEECC
Q ss_conf             9428883578999989863475433332100001232107999997530-01011121013-200677630124412404
Q gi|255764473|r   50 IFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSR-YVDAIVMRTTN-HSRLLELTEYATVPVINA  127 (306)
Q Consensus        50 lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~-~~D~iviR~~~-~~~~~~~~~~~~vpvINa  127 (306)
                      .+.++++     -|.+..--|.+.+.... ...+.     ++....+.. ..-+|..|.-. +..=.+.++.-.|+|.|.
T Consensus        30 ~~~~~~~-----~~~~~~~~~~d~v~~~~-~~~i~-----~evl~~l~~~~LK~I~~~gvG~D~IDl~aa~~~GI~V~n~   98 (330)
T PRK12480         30 TSKELLS-----SATVDQLKDYDGVTTMQ-FGKLE-----NDVYPKLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNV   98 (330)
T ss_pred             EECCCCC-----HHHHHHHCCCCEEEEEE-CCCCC-----HHHHHHHHHCCCEEEEECCEECCHHCHHHHHHCCCEEEEC
T ss_conf             9569899-----89999847999899960-79789-----9999965567975999877217521699999789999959


Q ss_pred             CCCCCH--HHHHHHHHHHHHHHC-------------------C-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             333202--467876557664200-------------------1-336773046104555543101001233125765200
Q gi|255764473|r  128 LTDNTH--PCQIIADIMTFEEHR-------------------G-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       128 ~~~~~H--PtQaL~D~~Ti~e~~-------------------g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      -+....  --.+++=++.+.++.                   | .+.|+++.++|- +|+.......+.-||+++....|
T Consensus        99 P~~~~~aVAE~ai~liL~l~R~~~~~~~~~~~~~~~~~~~~~g~~l~gktvGIiG~-G~IG~~va~~~~~fg~~Vi~yD~  177 (330)
T PRK12480         99 PSYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGT-GRIGAATAKIYAGFGATITAYDA  177 (330)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEECC
T ss_conf             98682899999999999998454999999982787645655775235868999675-88999999998756998999899


Q ss_pred             HCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCC
Q ss_conf             00132100002432013322213664663068733222100000022013331001112336889962898729925999
Q gi|255764473|r  186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLP  265 (306)
Q Consensus       186 ~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP  265 (306)
                      .   |... .       ....+..++++.++.+|+|..-+  .+..+         ....+|.+.++++|+++++--+. 
T Consensus       178 ~---~~~~-~-------~~~~~~~sleell~~sDiIslh~--Plt~~---------T~~lIn~~~l~~MK~~ailINta-  234 (330)
T PRK12480        178 Y---PNKD-L-------DFLTYKDSVKEAIKDADIISLHV--PANKE---------SYHLFDKAMFDHVKKGAILVNAA-  234 (330)
T ss_pred             C---CCCC-C-------CCCEECCCHHHHHHHCCEEEECC--CCCHH---------HHCCHHHHHHHHCCCCCEEEECC-
T ss_conf             8---6422-1-------21323278999987599999737--68533---------12004899997579997699727-


Q ss_pred             CCCCC
Q ss_conf             87487
Q gi|255764473|r  266 AHRGE  270 (306)
Q Consensus       266 ~~rg~  270 (306)
                        ||.
T Consensus       235 --RG~  237 (330)
T PRK12480        235 --RGA  237 (330)
T ss_pred             --CCC
T ss_conf             --863


No 36 
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389.
Probab=94.85  E-value=0.043  Score=33.95  Aligned_cols=102  Identities=18%  Similarity=0.226  Sum_probs=68.5

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEEC
Q ss_conf             33677304610455554310100123312576520000132100002432013322213664663068733222100000
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM  229 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~  229 (306)
                      .+.|+++.++|-+ ++.......+..||+++....|..-   +.    ....+   ....++++.++.+|+|..-+  ..
T Consensus        33 ~L~gk~vgIiG~G-~IG~~va~~l~~fg~~V~~~d~~~~---~~----~~~~~---~~~~~l~~ll~~sDii~~~~--pl   99 (176)
T pfam02826        33 ELSGKTVGIIGLG-RIGRAVARRLKAFGMKVIAYDRYPK---AE----AEALG---ARYVSLDELLAESDVVSLHL--PL   99 (176)
T ss_pred             CCCCCEEEEECCC-HHHHHHHHHHHHHCCCEEEECCCCC---CH----HHHCC---EEECCHHHHHHHCCEEEECC--CC
T ss_conf             5799999998969-9999999999983981254379876---10----23157---16668999986299887547--67


Q ss_pred             CCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHH
Q ss_conf             02201333100111233688996289872992599987487357679
Q gi|255764473|r  230 NQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEV  276 (306)
Q Consensus       230 ~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v  276 (306)
                      .++         ...-+|.+.++.+|+++++--..   ||.=|+.+.
T Consensus       100 t~~---------T~~li~~~~l~~mk~~a~lIN~s---RG~ivde~a  134 (176)
T pfam02826       100 TPE---------TRHLINAERLALMKPGAILINTA---RGGLVDEDA  134 (176)
T ss_pred             CCC---------CCCCCCHHHHHHHCCCCEEEEEC---CCCCCCHHH
T ss_conf             420---------24634699998518998899806---755128999


No 37 
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=94.28  E-value=0.49  Score=27.06  Aligned_cols=199  Identities=17%  Similarity=0.127  Sum_probs=117.2

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC-------CCCCCCHHHHHHHHHHC-CCEEEEEECCCCHHHHHHCCCCCCEECCC
Q ss_conf             57899998986347543333210000-------12321079999975300-10111210132006776301244124043
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQ-------LGRAETIGDTAKVLSRY-VDAIVMRTTNHSRLLELTEYATVPVINAL  128 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss-------~~kgEsl~Dt~~~ls~~-~D~iviR~~~~~~~~~~~~~~~vpvINa~  128 (306)
                      +...|.+.+..  +.+++.+...-++       ....|.+.=+-..+... -.+.++=......+.++.+..+++++--.
T Consensus        44 ~~~~~~~~~~~--~~d~iIlPvpg~~d~g~i~~~~~~~~~~l~~~~~~~l~~~~~vf~G~~~~~l~~~~~~~~~~~~d~~  121 (296)
T PRK08306         44 AKCSSLEEALS--DVDVIILPVPGTNDEGEVDTVFSNEKLVLTKELLEKTPEHCTIFSGIANPYLKELAETTGRKLIELF  121 (296)
T ss_pred             EEECCHHHHHH--CCCEEEECCCCCCCCCEEECCCCCCCCCHHHHHHHHCCCCCEEEEECCCHHHHHHHHHCCCCEEEEE
T ss_conf             77346788872--3999997883225896385534678763229999746999879995599899999997598367620


Q ss_pred             CCC------CHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCC
Q ss_conf             332------02467876557664200133677304610455554310100123312576520000132100002432013
Q gi|255764473|r  129 TDN------THPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQG  202 (306)
Q Consensus       129 ~~~------~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g  202 (306)
                      ...      +=||-.=+=...|++.--.+.|-++.++|- +|+..++...+..||.+|+++.-..     ..+..+...|
T Consensus       122 e~d~vAi~NaipTAEGai~~ai~~tp~ti~gs~~lVlG~-Gr~G~~lA~~l~~lGA~V~V~aR~~-----~~~a~a~~~G  195 (296)
T PRK08306        122 ERDDVAIYNSIPTAEGAIMMAIEHTPITIHGSNVLVLGF-GRTGMTLARTLKALGAKVKVGARKS-----AHLARITEMG  195 (296)
T ss_pred             CCCHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCEEEECC-CHHHHHHHHHHHHCCCEEEEEECCH-----HHHHHHHHCC
T ss_conf             020355562701489999999965996324765899898-6899999999997799699997999-----9999999769


Q ss_pred             CCCCCCCCHHHHCCCCCCCCCCCEEE----------CCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCC
Q ss_conf             32221366466306873322210000----------0022013331001112336889962898729925999
Q gi|255764473|r  203 ASVALFHDAVQAVKGAHCVFTDTWIS----------MNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLP  265 (306)
Q Consensus       203 ~~i~~~~d~~eal~~aD~V~~~~~~~----------~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP  265 (306)
                      .......++.+.+.++|+|+-+. .+          |..+...-+. .-++.++|-+-.++..-+++.-..||
T Consensus       196 ~~~v~~~~L~~~~~~~D~i~NTI-Pa~Vlt~~~l~~~~~~avIIDL-AS~PGG~Df~~A~~~Gika~lapgLP  266 (296)
T PRK08306        196 YSPVHLSELAEEVGEADIIFNTI-PALVLTKNVLSKMPPHALIIDL-ASKPGGTDFEYAKKLGIKALLAPGLP  266 (296)
T ss_pred             CEEEEHHHHHHHHCCCCEEEECC-CHHHCCHHHHHCCCCCCEEEEE-CCCCCCCCHHHHHHHCCEEEECCCCC
T ss_conf             85871999997735699999898-5254399999418999699994-77999738899998398599728999


No 38 
>PRK06436 glycerate dehydrogenase; Provisional
Probab=93.88  E-value=0.4  Score=27.66  Aligned_cols=61  Identities=15%  Similarity=0.103  Sum_probs=40.5

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             33677304610455554310100123312576520000132100002432013322213664663068733222
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                      .+.|+++.++|-+ ++..-....+.-||+++....+....          ..  ....+.++++.++.+|+|..
T Consensus       119 ~L~gktvGIiG~G-~IG~~vA~~~~afg~~V~~~~r~~~~----------~~--~~~~~~~~~ell~~sDivsl  179 (303)
T PRK06436        119 LLYNKSLGILGYG-GIGRRVALLAKAFGMNIYAYTRSYVN----------DG--ISSIYMEPEDIMKKSDFVLI  179 (303)
T ss_pred             EECCCEEEEECCC-HHHHHHHHHHHHCCCEEEEECCCCCC----------CC--CCEEECCHHHHHHHCCEEEE
T ss_conf             4118889998976-56999999999779889998985322----------45--74552689999975999999


No 39 
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215   This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by IPR014214 from INTERPRO. This protein is also known as SpoVFA..
Probab=93.58  E-value=0.36  Score=27.95  Aligned_cols=193  Identities=16%  Similarity=0.156  Sum_probs=130.6

Q ss_pred             EEEE-ECC-CCCHHHHHH-HHHHHHCC-CCCCCCCCC-CCCCCCCCCHHHH------HHHHHHC-CCEEEEEECCCCHHH
Q ss_conf             9999-428-883578999-98986347-543333210-0001232107999------9975300-101112101320067
Q gi|255764473|r   47 LAMI-FEK-PSTRTRVSF-EVAMKHLG-GDTIFLSGS-EMQLGRAETIGDT------AKVLSRY-VDAIVMRTTNHSRLL  114 (306)
Q Consensus        47 i~~l-F~e-~StRTR~SF-e~A~~~LG-~~~~~~~~~-~ss~~kgEsl~Dt------~~~ls~~-~D~iviR~~~~~~~~  114 (306)
                      |-++ |+| ..-+|..+- +.....++ .+++.|... .|+-++-+|.-+-      ...+..- -.|.|+=+.+..++.
T Consensus        28 ~~l~Gf~qL~~gF~G~~~~~~~~~~~~~~DvviLPv~G~~~~G~v~t~f~~~~~~l~~~~~~~~~~~~~~~~Gisn~yL~  107 (288)
T TIGR02853        28 ISLIGFDQLEDGFTGVEKLELDELDLSTLDVVILPVQGVSQDGKVATVFSNEKVVLKPELLEETKKHCTIYVGISNDYLE  107 (288)
T ss_pred             EEEECCCCCCCCCCCHHHHCCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCCEEECHHHHHHCCCCEEEEECCCCHHHH
T ss_conf             99963663002313300101342444466678816788599884874115872164668995207943899737765899


Q ss_pred             HHHCCCCCCEECCCC-CC-----CHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCC
Q ss_conf             763012441240433-32-----024678765576642001336773046104555543101001233125765200001
Q gi|255764473|r  115 ELTEYATVPVINALT-DN-----THPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGS  188 (306)
Q Consensus       115 ~~~~~~~vpvINa~~-~~-----~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~  188 (306)
                      ++++.+++++|.-.+ |+     +=||=.=+=++.|+..=-.+-|=++..+|= +|+.+|....++-+|.+|.+++-...
T Consensus       108 ~l~~~a~~~Li~l~erDdvAIYNSIPtaEGAimMA~e~td~TIHgS~v~VlGf-GRtG~tiAr~f~aLGA~V~V~AR~~~  186 (288)
T TIGR02853       108 ELAAEAGVKLIELFERDDVAIYNSIPTAEGAIMMAIEHTDFTIHGSNVMVLGF-GRTGMTIARTFSALGARVSVGARSSA  186 (288)
T ss_pred             HHHHHCCCCEEEECCCCCEEEECCCCCHHHHHHHHHHCCCCCEECCEEEEECC-CCHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             99987196024100357533445875567899999724896250134578844-70568999999726980575317836


Q ss_pred             CCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEE
Q ss_conf             3210000243201332221366466306873322210000002201333100111233688996289872992
Q gi|255764473|r  189 EPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFM  261 (306)
Q Consensus       189 ~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vm  261 (306)
                      ..     ..+-+.|..=....++.+.+.++|+|+=         +.       ...-||.+.|++++++++|+
T Consensus       187 dl-----ARI~E~g~~P~~~~~L~~~v~e~DIviN---------Ti-------PaLvlt~~~l~~lp~~Avii  238 (288)
T TIGR02853       187 DL-----ARITEMGLEPVPLNKLEEKVAEIDIVIN---------TI-------PALVLTKDVLSKLPKHAVII  238 (288)
T ss_pred             HH-----HHHHHHCCCCCCHHHHHHHHCCCCEEEE---------CC-------CCCCCCHHHHHHCCCCCEEE
T ss_conf             78-----9999960688271678876500024770---------67-------63003658995268584899


No 40 
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]
Probab=91.67  E-value=0.33  Score=28.17  Aligned_cols=103  Identities=15%  Similarity=0.206  Sum_probs=66.7

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEEC
Q ss_conf             33677304610455554310100123312576520000132100002432013322213664663068733222100000
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM  229 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~  229 (306)
                      .+.|+++.++|- +|+.......+.-||+++....+..- |..+     +..  ...+. ++++.++.+|+|..-+  .+
T Consensus       143 ~l~gktvGIiG~-GrIG~avA~r~~~Fgm~v~y~~~~~~-~~~~-----~~~--~~~y~-~l~ell~~sDii~l~~--Pl  210 (324)
T COG1052         143 DLRGKTLGIIGL-GRIGQAVARRLKGFGMKVLYYDRSPN-PEAE-----KEL--GARYV-DLDELLAESDIISLHC--PL  210 (324)
T ss_pred             CCCCCEEEEECC-CHHHHHHHHHHHCCCCEEEEECCCCC-HHHH-----HHC--CCEEC-CHHHHHHHCCEEEEEC--CC
T ss_conf             677888899784-88999999987217968998668874-5557-----405--86041-6899997699999977--99


Q ss_pred             CCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHH
Q ss_conf             02201333100111233688996289872992599987487357679
Q gi|255764473|r  230 NQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEV  276 (306)
Q Consensus       230 ~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v  276 (306)
                      ..+         ...-+|.+.++++|+++++.-..   ||-=|+.+.
T Consensus       211 t~~---------T~hLin~~~l~~mk~ga~lVNta---RG~~VDe~A  245 (324)
T COG1052         211 TPE---------TRHLINAEELAKMKPGAILVNTA---RGGLVDEQA  245 (324)
T ss_pred             CHH---------HHHHCCHHHHHHCCCCEEEEECC---CCCEECHHH
T ss_conf             837---------66532999997568976999648---742165999


No 41 
>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase.
Probab=91.66  E-value=1.2  Score=24.58  Aligned_cols=241  Identities=16%  Similarity=0.083  Sum_probs=132.9

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE-ECCCCCHHHHHHHHHHHHCCCCCCCCC--CCC-----
Q ss_conf             784458999999999999999966523666544379879999-428883578999989863475433332--100-----
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMI-FEKPSTRTRVSFEVAMKHLGGDTIFLS--GSE-----   80 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~l-F~e~StRTR~SFe~A~~~LG~~~~~~~--~~~-----   80 (306)
                      +++.+..+..|+..-..---+....++....+||+|.+|+.- -.|+-|-.   +-..-+.+|+.|..-+  +.+     
T Consensus         8 isLa~~G~~~I~wa~~~MPvL~~ir~~~~~ekPl~G~rI~~~lHle~kTA~---L~~tL~~~GA~V~~~~~NplSTQDdv   84 (430)
T pfam05221         8 ISLAAFGRKEIELAENEMPGLMALREEYGPSQPLKGARIAGCLHMTVQTAV---LIETLVALGAEVRWASCNIFSTQDHA   84 (430)
T ss_pred             CHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCCCCCEEEEEEECHHHHHH---HHHHHHHCCCEEEEECCCCCCCCHHH
T ss_conf             224266689999999779899999998635699999889999831799999---99999985987999658975323799


Q ss_pred             ----------CCCCCCCCHHHHHHHHHHC--------CCEEE--------EEECC-------------C-----CHHHHH
Q ss_conf             ----------0012321079999975300--------10111--------21013-------------2-----006776
Q gi|255764473|r   81 ----------MQLGRAETIGDTAKVLSRY--------VDAIV--------MRTTN-------------H-----SRLLEL  116 (306)
Q Consensus        81 ----------ss~~kgEsl~Dt~~~ls~~--------~D~iv--------iR~~~-------------~-----~~~~~~  116 (306)
                                .--.+||+.++.-..+..-        .|+++        +=|..             +     ..+..+
T Consensus        85 aAaL~~~Gi~VfA~~g~t~eey~~~~~~~L~~~~~~~P~iiiDDG~Dl~~~~h~~~~~l~~~i~G~~EETTTGv~RL~am  164 (430)
T pfam05221        85 AAAIAAAGVPVFAWKGETLEEYWWCIERALTFKDGQGPNMILDDGGDATLLIHKKYPQYLAGIRGVSEETTTGVHRLYKM  164 (430)
T ss_pred             HHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
T ss_conf             99999679769993799989999999998465889896565425412522078562888865167153214789987889


Q ss_pred             HC--CCCCCEECCCCC-------CCHHH-HHHHHHHHHHHHCC-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             30--124412404333-------20246-78765576642001-336773046104555543101001233125765200
Q gi|255764473|r  117 TE--YATVPVINALTD-------NTHPC-QIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       117 ~~--~~~vpvINa~~~-------~~HPt-QaL~D~~Ti~e~~g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      .+  ...+|+||.-|.       +-|=| |...|-+-  +.-+ -+.|++++.+|-+ -+.+-....+.-+|..|.++-.
T Consensus       165 ~~~g~L~fPviaVNDa~tK~~FDNrYGtgqS~~dgi~--r~Tn~liaGK~vVV~GYG-~cGkG~A~r~rglGA~V~VtEv  241 (430)
T pfam05221       165 LKKGKLLFPAINVNDSVTKSKFDNLYGCRESLPDGIK--RATDVMIAGKVAVVCGYG-DVGKGCAASLRGQGARVIVTEI  241 (430)
T ss_pred             HHCCCCCCCEEEECCHHHHHHHCCCCCCHHHHHHHHH--HHHCCEECCCEEEEECCC-CCCHHHHHHHHHCCCEEEEECC
T ss_conf             8659606417996766651340134331230999999--861713427679995567-5357899998427988999547


Q ss_pred             HCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCC
Q ss_conf             00132100002432013322213664663068733222100000022013331001112336889962898729925999
Q gi|255764473|r  186 IGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLP  265 (306)
Q Consensus       186 ~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP  265 (306)
                      ....     .-.+.-.|..+   .++.++++.+|+++|-.    +   .        .=-|+.+.++.+|+++++--.|-
T Consensus       242 DPi~-----ALeA~mDGf~V---~~m~eaa~~~DifvT~T----G---~--------~~vI~~~H~~~MKdgaIl~N~GH  298 (430)
T pfam05221       242 DPIC-----ALQAAMEGYQV---VTLEEVVKDADIFVTTT----G---C--------VDIIVGRHFMNMKKDAIVCNIGH  298 (430)
T ss_pred             CHHH-----HHHHHHCCCCC---CCHHHHHHHCCEEEEEC----C---C--------CCCCCHHHHHHHCCCEEEEECCC
T ss_conf             8589-----99998558845---77999985599999936----9---8--------87568999986417849995688


Q ss_pred             CCCCCCCCHHHHCCC
Q ss_conf             874873576796799
Q gi|255764473|r  266 AHRGEEVINEVLDGP  280 (306)
Q Consensus       266 ~~rg~EI~~~v~d~~  280 (306)
                        -+.||+-+-+..+
T Consensus       299 --fd~EId~~~L~~~  311 (430)
T pfam05221       299 --FDCEIDVGWLNYN  311 (430)
T ss_pred             --CCHHEEHHHHHCC
T ss_conf             --7141337877477


No 42 
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=91.56  E-value=0.19  Score=29.79  Aligned_cols=116  Identities=15%  Similarity=0.091  Sum_probs=71.2

Q ss_pred             HHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCCHHHHHCCC---CCCCCCCCHHHHCCCCCC
Q ss_conf             4200133677304610455554310100123312-576520000132100002432013---322213664663068733
Q gi|255764473|r  145 EEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY-LLNIATPIGSEPRNEYLNWARNQG---ASVALFHDAVQAVKGAHC  220 (306)
Q Consensus       145 ~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~~~~~~~~g---~~i~~~~d~~eal~~aD~  220 (306)
                      ++.+|++++++++++|- +.+....+..+...|+ +++++....    +.....++..|   ..+.-+.++.+.+.++|+
T Consensus         4 ~~~~~~l~~~~vlVIGa-G~~~~~~~~~L~~~g~~~i~v~nRt~----~ka~~la~~~~~~~~~~~~~~~l~~~l~~~Di   78 (134)
T pfam01488         4 KKIFGDLKGKKVLLIGA-GEMARLAAKHLLSKGAKKITIANRTL----EKAKELAEEFGGEEVEALPLDELEELLAEADI   78 (134)
T ss_pred             HHHHCCCCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCCH----HHHHHHHHHCCCCCEEEEECHHHHHHHHHCCE
T ss_conf             77638814898999996-09999999999975998899954757----89999999849972589851354413631999


Q ss_pred             CCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCC-CEEECCCCCCCCCCCCHHHHCCCCCH
Q ss_conf             2221000000220133310011123368899628987-29925999874873576796799710
Q gi|255764473|r  221 VFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPD-ALFMHCLPAHRGEEVINEVLDGPQSV  283 (306)
Q Consensus       221 V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~-~~vmHplP~~rg~EI~~~v~d~~~s~  283 (306)
                      |++-+        .      -..+-++.+.++.+.+. .++=-..|  |+  |+.+|.+-|...
T Consensus        79 vI~aT--------~------s~~~ii~~~~~~~~~~~~~iiDLavP--rn--vd~~v~~l~~v~  124 (134)
T pfam01488        79 VISAT--------S------APTPIITKEMVEEALKGLLFVDIAVP--RD--IEPEVGELEGVY  124 (134)
T ss_pred             EEEEC--------C------CCCCEECHHHHHHCCCCEEEEEECCC--CC--CCHHHCCCCCEE
T ss_conf             99925--------9------99736489999744398599983478--88--665454569869


No 43 
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme.   Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well a
Probab=91.03  E-value=0.27  Score=28.75  Aligned_cols=73  Identities=15%  Similarity=0.094  Sum_probs=52.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCC
Q ss_conf             32024678765576642001336773046104555543101001233125765200001321000024320133222136
Q gi|255764473|r  130 DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFH  209 (306)
Q Consensus       130 ~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~  209 (306)
                      ...=||-+++=+.-++++...++|++++++|..+-|..-+..++..-++.+++|.-.                     +.
T Consensus        21 ~~~~PcTp~ai~~ll~~~~i~l~Gk~vvViGrS~iVG~Pla~lL~~~~atVt~chs~---------------------T~   79 (168)
T cd01080          21 PGFIPCTPAGILELLKRYGIDLAGKKVVVVGRSNIVGKPLAALLLNRNATVTVCHSK---------------------TK   79 (168)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEECCC---------------------CC
T ss_conf             988698499999999994988778569998787300899999998489979997689---------------------88


Q ss_pred             CHHHHCCCCCCCCC
Q ss_conf             64663068733222
Q gi|255764473|r  210 DAVQAVKGAHCVFT  223 (306)
Q Consensus       210 d~~eal~~aD~V~~  223 (306)
                      |+.+..+.||+|.+
T Consensus        80 ~l~~~~~~ADIvIs   93 (168)
T cd01080          80 NLKEHTKQADIVIV   93 (168)
T ss_pred             CHHHHHHHCCEEEE
T ss_conf             97997410453554


No 44 
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]
Probab=90.82  E-value=1.4  Score=24.05  Aligned_cols=185  Identities=19%  Similarity=0.196  Sum_probs=104.5

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             784458999999999999999966523666544379879999428883578999-9898634754333321000012321
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSF-EVAMKHLGGDTIFLSGSEMQLGRAE   87 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SF-e~A~~~LG~~~~~~~~~~ss~~kgE   87 (306)
                      |+-+.+..+-...+-+..+.++.  +.+.  .|  +=.+.+.=..|+-++...- ..+|+++|..+...+-.+. .. .|
T Consensus         3 idGk~lA~~i~~~lk~~v~~~~~--~~~~--~P--~LavilvgddpaS~~YV~~K~k~~~~iGi~~~~~~l~~~-~t-~~   74 (283)
T COG0190           3 IDGKALAEKIREELKEKVEALKA--KGGF--KP--GLAVILVGDDPASQVYVRSKKKAAEEIGIASELYDLPED-IT-EE   74 (283)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH--CCCC--CC--EEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEECCCC-CC-HH
T ss_conf             23599999999999999999874--4688--84--389999679778999999999999981973689857875-78-99


Q ss_pred             CHHHHHHHHHH--CCCEEEEEEC-----CCCHHHH-HHCCCCC---CEECCCC---C--CCHHHHHHHHHHHHHHHC-CC
Q ss_conf             07999997530--0101112101-----3200677-6301244---1240433---3--202467876557664200-13
Q gi|255764473|r   88 TIGDTAKVLSR--YVDAIVMRTT-----NHSRLLE-LTEYATV---PVINALT---D--NTHPCQIIADIMTFEEHR-GS  150 (306)
Q Consensus        88 sl~Dt~~~ls~--~~D~iviR~~-----~~~~~~~-~~~~~~v---pvINa~~---~--~~HPtQaL~D~~Ti~e~~-g~  150 (306)
                      -+.+.+.-++.  -+|+|.+--|     ++..+.+ +....++   .-.|.|-   +  .-+||-..+= +++.|+. .+
T Consensus        75 eLl~~I~~lN~D~~v~GIlVQlPLp~hld~~~il~~I~p~KDVDG~hp~N~g~L~~~~~~~~PCTp~gi-~~ll~~~~i~  153 (283)
T COG0190          75 ELLALIDELNADPEVDGILVQLPLPKHLDEQKLLQAIDPEKDVDGFHPYNLGKLAQGEPGFLPCTPAGI-MTLLEEYGID  153 (283)
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHCCCCCCCCCCCHHHHCCHHCCCCCCCCCCHHHH-HHHHHHHCCC
T ss_conf             999999996089877579994778877788889860586778566696673532108998778989999-9999983998


Q ss_pred             CCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             3677304610455554310100123312576520000132100002432013322213664663068733222
Q gi|255764473|r  151 VKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       151 l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                      +.|++++++|-.+=|.+-+..++..-++.+++|.-.                     +.|+.+..+.||+|.+
T Consensus       154 l~Gk~~vVVGrS~iVGkPla~lL~~~naTVtvcHs~---------------------T~~l~~~~k~ADIvv~  205 (283)
T COG0190         154 LRGKNVVVVGRSNIVGKPLALLLLNANATVTVCHSR---------------------TKDLASITKNADIVVV  205 (283)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHCCCEEEEECCC---------------------CCCHHHHHHHCCEEEE
T ss_conf             789889998998767679999998679989997577---------------------8887898623899999


No 45 
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed
Probab=90.42  E-value=0.28  Score=28.69  Aligned_cols=115  Identities=18%  Similarity=0.131  Sum_probs=70.9

Q ss_pred             HHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCC
Q ss_conf             64200133677304610455554310100123312-57652000013210000243201332221366466306873322
Q gi|255764473|r  144 FEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY-LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVF  222 (306)
Q Consensus       144 i~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~  222 (306)
                      ..+.+|+++++++.++|-+. +....+..+...|+ +++++....    +.....++..|....-+.++.+.+.++|+|+
T Consensus       173 a~~~~~~l~~~~vlviGaGe-m~~l~~k~L~~~g~~~i~v~nRt~----~ra~~la~~~~~~~~~~~~l~~~l~~~Dvvi  247 (429)
T PRK00045        173 AKKIFGDLSGKKVLVIGAGE-MGELVAKHLAEKGVRKITVANRTL----ERAEELAEEFGAEAIPLEELPEALAEADIVI  247 (429)
T ss_pred             HHHHCCCCCCCEEEEECCCH-HHHHHHHHHHHCCCCEEEEECCCH----HHHHHHHHHCCCEEECHHHHHHHHHHCCEEE
T ss_conf             99864781206599976748-999999999855998499975867----7899999975988974999999996589999


Q ss_pred             CCCEEECCCCCHHHHHHCCCCCCCCHHHHHCC------CCCCEEECCCCCCCCCCCCHHHHCCCC
Q ss_conf             21000000220133310011123368899628------987299259998748735767967997
Q gi|255764473|r  223 TDTWISMNQEFKAREEHVFQPFQVNLSLMSMA------HPDALFMHCLPAHRGEEVINEVLDGPQ  281 (306)
Q Consensus       223 ~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a------~~~~~vmHplP~~rg~EI~~~v~d~~~  281 (306)
                      +-+        .      -..|-++.+.++.+      +|-.+|=-..|  |++  +.+|-+-|.
T Consensus       248 saT--------~------s~~~ii~~~~~~~~~~~r~~~~~~iiDLavP--Rdi--dp~v~~l~~  294 (429)
T PRK00045        248 SST--------A------APHPIITKGMVERALKQRRHRPLLLIDLAVP--RDI--EPEVGELDG  294 (429)
T ss_pred             EEC--------C------CCCCCCCHHHHHHHHHHCCCCCEEEEECCCC--CCC--CHHHCCCCC
T ss_conf             944--------8------9975027999999987346995699961688--777--443446698


No 46 
>TIGR00407 proA gamma-glutamyl phosphate reductase; InterPro: IPR000965   Gamma-glutamyl phosphate reductase (1.2.1.41 from EC) (GPR) is the enzyme that catalyzes the second step in the biosynthesis of proline from glutamate, the NADP-dependent reduction of L-glutamate 5-phosphate into L-glutamate 5-semialdehyde and phosphate. In bacteria (gene proA) and yeast  (gene PRO2), GPR is a monofunctional protein, while in plants and mammals, it is a bifunctional enzyme (P5CS)  that consists of two domains, an N-terminal glutamate 5-kinase domain (2.7.2.11 from EC) and a C-terminal GPR domain. ; GO: 0004350 glutamate-5-semialdehyde dehydrogenase activity, 0006561 proline biosynthetic process.
Probab=90.26  E-value=0.15  Score=30.49  Aligned_cols=46  Identities=24%  Similarity=0.343  Sum_probs=35.3

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCH
Q ss_conf             210799999753001011121013200677630124412404333202
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTH  133 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~H  133 (306)
                      .|.+.|.. .+..|+|+||-|+. .+-+......++||||..|.|..|
T Consensus       178 R~~v~eLL-~ld~Y~Dl~iPRGg-~~L~~~~~~~s~iPVl~~g~G~Ch  223 (415)
T TIGR00407       178 RELVSELL-KLDEYVDLIIPRGG-NGLVKLIKQESTIPVLGHGDGICH  223 (415)
T ss_pred             HHHHHHHH-CCCCCEEEEEECCC-HHHHHHHHHCCCCCEECCCCEEEE
T ss_conf             88999996-00783179973782-899999871577776036752566


No 47 
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain.
Probab=89.98  E-value=0.36  Score=27.94  Aligned_cols=73  Identities=15%  Similarity=0.084  Sum_probs=52.2

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCC
Q ss_conf             32024678765576642001336773046104555543101001233125765200001321000024320133222136
Q gi|255764473|r  130 DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFH  209 (306)
Q Consensus       130 ~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~  209 (306)
                      ...=||-+++=+.-++++.-.++|++++++|..+-|..-+..++..-++.+++|.-                     .+.
T Consensus        13 ~~~~PcTp~ai~~lL~~~~i~l~Gk~vvViGrS~iVG~Pla~lL~~~~atVtichs---------------------~T~   71 (159)
T pfam02882        13 PGFVPCTPRGIMELLKRYGIDLAGKNVVVIGRSNIVGKPLALLLLNANATVTVCHS---------------------KTK   71 (159)
T ss_pred             CCCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECC---------------------CCC
T ss_conf             99969649999999998399857866999888731489999999877998999818---------------------999


Q ss_pred             CHHHHCCCCCCCCC
Q ss_conf             64663068733222
Q gi|255764473|r  210 DAVQAVKGAHCVFT  223 (306)
Q Consensus       210 d~~eal~~aD~V~~  223 (306)
                      |+.+..++||+|++
T Consensus        72 nl~~~~~~ADIvI~   85 (159)
T pfam02882        72 DLAEITREADIVVV   85 (159)
T ss_pred             CHHHHHHCCCEEEE
T ss_conf             97896300344423


No 48 
>PRK12862 malic enzyme; Reviewed
Probab=89.81  E-value=1.7  Score=23.50  Aligned_cols=185  Identities=13%  Similarity=0.130  Sum_probs=103.7

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEE---CCC-CHHHHHHCCCCCCEECCCCCCCHHHH--HHHHHHHHHHHC-CCCCCCCEEE
Q ss_conf             2107999997530010111210---132-00677630124412404333202467--876557664200-1336773046
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMRT---TNH-SRLLELTEYATVPVINALTDNTHPCQ--IIADIMTFEEHR-GSVKGKLFSW  158 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR~---~~~-~~~~~~~~~~~vpvINa~~~~~HPtQ--aL~D~~Ti~e~~-g~l~~~~i~~  158 (306)
                      .+.+-+|.+.++--+-+|=+-.   |+- .....+.+-.+|||.-   +++|=|-  .++-+.--.+.- ++++..||++
T Consensus       121 ~~~~i~~v~~~~ptfgginledi~ap~cf~ie~~l~~~~~ipv~h---ddqhgtaiv~~a~l~nal~~~~k~~~~~kiv~  197 (761)
T PRK12862        121 PDKLVEIIAALEPTFGGINLEDIKAPECFEVERKLRERMKIPVFH---DDQHGTAIIVAAAVLNGLKVVGKDIEDVKLVA  197 (761)
T ss_pred             HHHHHHHHHHHCCCCCEECHHHCCCCCHHHHHHHHHHHCCCCEEC---CCCCHHHHHHHHHHHHHHHHHCCCHHHEEEEE
T ss_conf             899999999858886602798868973238999999855998233---77651899999999999998488566718999


Q ss_pred             ECCCCCCCCCHHHCCCCCCEE---EEEECHHCCCCC--CCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCC
Q ss_conf             104555543101001233125---765200001321--000024320133222136646630687332221000000220
Q gi|255764473|r  159 SGDGNNILHSLIEGAARFNYL---LNIATPIGSEPR--NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF  233 (306)
Q Consensus       159 vGd~~~v~hS~i~~~~~~g~~---v~~~~P~~~~~~--~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~  233 (306)
                      .|-+. -.-+-..++..+|.+   +.+|--+|..-.  ++..+.-+..-..-+-...+.|++++||+.+-..        
T Consensus       198 ~GaGa-a~~a~~~ll~~~G~~~~ni~~~D~~Gvi~~~r~~~~~~~k~~~a~~t~~~~l~ea~~gADvfig~S--------  268 (761)
T PRK12862        198 SGAGA-AALACLDLLVSLGVKRENIWVTDIKGVVYEGRTELMDPWKARYAQKTDARTLAEVIEGADVFLGLS--------  268 (761)
T ss_pred             ECCCH-HHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHCCCCEEEECC--------
T ss_conf             78878-899999999983998101799946787778877430799999965079665999966898899806--------


Q ss_pred             HHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHH---------CCCCCHHHHHHHHHH
Q ss_conf             13331001112336889962898729925999874873576796---------799710686877559
Q gi|255764473|r  234 KAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVL---------DGPQSVVFDEAENRL  292 (306)
Q Consensus       234 ~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~---------d~~~s~~~~Qa~Ngl  292 (306)
                              .+=-++.+.++.+.++.+|+-+-  |-.-||..+..         -+-||=|=.|+.|-+
T Consensus       269 --------~~~~~~~e~v~~Ma~~pivfalA--NP~PEI~p~~a~~~r~~~i~aTGRSD~pNQvNNvl  326 (761)
T PRK12862        269 --------AAGVLKPEMVKKMAPRPLILALA--NPTPEILPEEARAVRPDAIIATGRSDYPNQVNNVL  326 (761)
T ss_pred             --------CCCCCCHHHHHHHCCCCEEEECC--CCCCCCCHHHHHHHCCCEEEECCCCCCCCCCCHHH
T ss_conf             --------89999999998527377786258--98987599999874462798348889854011111


No 49 
>PRK07232 malic enzyme; Reviewed
Probab=87.62  E-value=2.4  Score=22.55  Aligned_cols=186  Identities=13%  Similarity=0.101  Sum_probs=105.2

Q ss_pred             CCCCHHHHHHHHHHCCCEEEEE---ECCC-CHHHHHHCCCCCCEECCCCCCCHHHH--HHHHHHHHHHHC-CCCCCCCEE
Q ss_conf             3210799999753001011121---0132-00677630124412404333202467--876557664200-133677304
Q gi|255764473|r   85 RAETIGDTAKVLSRYVDAIVMR---TTNH-SRLLELTEYATVPVINALTDNTHPCQ--IIADIMTFEEHR-GSVKGKLFS  157 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~~D~iviR---~~~~-~~~~~~~~~~~vpvINa~~~~~HPtQ--aL~D~~Ti~e~~-g~l~~~~i~  157 (306)
                      -.|.+-+|.+.++--+-+|=+-   .|+- .....+.+-.+|||.-   +++|=|-  +++-+.--.+.- ++++..||+
T Consensus       114 d~~~~i~~v~~~~ptfgginledi~ap~cf~ie~~l~~~~~ipv~h---ddqhgtaiv~~a~l~nal~~~~k~~~~~kiv  190 (753)
T PRK07232        114 DPDKFIEAVAALEPTFGGINLEDIKAPECFYIEQKLRERMDIPVFH---DDQHGTAIISAAALLNALELVGKKIEDVKIV  190 (753)
T ss_pred             CHHHHHHHHHHHCCCCCEECHHHCCCCCHHHHHHHHHHHCCCCEEC---CCCCHHHHHHHHHHHHHHHHHCCCHHHEEEE
T ss_conf             9899999999858886603798868973238999999865998233---7765189999999999999838646671899


Q ss_pred             EECCCCCCCCCHHHCCCCCCEE---EEEECHHCCCCC--CCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCC
Q ss_conf             6104555543101001233125---765200001321--00002432013322213664663068733222100000022
Q gi|255764473|r  158 WSGDGNNILHSLIEGAARFNYL---LNIATPIGSEPR--NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQE  232 (306)
Q Consensus       158 ~vGd~~~v~hS~i~~~~~~g~~---v~~~~P~~~~~~--~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~  232 (306)
                      +.|-+. -.-+-+.++..+|.+   +.+|--.|..-+  ++..+.-+..-..-+-...+.|++++||+.+-..       
T Consensus       191 ~~GaGa-a~~a~~~ll~~~G~~~~ni~~~d~~Gvi~~~r~~~~~~~k~~~a~~t~~~~l~ea~~gaDvfig~S-------  262 (753)
T PRK07232        191 VSGAGA-AAIACLNLLVALGAKKENIIVCDSKGVIYKGRTEGMDEWKAAYAQDTDARTLAEAIEGADVFLGLS-------  262 (753)
T ss_pred             EECCCH-HHHHHHHHHHHCCCCHHCEEEEECCCCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHCCCCEEEECC-------
T ss_conf             978868-889999999984998010799957786568887762499998634689886999957997899747-------


Q ss_pred             CHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHH---------CCCCCHHHHHHHHHH
Q ss_conf             013331001112336889962898729925999874873576796---------799710686877559
Q gi|255764473|r  233 FKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVL---------DGPQSVVFDEAENRL  292 (306)
Q Consensus       233 ~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~---------d~~~s~~~~Qa~Ngl  292 (306)
                               .+=-++.+.++.+.++.+|+-+-  |-.-||..+..         -+-||=|=.|+.|-+
T Consensus       263 ---------~~~~~~~~mv~~Ma~~pivfalA--NP~PEI~p~~a~~~r~d~i~aTGRsD~pNQvNNvl  320 (753)
T PRK07232        263 ---------AAGVLTPEMVKSMADNPIIFALA--NPDPEITPEEAKAVRPDAIIATGRSDYPNQVNNVL  320 (753)
T ss_pred             ---------CCCCCCHHHHHHHCCCCEEEECC--CCCCCCCHHHHHHHHCCEEEECCCCCCCCCCCHHH
T ss_conf             ---------79978999998628787798568--98977699999976043798348889854111111


No 50 
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate  disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein
Probab=87.16  E-value=0.41  Score=27.54  Aligned_cols=136  Identities=17%  Similarity=0.099  Sum_probs=69.5

Q ss_pred             CCHHHCC-HHHHHHHHHHHHHHHHHHHCCC-------CCCCCCCCE-EEEEECCCCCHHHHHHHHHHHHCCC---CCCCC
Q ss_conf             7844589-9999999999999996652366-------654437987-9999428883578999989863475---43333
Q gi|255764473|r    9 ADLSNIS-SSNLSCIIEVAKKIKNSSENIF-------ENKPLSGKV-LAMIFEKPSTRTRVSFEVAMKHLGG---DTIFL   76 (306)
Q Consensus         9 l~~~dl~-~~~i~~ll~~A~~~k~~~~~~~-------~~~~l~gk~-i~~lF~e~StRTR~SFe~A~~~LG~---~~~~~   76 (306)
                      +.+-|.+ ++-+..+-.+|+.+.+......       ..+-|+|-- |.+-|.-.....|..=|.-..+.|.   .+.  
T Consensus        32 i~L~DID~~~rL~~~~~la~~~~~~~~~~~~v~~ttd~~eAl~gADfVi~~irvGg~~~r~~De~Ip~kyGvigQET~--  109 (419)
T cd05296          32 LVLVDIDEEEKLEIVGALAKRMVKKAGLPIKVHLTTDRREALEGADFVFTQIRVGGLEARALDERIPLKHGVIGQETT--  109 (419)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHCCCCCCCCC--
T ss_conf             999899859999999999999999609980899967999983699999998733793076776543876497653476--


Q ss_pred             CCCCC--CCCCCCCHHHHHHHHHHC-CCEEEEEECC--CCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             21000--012321079999975300-1011121013--2006776301244124043332024678765576642
Q gi|255764473|r   77 SGSEM--QLGRAETIGDTAKVLSRY-VDAIVMRTTN--HSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEE  146 (306)
Q Consensus        77 ~~~~s--s~~kgEsl~Dt~~~ls~~-~D~iviR~~~--~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e  146 (306)
                      +++..  ++-.=--+.|.++.+..+ .|+.++--.+  .-..+.+.++..+.+|+-.++..+..+.|+.++-+..
T Consensus       110 G~GG~~~alRtiP~~l~ia~~i~e~cP~AwliNytNP~~ivt~a~~r~~~~k~vGlCh~~~~~~~~la~~Lg~~~  184 (419)
T cd05296         110 GAGGFAKALRTIPVILDIAEDVEELAPDAWLINFTNPAGIVTEAVLRHTGDRVIGLCNVPIGLQRRIAELLGVDP  184 (419)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCCH
T ss_conf             747999876228999999999998699838997378799999999966899889979777989999999958987


No 51 
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated
Probab=87.10  E-value=0.46  Score=27.22  Aligned_cols=29  Identities=21%  Similarity=0.127  Sum_probs=13.0

Q ss_pred             HHHHHHHHC--CCEEEEEECCCCHHHHHHCC
Q ss_conf             999975300--10111210132006776301
Q gi|255764473|r   91 DTAKVLSRY--VDAIVMRTTNHSRLLELTEY  119 (306)
Q Consensus        91 Dt~~~ls~~--~D~iviR~~~~~~~~~~~~~  119 (306)
                      +..+-++.+  .|+|+.=..+.-.+.++++.
T Consensus        95 ~vf~eLd~~~~~~aIiASsTSgl~~S~l~~~  125 (489)
T PRK07531         95 KVLAEIEAAARPDALIGSSTSGFKPSELQEG  125 (489)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCHHHHHHH
T ss_conf             9999999767998389853665889999865


No 52 
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy). The equilibrium lies far on the side of AdoHyc synthesis, but in nature the removal of Ado and Hyc is sufficiently fast, so that the net reaction is in the direction of hydrolysis. Since AdoHyc is a potent inhibitor of S-adenosyl-L-methionine dependent methyltransferases,  AdoHycase plays a critical role in the modulation of the activity of various methyltransferases. The enzyme forms homooligomers of 45-50kDa subunits, each binding one molecule of NAD+.
Probab=86.91  E-value=2.6  Score=22.29  Aligned_cols=242  Identities=15%  Similarity=0.101  Sum_probs=136.7

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE-ECCCCCHHHHHHHHHHHHCCCCCCCCC--CCC-----
Q ss_conf             784458999999999999999966523666544379879999-428883578999989863475433332--100-----
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMI-FEKPSTRTRVSFEVAMKHLGGDTIFLS--GSE-----   80 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~l-F~e~StRTR~SFe~A~~~LG~~~~~~~--~~~-----   80 (306)
                      |++.+..+..|+..=..---+....++....+||+|.+|+.- -.|+-|-   -+-..-+.+|+.|..-+  +.+     
T Consensus         1 isLA~~G~~~I~wa~~~MPvL~~lr~~~~~~kPl~G~rI~~clHle~kTA---~L~~tL~~~GA~V~~~~~NplSTQDdv   77 (413)
T cd00401           1 ISLAAFGRKEIEIAENEMPGLMAIREEYGASKPLKGARIAGCLHMTVQTA---VLIETLVALGAEVRWSSCNIFSTQDHA   77 (413)
T ss_pred             CCCHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCCCCCEEEEEEECHHHHH---HHHHHHHHCCCEEEEECCCCCCCHHHH
T ss_conf             97116668999999977989999999863469989988999982058899---999999985998999637976532899


Q ss_pred             ----------CCCCCCCCHHHHHHHHHH-------CCCEEE--------EEECC-------------C-----CHHHHHH
Q ss_conf             ----------001232107999997530-------010111--------21013-------------2-----0067763
Q gi|255764473|r   81 ----------MQLGRAETIGDTAKVLSR-------YVDAIV--------MRTTN-------------H-----SRLLELT  117 (306)
Q Consensus        81 ----------ss~~kgEsl~Dt~~~ls~-------~~D~iv--------iR~~~-------------~-----~~~~~~~  117 (306)
                                .--.||||.++....+..       -.|+++        +=|..             +     ..+..+.
T Consensus        78 aAaL~~~gi~VfA~~g~s~eey~~~l~~~L~~~~~~P~iiiDDG~Dl~~~~h~~~~~~~~~i~G~~EETTTGv~RL~am~  157 (413)
T cd00401          78 AAAIAAAGIPVFAWKGETLEEYWWCIEQALKFPDGEPNMILDDGGDLTLLIHKKHPELLPGIRGISEETTTGVHRLYKME  157 (413)
T ss_pred             HHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCHHHHHHHCCHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             99999679769984799989999999999828799964686144122121340574677420124555308899999999


Q ss_pred             CC--CCCCEECCCCC-------CCHHH-HHHHHHHHHHHHCC-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHH
Q ss_conf             01--24412404333-------20246-78765576642001-3367730461045555431010012331257652000
Q gi|255764473|r  118 EY--ATVPVINALTD-------NTHPC-QIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       118 ~~--~~vpvINa~~~-------~~HPt-QaL~D~~Ti~e~~g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +.  ...|+||.-|.       +-|=| |...|-+  .+.-+ -+.|++++.+|-+ -+.+-....+.-+|..|.++-..
T Consensus       158 ~~g~L~fP~iaVNDa~tK~~FDNrYGtgqS~~dgi--~r~Tn~liaGK~vVV~GYG-~~GkG~A~r~rglGA~V~VtEvD  234 (413)
T cd00401         158 KEGKLKFPAINVNDSVTKSKFDNLYGCRESLIDGI--KRATDVMIAGKVAVVAGYG-DVGKGCAQSLRGQGARVIVTEVD  234 (413)
T ss_pred             HCCCCCCCEEEECCHHHHHHCCCCCCCCHHHHHHH--HHHHHHEECCCEEEEECCC-CCCHHHHHHHHHCCCEEEEECCC
T ss_conf             76982786788636666334014433321089999--9874212137779994577-63568899886589889997177


Q ss_pred             CCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCC
Q ss_conf             01321000024320133222136646630687332221000000220133310011123368899628987299259998
Q gi|255764473|r  187 GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPA  266 (306)
Q Consensus       187 ~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~  266 (306)
                      ...     .-.+.-.|..+   .+++++++.+|+++|-.    +   .        .=-|+.+.++++|+++++.-.|- 
T Consensus       235 Pi~-----ALeA~mDGf~V---~~m~~a~~~~DifiTaT----G---n--------~~VI~~eH~~~MKdgaIl~N~GH-  290 (413)
T cd00401         235 PIC-----ALQAAMEGYEV---MTMEEAVKEGDIFVTTT----G---N--------KDIITGEHFEQMKDGAIVCNIGH-  290 (413)
T ss_pred             HHH-----HHHHHHCCCCC---CCHHHHHHHCCEEEEEC----C---C--------CCCCCHHHHHHHCCCEEEEECCC-
T ss_conf             588-----99998568945---77999972389999933----8---8--------77373999998458869980677-


Q ss_pred             CCCCCCCHHHHCCCC
Q ss_conf             748735767967997
Q gi|255764473|r  267 HRGEEVINEVLDGPQ  281 (306)
Q Consensus       267 ~rg~EI~~~v~d~~~  281 (306)
                       -+.||+-+-+....
T Consensus       291 -fd~EId~~~L~~~a  304 (413)
T cd00401         291 -FDVEIDVKGLKENA  304 (413)
T ss_pred             -CCHHEEHHHHHHCC
T ss_conf             -72323099887066


No 53 
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families in
Probab=86.79  E-value=0.23  Score=29.21  Aligned_cols=135  Identities=15%  Similarity=0.131  Sum_probs=74.2

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCCC-------CCCCCCCE-EEEEECCCCCHHHHHHHHHHHHCCC---CCCCCC
Q ss_conf             784458999999999999999966523666-------54437987-9999428883578999989863475---433332
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIFE-------NKPLSGKV-LAMIFEKPSTRTRVSFEVAMKHLGG---DTIFLS   77 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~-------~~~l~gk~-i~~lF~e~StRTR~SFe~A~~~LG~---~~~~~~   77 (306)
                      |.+-|.+++-+..+-.+|+.+.+.......       ..-|+|-- |.+-|.-.....|..=+.-..+.|.   .+.  +
T Consensus        32 i~L~DId~erL~~~~~~a~~~~~~~~~~~~v~~ttd~~eAl~gADfVi~~irvGg~~~r~~De~IplkyGv~gqeT~--G  109 (425)
T cd05197          32 VTLYDIDEERLDIILTIAKRYVEEVGADIKFEKTMDLEDAIIDADFVINQFRVGGLTYREKDEQIPLKYGVIGQETV--G  109 (425)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCEEEEEEEECCHHHHHHHHHHHHHCCCEEECCC--C
T ss_conf             99988999999999999999999619983899978999985689999998875670578999868987591444377--7


Q ss_pred             CCCC--CCCCCCCHHHHHHHHHHC-CCEEEEEEC-CCCH-HHHHHCC-CCCCEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             1000--012321079999975300-101112101-3200-6776301-24412404333202467876557664
Q gi|255764473|r   78 GSEM--QLGRAETIGDTAKVLSRY-VDAIVMRTT-NHSR-LLELTEY-ATVPVINALTDNTHPCQIIADIMTFE  145 (306)
Q Consensus        78 ~~~s--s~~kgEsl~Dt~~~ls~~-~D~iviR~~-~~~~-~~~~~~~-~~vpvINa~~~~~HPtQaL~D~~Ti~  145 (306)
                      ++..  ++-.---+.|.++-+..+ .|+.++--. +-+. .+.+.++ ..+.+|+-.++-.+-.+.|++++-+-
T Consensus       110 ~GG~~~alRtIPv~l~ia~~i~e~cP~AwliNytNP~~ivt~al~~~~~~~k~vGLCh~~~~~~~~la~~lg~~  183 (425)
T cd05197         110 PGGTFSGLRQIPYVLDIARKXEKLSPDAWYLNFTNPAGEVTEAVRRYVPPEKAVGLCNVPIGVMEIVAKLLGES  183 (425)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCC
T ss_conf             88999998429999999999998699808997378789999999974888848985866799999999994998


No 54 
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are eukaryotic MDHs localized to the cytoplasm and cytosol. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=86.58  E-value=0.88  Score=25.39  Aligned_cols=61  Identities=23%  Similarity=0.347  Sum_probs=27.8

Q ss_pred             HCCCCCCCCCCCCCCCCCCCC-----------HHHHHHHHHHC--CCEEE--EEECCCCHHHHHHCCC-CCC--EECCCC
Q ss_conf             347543333210000123210-----------79999975300--10111--2101320067763012-441--240433
Q gi|255764473|r   68 HLGGDTIFLSGSEMQLGRAET-----------IGDTAKVLSRY--VDAIV--MRTTNHSRLLELTEYA-TVP--VINALT  129 (306)
Q Consensus        68 ~LG~~~~~~~~~~ss~~kgEs-----------l~Dt~~~ls~~--~D~iv--iR~~~~~~~~~~~~~~-~vp--vINa~~  129 (306)
                      --|++++.+.++- -...||+           +++.++.+..|  .|+.|  +=.|-+.....+.+++ .+|  .|-+++
T Consensus        76 ~~~aDvvii~ag~-prkpGmtR~DLl~~Na~I~k~~~~~I~~~a~p~~~viVv~NPvn~~~~i~~~~a~~~p~~~i~~~t  154 (325)
T cd01336          76 FKDVDVAILVGAM-PRKEGMERKDLLKANVKIFKEQGEALDKYAKKNVKVLVVGNPANTNALILLKYAPSIPKENFTALT  154 (325)
T ss_pred             HCCCCEEEEECCC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHCCCCCHHHEEEEE
T ss_conf             3688789994887-799998279999989999999999999861458199992793588999999977999668499842


No 55 
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional
Probab=86.37  E-value=2.2  Score=22.81  Aligned_cols=82  Identities=16%  Similarity=0.189  Sum_probs=54.5

Q ss_pred             CCEEEEEECCCC----CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HH
Q ss_conf             987999942888----35789999898634754333321000012321079999975300101112101320067---76
Q gi|255764473|r   44 GKVLAMIFEKPS----TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---EL  116 (306)
Q Consensus        44 gk~i~~lF~e~S----tRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~  116 (306)
                      ..+|+..+...+    .+-+-.|+.+++.+|.+++..++....-..   +.+.-..++..+|+|++=..+...+.   +.
T Consensus        25 ~~~IGv~~~~~~~~~~~~~~~~~~~~Ake~G~~v~v~dA~~D~~~Q---i~qIe~~I~qgvdaIiv~p~D~~al~~~v~~  101 (330)
T PRK10355         25 EVKIGMAIDDLRLERWQKDRDIFVKKAESLGAKVFVQSANGNEETQ---MSQIENMINRGVDVLVIIPYNGQVLSNVIKE  101 (330)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHH---HHHHHHHHHCCCCEEEEECCCHHHHHHHHHH
T ss_conf             8679999068888689999999999999759989997189998999---9999999985999999969987888999999


Q ss_pred             HCCCCCCEECCC
Q ss_conf             301244124043
Q gi|255764473|r  117 TEYATVPVINAL  128 (306)
Q Consensus       117 ~~~~~vpvINa~  128 (306)
                      ++...||||+--
T Consensus       102 A~~aGIPVI~~D  113 (330)
T PRK10355        102 AKQEGIKVLAYD  113 (330)
T ss_pred             HHHCCCEEEEEC
T ss_conf             998799499957


No 56 
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
Probab=85.90  E-value=0.33  Score=28.16  Aligned_cols=152  Identities=14%  Similarity=0.105  Sum_probs=81.0

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCC-------CCCCCCCCE-EEEEECCCCCHHHHHHHHHHHHCCCC-CC--CCC
Q ss_conf             78445899999999999999996652366-------654437987-99994288835789999898634754-33--332
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIF-------ENKPLSGKV-LAMIFEKPSTRTRVSFEVAMKHLGGD-TI--FLS   77 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~-------~~~~l~gk~-i~~lF~e~StRTR~SFe~A~~~LG~~-~~--~~~   77 (306)
                      |.+-|.+.+-+..+-.+++.+.+......       ...-|+|-- |.+-|.-....-|..=|.-..+.|-. .+  ..+
T Consensus        32 i~L~Did~erl~~v~~l~~~~~~~~~~~~~v~~Ttd~~eAl~gADfV~~~irvGg~~~r~~De~Iplk~Gv~~~vGET~G  111 (423)
T cd05297          32 IALMDIDEERLETVEILAKKIVEELGAPLKIEATTDRREALDGADFVINTIQVGGHEYTETDFEIPEKYGYYQTVGDTSG  111 (423)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHCCCCEEECCCCC
T ss_conf             99988999999999999999998519981899968999984689999998774682488988848988396604456547


Q ss_pred             CCCCCCCCC--CCHHHHHHHHHHC-CCEEEEEEC--CCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHH--CCC
Q ss_conf             100001232--1079999975300-101112101--320067763012441240433320246787655766420--013
Q gi|255764473|r   78 GSEMQLGRA--ETIGDTAKVLSRY-VDAIVMRTT--NHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEH--RGS  150 (306)
Q Consensus        78 ~~~ss~~kg--Esl~Dt~~~ls~~-~D~iviR~~--~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~--~g~  150 (306)
                      ++....+-.  --+.|.++.+..+ .|+.++-=.  ..-..+.+.++..+.+|+-.++-.+....+++++-.-+.  .-.
T Consensus       112 ~GG~~~alRtIPv~leia~~i~e~~P~AwiiNytNP~~ivteal~r~~~~k~iGlC~~p~~~~~~la~~l~~~~~~v~~~  191 (423)
T cd05297         112 PGGIFRALRTIPVLLDIARDIEELCPDAWLLNYANPMAELTWALNRYTPIKTVGLCHGVQGTAEQLAKLLGEPPEEVDYQ  191 (423)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHCCCHHHCEEE
T ss_conf             75899986228999999999998799838997678889999999973899789879776999999999829988991899


Q ss_pred             CCCCC-EEEEC
Q ss_conf             36773-04610
Q gi|255764473|r  151 VKGKL-FSWSG  160 (306)
Q Consensus       151 l~~~~-i~~vG  160 (306)
                      .-|++ .+|.=
T Consensus       192 ~~GLNH~~W~~  202 (423)
T cd05297         192 VAGINHMAWLL  202 (423)
T ss_pred             EECCCEEEEEE
T ss_conf             95054468999


No 57 
>PRK05442 malate dehydrogenase; Provisional
Probab=85.77  E-value=1.1  Score=24.70  Aligned_cols=24  Identities=21%  Similarity=0.223  Sum_probs=11.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             4754333321000012321079999
Q gi|255764473|r   69 LGGDTIFLSGSEMQLGRAETIGDTA   93 (306)
Q Consensus        69 LG~~~~~~~~~~ss~~kgEsl~Dt~   93 (306)
                      -|++++.+.++- .-..||+-.|.+
T Consensus        79 ~~aDvviitag~-prkPGmtR~DLl  102 (325)
T PRK05442         79 KDADVALLVGAR-PRGPGMERKDLL  102 (325)
T ss_pred             CCCCEEEECCCC-CCCCCCCHHHHH
T ss_conf             799889980786-799997489999


No 58 
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional
Probab=85.62  E-value=3  Score=21.87  Aligned_cols=240  Identities=16%  Similarity=0.120  Sum_probs=134.2

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE-ECCCCCHHHHHHHHHHHHCCCCCCCCC--CCC-----
Q ss_conf             784458999999999999999966523666544379879999-428883578999989863475433332--100-----
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMI-FEKPSTRTRVSFEVAMKHLGGDTIFLS--GSE-----   80 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~l-F~e~StRTR~SFe~A~~~LG~~~~~~~--~~~-----   80 (306)
                      +++.+..+.+|+..=..---+....++....+||+|.+|+.- -.++-|-   -+-..-+.+|+.|..-+  +-+     
T Consensus        10 ~~La~~G~~~Iewa~~~MPvL~~ir~~~~~~kPl~G~rI~~clHle~kTA---~L~~tL~~~GAeV~~~~~NplSTQDdv   86 (427)
T PRK05476         10 ISLADWGRKEIEWAETEMPGLMAIREEFAAEKPLKGARIAGCLHMTIQTA---VLIETLKALGAEVRWASCNPFSTQDHA   86 (427)
T ss_pred             CHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCCCCCEEEEEEEECHHHH---HHHHHHHHCCCEEEEECCCCCCCCHHH
T ss_conf             02306668999999977979999999863369989988999983008899---999999984998999547987645799


Q ss_pred             ----------CCCCCCCCHHHHHHH----HHHCCCEEEEEECC--------------------C------CHHHHHHCC-
Q ss_conf             ----------001232107999997----53001011121013--------------------2------006776301-
Q gi|255764473|r   81 ----------MQLGRAETIGDTAKV----LSRYVDAIVMRTTN--------------------H------SRLLELTEY-  119 (306)
Q Consensus        81 ----------ss~~kgEsl~Dt~~~----ls~~~D~iviR~~~--------------------~------~~~~~~~~~-  119 (306)
                                .--.+|||.++....    |+...|+++=-..+                    +      ..+..+++. 
T Consensus        87 aAaL~~~Gi~VfA~~g~t~eey~~~~~~~L~~~P~iiiDDG~Dl~~~lh~~~~~~~~~i~G~~EETTTGv~RL~am~~~g  166 (427)
T PRK05476         87 AAALAAAGIPVFAWKGETLEEYWEAIERALDWGPNMILDDGGDLTLLVHTERPELLANIKGVTEETTTGVHRLYAMAKDG  166 (427)
T ss_pred             HHHHHHCCEEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHHCEECCCCCCHHHHHHHHHHHCC
T ss_conf             99998689169997898999999999997555998787565228999998605667541630347526389999998669


Q ss_pred             -CCCCEECCCCC-------CCHHH-HHHHHHHHHHHHCC-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCC
Q ss_conf             -24412404333-------20246-78765576642001-3367730461045555431010012331257652000013
Q gi|255764473|r  120 -ATVPVINALTD-------NTHPC-QIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSE  189 (306)
Q Consensus       120 -~~vpvINa~~~-------~~HPt-QaL~D~~Ti~e~~g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~  189 (306)
                       ..+|+||.-|.       +-|=| |.+.|-+  .+.-+ -+.|++++.+|-+ .+.+-....+.-+|..|.++-.... 
T Consensus       167 ~L~~PviavNDa~tK~~FDNrYGtGqS~~dgi--~r~Tn~llaGK~vVV~GYG-~~GkG~A~~arg~GA~ViVtEvDPi-  242 (427)
T PRK05476        167 ELKFPAINVNDSVTKSKFDNRYGTGESLLDGI--KRATNVLIAGKVVVVAGYG-DVGKGSAQRLRGLGARVIVTEIDPI-  242 (427)
T ss_pred             CCCCCEEEECCHHHHHHCCCCCCCCCCHHHHH--HHHHCCEECCCEEEEECCC-CCCCHHHHHHHCCCCEEEEEECCHH-
T ss_conf             77777798655344222245533462499999--9873521257379995566-5560089987418987999804737-


Q ss_pred             CCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCC
Q ss_conf             21000024320133222136646630687332221000000220133310011123368899628987299259998748
Q gi|255764473|r  190 PRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRG  269 (306)
Q Consensus       190 ~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg  269 (306)
                          ..-.+.-.|..+   ..++++++.+|+++|-.    +   .        .=-|+.+.++..|+++++.-.|-  -+
T Consensus       243 ----~ALeA~mDGf~V---~~~~~a~~~~DifiT~T----G---~--------~~vI~~~h~~~MKdgaIl~N~GH--fd  298 (427)
T PRK05476        243 ----CALQAAMDGFEV---MTMEEAAEKADIFVTAT----G---N--------KDVITAEHMEAMKDGAIVCNIGH--FD  298 (427)
T ss_pred             ----HHHHHHHCCCCC---CCHHHHHHHCCEEEEEC----C---C--------CCCCCHHHHHHHCCCEEEECCCC--CC
T ss_conf             ----999988627835---65899862089999904----8---9--------57248999985078829976777--75


Q ss_pred             CCCCHHHHCC
Q ss_conf             7357679679
Q gi|255764473|r  270 EEVINEVLDG  279 (306)
Q Consensus       270 ~EI~~~v~d~  279 (306)
                      .||+-+-+..
T Consensus       299 ~EIdv~~L~~  308 (427)
T PRK05476        299 NEIDVAALEE  308 (427)
T ss_pred             CEEEHHHHHH
T ss_conf             0432887752


No 59 
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases. Bacillus subtilis GlvA and Clostridium acetobutylicum pagL are 6-phospho-alpha-glucosidase, catalyzing the hydrolysis of alpha-glucopyranoside bonds to release glucose from oligosaccharides. The substrate specificities of other members of this subgroup are unknown. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP_PTS).  After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases, which include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. Members of this subfamily are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductas
Probab=85.40  E-value=0.35  Score=28.03  Aligned_cols=136  Identities=13%  Similarity=0.098  Sum_probs=66.6

Q ss_pred             CCCHHHCCHHHHHHHHHHHHHHHHHHHCCC-------CCCCCCCCE-EEEEECCCCCHHHHHHHHHHHHCCC---CCCCC
Q ss_conf             178445899999999999999996652366-------654437987-9999428883578999989863475---43333
Q gi|255764473|r    8 FADLSNISSSNLSCIIEVAKKIKNSSENIF-------ENKPLSGKV-LAMIFEKPSTRTRVSFEVAMKHLGG---DTIFL   76 (306)
Q Consensus         8 ~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~-------~~~~l~gk~-i~~lF~e~StRTR~SFe~A~~~LG~---~~~~~   76 (306)
                      -+.+-|.+.+-+..+-.+|+.+........       ..+-|+|-- |.+-|.-.....|..=|.=..+.|.   .+.  
T Consensus        31 ei~L~DId~~rL~~~~~la~~~~~~~g~~~~i~~ttdr~eAL~gADfVi~~irvGg~~~r~~De~Ip~kyGivgqeT~--  108 (437)
T cd05298          31 ELVLYDIDAERQEKVAEAVKILFKENYPEIKFVYTTDPEEAFTDADFVFAQIRVGGYAMREQDEKIPLKHGVVGQETC--  108 (437)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHCCCCCCCCC--
T ss_conf             899977999999999999999998529981799967999985799999996652683267888767987597760156--


Q ss_pred             CCCCC--CCCCCCCHHHHHHHHHHC-CCEEEEEECC-CCHH-HHHHC-CCCCCEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             21000--012321079999975300-1011121013-2006-77630-124412404333202467876557664
Q gi|255764473|r   77 SGSEM--QLGRAETIGDTAKVLSRY-VDAIVMRTTN-HSRL-LELTE-YATVPVINALTDNTHPCQIIADIMTFE  145 (306)
Q Consensus        77 ~~~~s--s~~kgEsl~Dt~~~ls~~-~D~iviR~~~-~~~~-~~~~~-~~~vpvINa~~~~~HPtQaL~D~~Ti~  145 (306)
                      +++..  ++-.-=-+.|.++-+..+ .|+.++--.+ .+.+ +.+.+ +..+.+|.-..+..+-.+.|+.++-+-
T Consensus       109 G~GGi~~alRtiPv~ldia~di~e~cP~AwliNytNP~~~vt~al~~~~~~~k~vGLCh~~~~~~~~la~~Lg~~  183 (437)
T cd05298         109 GPGGFAYGLRSIGPMIELIDDIEKYSPDAWILNYSNPAAIVAEALRRLFPNARILNICDMPIAIMDSMAAILGLD  183 (437)
T ss_pred             CCCHHHEEEEEHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCC
T ss_conf             646224011449999999999998799928997578789999999974899988988978899999999995898


No 60 
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism]
Probab=85.36  E-value=0.59  Score=26.50  Aligned_cols=47  Identities=30%  Similarity=0.405  Sum_probs=37.4

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHH
Q ss_conf             2107999997530010111210132006776301244124043332024
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHP  134 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HP  134 (306)
                      +|++.+..+ +..|+|+++-|+. .+-+....+.+++|||-.|.|..|=
T Consensus       184 R~~v~~ll~-l~~yiD~iIPRGg-~~Li~~v~~~a~vPVi~~~~G~CHi  230 (417)
T COG0014         184 REEVLELLR-LDGYIDLVIPRGG-AGLIRRVVENATVPVIEHGVGNCHI  230 (417)
T ss_pred             HHHHHHHHH-HCCCEEEEECCCC-HHHHHHHHHCCCCCEEECCCCEEEE
T ss_conf             799999982-0676369973895-7999999847958788547503799


No 61 
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=85.02  E-value=0.62  Score=26.39  Aligned_cols=36  Identities=14%  Similarity=0.108  Sum_probs=24.0

Q ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             437987999942888357899998986347543333210
Q gi|255764473|r   41 PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGS   79 (306)
Q Consensus        41 ~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~   79 (306)
                      -|+||+|..+=.=   +|=.|-....+++|..+...|..
T Consensus        11 ~~~gk~v~V~GlG---~sG~s~a~~L~~~G~~v~~~D~~   46 (481)
T PRK01438         11 DWSGLRVVVAGLG---VSGFPAADALHELGASVTVVADG   46 (481)
T ss_pred             HCCCCEEEEEEEC---HHHHHHHHHHHHCCCEEEEEECC
T ss_conf             7189989999575---88999999999679989999799


No 62 
>PRK12861 malic enzyme; Reviewed
Probab=84.49  E-value=3.4  Score=21.53  Aligned_cols=185  Identities=15%  Similarity=0.129  Sum_probs=102.0

Q ss_pred             CCCHHHHHHHHHHCCCEEEEE---ECCC-CHHHHHHCCCCCCEECCCCCCCHHHH--HHHHHHHHHHHC-CCCCCCCEEE
Q ss_conf             210799999753001011121---0132-00677630124412404333202467--876557664200-1336773046
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMR---TTNH-SRLLELTEYATVPVINALTDNTHPCQ--IIADIMTFEEHR-GSVKGKLFSW  158 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR---~~~~-~~~~~~~~~~~vpvINa~~~~~HPtQ--aL~D~~Ti~e~~-g~l~~~~i~~  158 (306)
                      .+.+-+|.+.++--+-+|-+-   .|+- ..-..+.+-.+|||.-   +++|=|-  +++-+.--.+.- ++++..||++
T Consensus       116 ~~~~i~~v~~~~ptfgginledi~ap~cf~ie~~l~~~~~ipv~h---ddqhgtaii~~a~l~nal~~~~k~~~~~kiv~  192 (762)
T PRK12861        116 PDKLVDIIAGLEPTFGGINLEDIKAPECFTVERKLRERMKIPVFH---DDQHGTAITVAAAFINGLKVVGKSIKEVKVVT  192 (762)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHCCCCCCHHHHHHHHHHCCCCEEC---CCCCCHHHHHHHHHHHHHHHHCCCHHHEEEEE
T ss_conf             899999999858875623798768974027999999867998231---67760899999999999998287565616999


Q ss_pred             ECCCCCCCCCHHHCCCCCCE---EEEEECHHCCC--CCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCC
Q ss_conf             10455554310100123312---57652000013--21000024320133222136646630687332221000000220
Q gi|255764473|r  159 SGDGNNILHSLIEGAARFNY---LLNIATPIGSE--PRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEF  233 (306)
Q Consensus       159 vGd~~~v~hS~i~~~~~~g~---~v~~~~P~~~~--~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~  233 (306)
                      .|-+. -.-+-+.++..+|.   ++.+|--+|..  -+++..+..+..-..-+-...+.+++++||+.+-..        
T Consensus       193 ~GaGa-a~ia~~~l~~~~G~~~~ni~~~D~~G~i~~~r~~~~~~~k~~~a~~t~~~~l~ea~~gaDvfiG~S--------  263 (762)
T PRK12861        193 SGAGA-AALACLDLLVDLGLPVENIWVTDIEGVVYRGRTTLMDPAKERFAQETDARTLAEVIGGADVFLGLS--------  263 (762)
T ss_pred             ECCCH-HHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHCCCCEEEECC--------
T ss_conf             68778-899999999983999555899947785118986535799999985689777999837898899767--------


Q ss_pred             HHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHH---------CCCCCHHHHHHHHHH
Q ss_conf             13331001112336889962898729925999874873576796---------799710686877559
Q gi|255764473|r  234 KAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVL---------DGPQSVVFDEAENRL  292 (306)
Q Consensus       234 ~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~---------d~~~s~~~~Qa~Ngl  292 (306)
                              .+=-++.+.++.+.++.+|+-+-  |-.-||..+..         -+-||=|=.|+.|-+
T Consensus       264 --------~~~~~~~~mv~~Ma~~pivfalA--NP~PEI~p~~a~~~r~~~i~aTGRSD~pNQvNNvL  321 (762)
T PRK12861        264 --------AGGVLKAEMLKAMAARPLILALA--NPTPEIFPELAHATRDDVVIATGRSDYPNQVNNVL  321 (762)
T ss_pred             --------CCCCCCHHHHHHHCCCCEEEECC--CCCCCCCHHHHHHHCCCEEEECCCCCCCCCCCCEE
T ss_conf             --------89989999998537787699726--99988898998541686898348878853124532


No 63 
>pfam02056 Glyco_hydro_4 Family 4 glycosyl hydrolase.
Probab=84.47  E-value=0.4  Score=27.65  Aligned_cols=79  Identities=14%  Similarity=0.168  Sum_probs=39.4

Q ss_pred             CCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCC---CCCCCCCCCHHHHCC
Q ss_conf             32221366466306873322210000002201333100111233688996289872992599---987487357679679
Q gi|255764473|r  203 ASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCL---PAHRGEEVINEVLDG  279 (306)
Q Consensus       203 ~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHpl---P~~rg~EI~~~v~d~  279 (306)
                      .+++.+.|.++|+++||+|+........+ ....+.+.-.+|++....=+...+.. +++-+   |  .-.||..++-+-
T Consensus        59 ~~v~~ttd~~eAl~gADfVi~~irvG~~~-~r~~De~Iplk~Gv~~~~~eT~G~GG-~~~alRtip--~~l~ia~~i~e~  134 (183)
T pfam02056        59 IKFEKTTDRKEALTDADFVINAIRVGLLP-ARELDEKIPLRHGVVGTIQETVGPGG-IFRGLRTIP--VFFDIAKDIEEL  134 (183)
T ss_pred             EEEEEECCHHHHHCCCCEEEEEEEECCCH-HHHHHHHHHHHCCCCCEECCCCCCCH-HHHHHCCHH--HHHHHHHHHHHH
T ss_conf             39999789999966899999986407714-88877767998396532332457228-887760189--999999999997


Q ss_pred             -CCCHHH
Q ss_conf             -971068
Q gi|255764473|r  280 -PQSVVF  285 (306)
Q Consensus       280 -~~s~~~  285 (306)
                       |..|++
T Consensus       135 ~P~Awli  141 (183)
T pfam02056       135 CPDAWVL  141 (183)
T ss_pred             CCCCEEE
T ss_conf             9983899


No 64 
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are bacterial MDHs, and plant MDHs localized to the choloroplasts. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=84.42  E-value=1.4  Score=24.11  Aligned_cols=24  Identities=21%  Similarity=0.208  Sum_probs=10.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             4754333321000012321079999
Q gi|255764473|r   69 LGGDTIFLSGSEMQLGRAETIGDTA   93 (306)
Q Consensus        69 LG~~~~~~~~~~ss~~kgEsl~Dt~   93 (306)
                      =|++++.+.++- .-.-|||-.|.+
T Consensus        77 ~~aDvVvitaG~-prkPG~tR~DLl  100 (322)
T cd01338          77 KDADWALLVGAK-PRGPGMERADLL  100 (322)
T ss_pred             CCCCEEEEECCC-CCCCCCCHHHHH
T ss_conf             788789993687-899898189999


No 65 
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NAD(P) binding domains of methylene-tetrahydrofolate dehydrogenase (m-THF DH) and  m-THF DH/cyclohydrolase bifunctional enzymes (m-THF DH/cyclohydrolase). M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional
Probab=84.10  E-value=1.4  Score=24.02  Aligned_cols=63  Identities=14%  Similarity=0.016  Sum_probs=43.8

Q ss_pred             HHHHHHHCC-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCC
Q ss_conf             576642001-3367730461045555431010012331257652000013210000243201332221366466306873
Q gi|255764473|r  141 IMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAH  219 (306)
Q Consensus       141 ~~Ti~e~~g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD  219 (306)
                      +..+.++++ +++|++++++|..+-|..-+..++..-|+.+++|.-.                     +.|+.+.+++||
T Consensus        15 v~~ll~~y~i~l~Gk~vvVvGrS~~VG~Pla~lL~~~~atVt~~hs~---------------------t~~l~~~~~~AD   73 (140)
T cd05212          15 VKELLNKEGVRLDGKKVLVVGRSGIVGAPLQCLLQRDGATVYSCDWK---------------------TIQLQSKVHDAD   73 (140)
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCC---------------------CCCHHHHHHHCC
T ss_conf             99999980999999999999998124999999999788989994699---------------------959899852349


Q ss_pred             CCCCC
Q ss_conf             32221
Q gi|255764473|r  220 CVFTD  224 (306)
Q Consensus       220 ~V~~~  224 (306)
                      +|.+-
T Consensus        74 IvI~a   78 (140)
T cd05212          74 VVVVG   78 (140)
T ss_pred             EEEEC
T ss_conf             99981


No 66 
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. Although the delta receptors are a member of the ionotropic glutamate receptor family, they cannot be activated by AMPA, kainate, NMDA, glutamate, or any other ligands. Phylogenetic analysis shows that both GluRdelta1 and GluRalpha2 are closer related to non-NMDA receptors. GluRdelta2 was shown to function as a
Probab=83.80  E-value=3.6  Score=21.35  Aligned_cols=102  Identities=13%  Similarity=0.216  Sum_probs=56.1

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCC-----CCCCCCCCCHHHHHHHHHHC-CCEEEEEECCC----CHHHH
Q ss_conf             7999942888357899998986347543333210-----00012321079999975300-10111210132----00677
Q gi|255764473|r   46 VLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGS-----EMQLGRAETIGDTAKVLSRY-VDAIVMRTTNH----SRLLE  115 (306)
Q Consensus        46 ~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~-----~ss~~kgEsl~Dt~~~ls~~-~D~iviR~~~~----~~~~~  115 (306)
                      +|+.+|.+.+--.-.+|..|+.+.-.+.-.+...     --.+...-|+.=+-++...+ .++..|=+|.+    ..+..
T Consensus         1 ~IGaIF~~~~~~~e~AFr~Av~~iN~~~~~l~~~~L~~~i~~v~~~DsF~~~k~~C~ll~~GV~AIfGP~s~~sa~~v~S   80 (400)
T cd06391           1 HIGAIFDESAKKDDEVFRMAVADLNQNNEILQTEKITVSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQS   80 (400)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHH
T ss_conf             91366579984899999999998605833257871068888738999089999999987439469999997558999998


Q ss_pred             HHCCCCCCEE------------------CCCC-C---CCHHH----HHHHHHHHHHHH
Q ss_conf             6301244124------------------0433-3---20246----787655766420
Q gi|255764473|r  116 LTEYATVPVI------------------NALT-D---NTHPC----QIIADIMTFEEH  147 (306)
Q Consensus       116 ~~~~~~vpvI------------------Na~~-~---~~HPt----QaL~D~~Ti~e~  147 (306)
                      +.....||.|                  .+.. +   .-||.    +|++|+.+-.++
T Consensus        81 icdal~IPhi~~~~~~~~~p~~~~~~~~~~~~~~f~inl~P~~~l~~A~~dlV~~~~W  138 (400)
T cd06391          81 LADAMHIPHLFIQRSTAGTPRSSCGLTRSNRNDDYTLSVRPPVYLNDVILRVVTEYAW  138 (400)
T ss_pred             HHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHCCC
T ss_conf             7446889807632577778411267664557775389827768999999999997798


No 67 
>TIGR02012 tigrfam_recA protein RecA; InterPro: IPR001553   The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response . In homologous recombination, the protein functions as a DNA-dependent ATPase, promoting synapsis, heteroduplex formation and strand exchange between homologous DNAs . RecA also acts as a protease cofactor that promotes autodigestion of the lexA product and phage repressors. The proteolytic inactivation of the lexA repressor by an activated form of recA may cause a derepression of the 20 or so genes involved in the SOS response, which regulates DNA repair, induced mutagenesis, delayed cell division and prophage induction in response to DNA damage .    RecA is a protein of about 350 amino-acid residues. Its sequence is very well conserved , ,  among eubacterial species. It is also found in the chloroplast of plants . RecA-like proteins are found in archaea and diverse eukaryotic organisms, like fission yeast, mouse or human. In the filament visualised by X-ray crystallography, -strand 3, the loop C-terminal to -strand 2, and alpha-helix D of the core domain form one surface that packs against alpha-helix A and -strand 0 (the N-terminal domain) of an adjacent monomer during polymerisation [Lusetti and Cox, Annu. Rev. Biochem. 2002. 71:71-100.]. The core ATP-binding site domain is well conserved, with 14 invariant residues. It contains the nucleotide binding loop between -strand 1 and alpha-helix C. The Escherichia coli sequence GPESSGKT matches the consensus sequence of amino acids (G/A)XXXXGK(T/S) for the Walker A box (also referred to as the P-loop) found in a number of nucleoside triphosphate (NTP)-binding proteins. Another nucleotide binding motif, the Walker B box is found at -strand 4 in the RecA structure. The Walker B box is characterised by four hydrophobic amino acids followed by an acidic residue (usually aspartate). Nucleotide specificity and additional ATP binding interactions are contributed by the amino acid residues at -strand 2 and the loop C-terminal to that strand, all of which are greater than 90
Probab=83.31  E-value=3.7  Score=21.32  Aligned_cols=101  Identities=20%  Similarity=0.271  Sum_probs=66.5

Q ss_pred             CCCEEEEEECCCCCHHHHHH--HHHHHHCCCCCCCCCCCC-------------------CCCCCCCCHHHHHHHH--HHC
Q ss_conf             79879999428883578999--989863475433332100-------------------0012321079999975--300
Q gi|255764473|r   43 SGKVLAMIFEKPSTRTRVSF--EVAMKHLGGDTIFLSGSE-------------------MQLGRAETIGDTAKVL--SRY   99 (306)
Q Consensus        43 ~gk~i~~lF~e~StRTR~SF--e~A~~~LG~~~~~~~~~~-------------------ss~~kgEsl~Dt~~~l--s~~   99 (306)
                      +|+.+=..=.|.|-.|-++.  -+.+++.||.+.++|+.+                   ||...||..-+.+..|  |.-
T Consensus        54 ~GRi~EiYGpESsGKTTLal~~iA~~Qk~Gg~~afiDAEHAlD~~YA~~LGv~~~~L~~sQPd~GE~ALeI~~~L~rSgA  133 (322)
T TIGR02012        54 KGRIIEIYGPESSGKTTLALHVIAEAQKAGGVAAFIDAEHALDPVYAKKLGVDIDNLLVSQPDTGEQALEIAETLVRSGA  133 (322)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHCCHHHHHHHCCCHHHHEEECCCCCHHHHHHHHHHHHCCC
T ss_conf             75079985489884789999999999743983899845130377889983645247112088871469999999872376


Q ss_pred             CCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHH-HHHHHHHHHHHHCCCC
Q ss_conf             101112101320067763012441240433320246-7876557664200133
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPC-QIIADIMTFEEHRGSV  151 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPt-QaL~D~~Ti~e~~g~l  151 (306)
                      +|+||+=.-  .++-.-+      =|++.=+++|+= ||=+==-.+++..+.+
T Consensus       134 vD~iVvDSV--AAL~P~a------EieGemgd~~~Gl~ARLMS~ALRKl~g~~  178 (322)
T TIGR02012       134 VDIIVVDSV--AALVPKA------EIEGEMGDSHVGLQARLMSQALRKLTGAL  178 (322)
T ss_pred             CEEEEECCC--CCCCCHH------HCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             117997340--0138712------31754354423257888999999888765


No 68 
>pfam06506 PrpR_N Propionate catabolism activator. This domain is found at the N terminus of several sigma54- dependent transcriptional activators including PrpR, which activates catabolism of propionate.
Probab=83.30  E-value=3.1  Score=21.77  Aligned_cols=101  Identities=18%  Similarity=0.173  Sum_probs=57.3

Q ss_pred             HHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCC
Q ss_conf             75300101112101320067763012441240433320246787655766420013367730461045555431010012
Q gi|255764473|r   95 VLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAA  174 (306)
Q Consensus        95 ~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~  174 (306)
                      .....+|+|+-|+..   ...+.++.++|||.-.-..+       |++-....... .+.+++++|..+ +..+.-....
T Consensus        28 ~~~~g~dvIIsRGgt---a~~ir~~~~iPVv~I~~s~~-------Dil~al~~a~~-~~~kiavvg~~~-~~~~~~~~~~   95 (169)
T pfam06506        28 LVAEGVDVIISRGGT---AAYLRDRLSVPVVEIKVSGF-------DLLRALARARR-YGGRIGLVGYEN-IIPGLKALSE   95 (169)
T ss_pred             HHHCCCCEEEECCHH---HHHHHHHCCCCEEEEECCHH-------HHHHHHHHHHH-HCCCEEEEECCC-CCHHHHHHHH
T ss_conf             997799599989658---99999858998899827886-------99999999997-589799992763-0368999999


Q ss_pred             CCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCC
Q ss_conf             331257652000013210000243201332221
Q gi|255764473|r  175 RFNYLLNIATPIGSEPRNEYLNWARNQGASVAL  207 (306)
Q Consensus       175 ~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~  207 (306)
                      .||.++.+.......--...+..++..|.++.+
T Consensus        96 il~~~i~~~~~~~~~e~~~~i~~l~~~G~~vvV  128 (169)
T pfam06506        96 LLGLDIVQRAYQSEEEARAAVKELKAQGIKVIV  128 (169)
T ss_pred             HHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEE
T ss_conf             969935999966889999999999986995998


No 69 
>PRK07631 amidophosphoribosyltransferase; Provisional
Probab=83.14  E-value=2.8  Score=22.11  Aligned_cols=133  Identities=19%  Similarity=0.221  Sum_probs=85.0

Q ss_pred             EEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHH----HHH--CCCE-EEEEECCCCHHH--HHHCC
Q ss_conf             99428883578999989863475433332100001232107999997----530--0101-112101320067--76301
Q gi|255764473|r   49 MIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKV----LSR--YVDA-IVMRTTNHSRLL--ELTEY  119 (306)
Q Consensus        49 ~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~----ls~--~~D~-iviR~~~~~~~~--~~~~~  119 (306)
                      ..|.+++.+..++||-         +||.-.+|.+. |.++.++=+-    |+.  -+|+ +|+-.|+.+...  -+++.
T Consensus       235 ~~~~~~~~~~~C~FEy---------IYFaRpdS~i~-g~~Vy~~R~~~G~~LA~e~~~~~DvVi~VPDSg~~aA~gya~~  304 (475)
T PRK07631        235 ERFSPNINRSICSMEY---------IYFARPDSNVD-GINVHTARKNLGKQLAEEAPVEADVVTGVPDSSISAAIGYAEA  304 (475)
T ss_pred             EECCCCCCCCCCEEEE---------EECCCCCCCCC-CEEHHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHH
T ss_conf             9537987765550343---------21268873207-7069999999999998327987888997899638899999987


Q ss_pred             CCCCEECCCCC-C------CHHHHHHHHHHHHHH---HCCCCCCCCEEEECC---CCCCCCCHHHCCCCCCEE---EEEE
Q ss_conf             24412404333-2------024678765576642---001336773046104---555543101001233125---7652
Q gi|255764473|r  120 ATVPVINALTD-N------THPCQIIADIMTFEE---HRGSVKGKLFSWSGD---GNNILHSLIEGAARFNYL---LNIA  183 (306)
Q Consensus       120 ~~vpvINa~~~-~------~HPtQaL~D~~Ti~e---~~g~l~~~~i~~vGd---~~~v~hS~i~~~~~~g~~---v~~~  183 (306)
                      +.+|.--+.-. .      =-|+|.+=+.-.=.+   .+..++|++|..|-|   -+++.+..+..+...|++   +.++
T Consensus       305 sgip~~~glikn~yvgRTFI~p~q~~R~~~v~~Kln~~~~~v~gK~vvlVDDSIVRGtT~k~iv~~Lr~aGAkeVh~ri~  384 (475)
T PRK07631        305 TGIPYELGLIKNRYVGRTFIQPSQALREQGVKMKLSAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHVRIS  384 (475)
T ss_pred             CCCCHHHHHHCCCEECCCCCCCCHHHHHHHHHCCEEECCCCCCCCEEEEEECCEECCCCHHHHHHHHHHCCCCEEEEEEC
T ss_conf             29954541100130146577975889987442014244200389737997443510641999999999769988999968


Q ss_pred             CHHCCCCC
Q ss_conf             00001321
Q gi|255764473|r  184 TPIGSEPR  191 (306)
Q Consensus       184 ~P~~~~~~  191 (306)
                      +|+-..|.
T Consensus       385 sPpi~~pc  392 (475)
T PRK07631        385 SPPIAHPC  392 (475)
T ss_pred             CCCCCCCC
T ss_conf             99857876


No 70 
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=82.91  E-value=1.6  Score=23.73  Aligned_cols=69  Identities=19%  Similarity=0.167  Sum_probs=46.4

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECCC
Q ss_conf             5789999898634754333321000012321079999975300101112101320067---76301244124043
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINAL  128 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa~  128 (306)
                      +-+-.+|.+++.||.++..+++... ..+-  +.+.-..+...+|+|++=..+...+.   +-++...||||.-.
T Consensus        16 ~~~~Gae~aA~e~Gv~v~~~~a~~D-~~~Q--~~~Ie~~I~~gvD~Iiv~p~d~~a~~~~~~~A~~aGIpVV~~d   87 (272)
T cd06313          16 QGKQAADEAGKLLGVDVTWYGGALD-AVKQ--VAAIENMASQGWDFIAVDPLGIGTLTEAVQKAIARGIPVIDMG   87 (272)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCC-HHHH--HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             9999999999981998999869999-9999--9999999985999999968887899999999998699899974


No 71 
>cd01981 Pchlide_reductase_B Pchlide_reductase_B: B protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase. Pchlide reductase catalyzes the reductive formation of chlorophyllide (chlide) from protochlorophyllide (pchlide) during biosynthesis of chlorophylls and bacteriochlorophylls. This group contains both the light-independent Pchlide reductase (DPOR) and light-dependent Pchlide reductase (LPOR).  Angiosperms contain only LPOR, cyanobacteria, algae and gymnosperms contain both DPOR and LPOR, primitive anoxygenic photosynthetic bacteria contain only DPOR. NB is structurally similar to the FeMo protein of nitrogenase, forming an N2B2 heterotetramer. N and B are homologous to the FeMo alpha and beta subunits respectively. Also in common with nitrogenase in vitro DPOR activity requires ATP hydrolysis and dithoionite or ferredoxin as electron donor. The NB protein complex may serve as a catalytic site for Pchlide reduction similar to MoFe for nitrogen reduction.
Probab=82.51  E-value=3.8  Score=21.22  Aligned_cols=20  Identities=20%  Similarity=0.160  Sum_probs=8.3

Q ss_pred             CCHHHHHHH-HHHC-CCEEEEE
Q ss_conf             107999997-5300-1011121
Q gi|255764473|r   87 ETIGDTAKV-LSRY-VDAIVMR  106 (306)
Q Consensus        87 Esl~Dt~~~-ls~~-~D~iviR  106 (306)
                      |-|.++++. ...| .++|.+-
T Consensus        71 ~kL~~~I~~~~~~y~P~~I~V~   92 (430)
T cd01981          71 EKVVENITRKDKEEKPDLIVLT   92 (430)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9999999999984399768997


No 72 
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain.
Probab=81.81  E-value=4.3  Score=20.85  Aligned_cols=117  Identities=15%  Similarity=0.026  Sum_probs=76.1

Q ss_pred             HHHHHHHHHHHHCC-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHH
Q ss_conf             78765576642001-33677304610455554310100123312576520000132100002432013322213664663
Q gi|255764473|r  136 QIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQA  214 (306)
Q Consensus       136 QaL~D~~Ti~e~~g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~ea  214 (306)
                      |.+.|-+  .+.-+ -+.|++++.+|-+ -+..+....+.-+|..+.++-.....     .-.+.-.|  +.+ ..++++
T Consensus         7 qS~~d~i--~r~tn~llaGk~vvV~GYG-~~GkGvA~~~rg~Ga~V~V~EvDPi~-----aleA~mdG--f~V-~~~~ea   75 (162)
T pfam00670         7 ESLIDGI--KRATDVMIAGKVAVVCGYG-DVGKGCAASLKGQGARVIVTEIDPIC-----ALQAAMEG--FQV-VTLEEV   75 (162)
T ss_pred             CCHHHHH--HHHHCCEECCCEEEEECCC-CCCHHHHHHHHCCCCEEEEEECCCHH-----HHHHHHCC--CCC-CCHHHH
T ss_conf             0289999--8861765748789996787-66777999862299989999479306-----99998649--954-788898


Q ss_pred             CCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCC
Q ss_conf             068733222100000022013331001112336889962898729925999874873576796799
Q gi|255764473|r  215 VKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGP  280 (306)
Q Consensus       215 l~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~  280 (306)
                      ++.+|++.|-.       ..        .=-++.+-++.+|+++++.--+-  .+.||+-+-+..+
T Consensus        76 ~~~aDi~VTaT-------G~--------~~vi~~eh~~~mKdgaIlaN~GH--fd~EIdv~~L~~~  124 (162)
T pfam00670        76 VKKADIFVTTT-------GN--------KDIITGEHMAKMKNDAIVCNIGH--FDNEIDVAWLNTN  124 (162)
T ss_pred             HHCCCEEEECC-------CC--------CCCCCHHHHHHHCCCEEEECCCC--CCCEEEHHHHHCC
T ss_conf             60499999924-------89--------77473999998448869987775--6522728888575


No 73 
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs. Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs from other bacteria. The members of this group are homologous to a family of periplasmic pentose/hexose sugar-binding proteins that function as the primary receptors for chemotaxis and transporters of many sugar based solutes in bacteria and archaea and that are a member of the type I periplasmic binding protein superfamily.  LsrB binds a chemically distinct form of the AI-2 signal that lacks boron, in contrast to the Vibrio harveyi AI-2 signaling molecule that has an unusual furanosyl borate diester. Hence, many bacteria coordinate their gene expression according to the local density of their population by producing species specific AI-2. This process of quorum sensing allows LsrB to function as a periplasmic AI-2 binding p
Probab=81.80  E-value=2  Score=23.00  Aligned_cols=70  Identities=19%  Similarity=0.220  Sum_probs=47.5

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECCCC
Q ss_conf             789999898634754333321000012321079999975300101112101320067---763012441240433
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINALT  129 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa~~  129 (306)
                      -+-.++.|++++|..+.++++.+.+..+-  +...-..++..+|+|++=..+...+.   +-++...||||+--+
T Consensus        17 v~~Gae~aA~e~G~~v~~~~~~~~D~~~Q--~~~ie~~Ia~gvDaIii~p~d~~a~~~~i~~A~~aGIpVv~~Ds   89 (298)
T cd06302          17 MEEGAKEAAKELGVDAIYVGPTTADAAGQ--VQIIEDLIAQGVDAIAVVPNDPDALEPVLKKAREAGIKVVTHDS   89 (298)
T ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCHHHH--HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             99999999999799999988998999999--99999999739988999068778889999999867986998268


No 74 
>PRK06718 precorrin-2 dehydrogenase; Reviewed
Probab=81.74  E-value=1  Score=24.93  Aligned_cols=71  Identities=8%  Similarity=0.072  Sum_probs=43.5

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCH-HHHCCCCCCCCC
Q ss_conf             0133677304610455554310100123312576520000132100002432013322213664-663068733222
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDA-VQAVKGAHCVFT  223 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~-~eal~~aD~V~~  223 (306)
                      +=+++|+++.++|.+. |+-..+..+...|+.+++++|.-.   +++...++.....+.. .+. ...+.++++|+.
T Consensus         5 fl~l~gk~vLVVGGG~-vA~rK~~~Ll~~gA~VtVvsp~~~---~el~~l~~~~~i~~~~-~~~~~~dl~~~~lVia   76 (202)
T PRK06718          5 MIDLSNKRVVIVGGGK-VAGRRAITLLKYGAHITVISPEIT---ENLVKLVEEGKIRWKE-KEFEPSDIVDAFLVIA   76 (202)
T ss_pred             EEECCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCCCC---HHHHHHHHCCCCEEEE-CCCCHHHHCCCCEEEE
T ss_conf             9982898699988989-999999999868996999869999---8999999769944761-6788667516704455


No 75 
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism]
Probab=81.29  E-value=1.7  Score=23.53  Aligned_cols=24  Identities=29%  Similarity=0.371  Sum_probs=13.9

Q ss_pred             CHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             844589999999999999999665
Q gi|255764473|r   10 DLSNISSSNLSCIIEVAKKIKNSS   33 (306)
Q Consensus        10 ~~~dl~~~~i~~ll~~A~~~k~~~   33 (306)
                      -+-|++.+-...+..+++.+-+..
T Consensus        36 ~L~Did~~r~~~i~~~~~~~v~~~   59 (442)
T COG1486          36 ALYDIDEERLKIIAILAKKLVEEA   59 (442)
T ss_pred             EEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             998387788999999999999963


No 76 
>cd04510 consensus
Probab=81.20  E-value=1.5  Score=23.91  Aligned_cols=126  Identities=15%  Similarity=0.140  Sum_probs=50.9

Q ss_pred             CCHHHHHHHHHHCC--C--EEEEEE-CCCCHHHHHHCCC-CCC--EECCCCCCCHHHHHHHHHHHHHHHCC-CCCCC-CE
Q ss_conf             10799999753001--0--111210-1320067763012-441--24043332024678765576642001-33677-30
Q gi|255764473|r   87 ETIGDTAKVLSRYV--D--AIVMRT-TNHSRLLELTEYA-TVP--VINALTDNTHPCQIIADIMTFEEHRG-SVKGK-LF  156 (306)
Q Consensus        87 Esl~Dt~~~ls~~~--D--~iviR~-~~~~~~~~~~~~~-~vp--vINa~~~~~HPtQaL~D~~Ti~e~~g-~l~~~-~i  156 (306)
                      +-+++..+.|+.|.  |  ++|+=. |-+.....+.+++ ++|  =|.|++.-.| -.|.+=   +-++.| ...+. ++
T Consensus       105 ~IF~~qG~al~~~A~~~vKVlVvGN~PaNTNalI~~~~Ap~Ip~~nf~AmtrLD~-NRA~a~---lA~Kl~v~~~~V~nv  180 (334)
T cd04510         105 EHFHRYGQLIEQNAQKDVRVLVAGRGFLNLKASLLIENAPSIDRQNIIAVATQLE-YEAKAQ---LARKLNVNTAGVKDV  180 (334)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCCHHHEEEHHHHHH-HHHHHH---HHHHHCCCHHHHEEE
T ss_conf             9999999999853668867999789865277999997577797676561057678-899999---999869997781233


Q ss_pred             EEECCCCC-----CCCCHHHCCCCCCEEEEEECHHCC------------CCCCCCHHHHHCCCCCCCCCCCHHHHCCCCC
Q ss_conf             46104555-----543101001233125765200001------------3210000243201332221366466306873
Q gi|255764473|r  157 SWSGDGNN-----ILHSLIEGAARFNYLLNIATPIGS------------EPRNEYLNWARNQGASVALFHDAVQAVKGAH  219 (306)
Q Consensus       157 ~~vGd~~~-----v~hS~i~~~~~~g~~v~~~~P~~~------------~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD  219 (306)
                      .+.|.|+.     +-|+.+     .|++=.+-+|.++            +..+++++..++.|..+....-...|...|.
T Consensus       181 iIWGNhS~tq~pD~~~A~v-----~~~dgai~gp~~~~~~v~~~i~D~~Wl~~efi~~Vq~Rga~ii~~Rg~sSAaSaA~  255 (334)
T cd04510         181 IVWGNIGGSTYIDLSRARV-----YRYDGAIWGPDSFSRHVMEMVHDNKWLDTEFRSLLQKHRATILTSLNHAAAISTAH  255 (334)
T ss_pred             EEEECCCCCCCCCHHHCEE-----ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             7984688886774003278-----35465434775456627776347788875313888740688997747450665999


Q ss_pred             CC
Q ss_conf             32
Q gi|255764473|r  220 CV  221 (306)
Q Consensus       220 ~V  221 (306)
                      .+
T Consensus       256 A~  257 (334)
T cd04510         256 AI  257 (334)
T ss_pred             HH
T ss_conf             99


No 77 
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily. Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily. ABP is only involved in transport contrary to other related sugar-binding proteins such as the glucose/galactose-binding protein (GGBP) and the ribose-binding protein (RBP), both of which are involved in chemotaxis as well as transport. The periplasmic ABP consists of two alpha/beta globular domains connected by a three-stranded hinge, a Venus flytrap-like domain, which undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, ABP is homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR) and DNA-binding transcriptional repressors such a
Probab=80.62  E-value=2.8  Score=22.12  Aligned_cols=65  Identities=8%  Similarity=0.009  Sum_probs=45.4

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHH---HHHHCCCCCCEECC
Q ss_conf             8999989863475433332100001232107999997530010111210132006---77630124412404
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRL---LELTEYATVPVINA  127 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~---~~~~~~~~vpvINa  127 (306)
                      +-..+.+++.+|.+++..+..+++    +-+.+.-..+++.+|+|++=..+...+   .+.++.+.||||+-
T Consensus        18 ~~g~~~~A~e~G~~l~~~~~~d~~----~q~~~ie~~i~qgvd~iii~p~d~~~~~~~v~~A~~agIpVv~~   85 (289)
T cd01540          18 WKFAKKAAKEKGFTVVKIDVPDGE----KVLSAIDNLGAQGAKGFVICVPDVKLGPAIVAKAKAYNMKVVAV   85 (289)
T ss_pred             HHHHHHHHHHHCCEEEEECCCCHH----HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             999999999849879997689969----99999999998589889992787100189999999879869993


No 78 
>PRK06781 amidophosphoribosyltransferase; Provisional
Probab=80.61  E-value=3.4  Score=21.51  Aligned_cols=131  Identities=18%  Similarity=0.229  Sum_probs=80.1

Q ss_pred             ECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHC--CCE-EEEEECCCCH--HHHHHCCCC
Q ss_conf             4288835789999898634754333321000012321079999----975300--101-1121013200--677630124
Q gi|255764473|r   51 FEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTA----KVLSRY--VDA-IVMRTTNHSR--LLELTEYAT  121 (306)
Q Consensus        51 F~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~----~~ls~~--~D~-iviR~~~~~~--~~~~~~~~~  121 (306)
                      |.++.-+..++||-         +||.-.+|.+ -|.++.++=    +.|+.-  +|+ +|+-.|+.+.  ..-+++.+.
T Consensus       237 ~~~~~~~~~C~FEy---------IYFaRpdS~~-~g~~Vy~~R~~~G~~LA~e~~~~~DvVi~VPdSg~~aA~gya~~~g  306 (471)
T PRK06781        237 FTNEVDHAICSMEY---------IYFARPDSNI-AGINVHAARKNMGKRLAAEAPIEADVVTGVPDSSISAAIGYAEATG  306 (471)
T ss_pred             CCCCCCCCCEEEEE---------HHCCCCCEEE-CCEEHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHC
T ss_conf             48987776338752---------0105887016-8808999999999998621798889899789873889999999809


Q ss_pred             CCEECCCCC-C------CHHHHHHHHHHHHHH---HCCCCCCCCEEEECCC---CCCCCCHHHCCCCCCEE---EEEECH
Q ss_conf             412404333-2------024678765576642---0013367730461045---55543101001233125---765200
Q gi|255764473|r  122 VPVINALTD-N------THPCQIIADIMTFEE---HRGSVKGKLFSWSGDG---NNILHSLIEGAARFNYL---LNIATP  185 (306)
Q Consensus       122 vpvINa~~~-~------~HPtQaL~D~~Ti~e---~~g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~~---v~~~~P  185 (306)
                      +|.-.+.-. .      =-|+|.+=+...=.+   .+..++|++|.+|-|.   +++....+..+...|++   +.+++|
T Consensus       307 ip~~~glikn~yvgRTFI~p~q~~R~~~v~~Kln~~~~~i~gK~vvlVDDSIVRGtT~k~iv~~Lr~aGAkeVh~ri~sP  386 (471)
T PRK06781        307 IPYELGLIKNRYVGRTFIQPSQELREQGVKMKLSAVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASP  386 (471)
T ss_pred             CCHHHCEEECCCCCCCCCCCCHHHHHHHHHHCCEECCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             97444301002014435387588998765301104100048988999816605575699999999977998899996899


Q ss_pred             HCCCCC
Q ss_conf             001321
Q gi|255764473|r  186 IGSEPR  191 (306)
Q Consensus       186 ~~~~~~  191 (306)
                      +-..|.
T Consensus       387 pi~~Pc  392 (471)
T PRK06781        387 PLKYPC  392 (471)
T ss_pred             CCCCCC
T ss_conf             857876


No 79 
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=80.34  E-value=1.1  Score=24.80  Aligned_cols=37  Identities=11%  Similarity=0.109  Sum_probs=24.6

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             4437987999942888357899998986347543333210
Q gi|255764473|r   40 KPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGS   79 (306)
Q Consensus        40 ~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~   79 (306)
                      ..|+||.|+.+=.   -+|=.|.-....+.|..+...|..
T Consensus        10 ~~l~~kkv~i~Gl---G~sG~a~a~~L~~~g~~v~~~D~~   46 (458)
T PRK01710         10 DFIKNKKVAVVGI---GVSNIPLIKFLVKLGAKVTAFDKK   46 (458)
T ss_pred             HHHCCCEEEEEEE---CHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             9978996999978---788999999999788979999898


No 80 
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=80.23  E-value=2.1  Score=22.92  Aligned_cols=68  Identities=10%  Similarity=0.132  Sum_probs=44.3

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECC
Q ss_conf             789999898634754333321000012321079999975300101112101320067---7630124412404
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINA  127 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa  127 (306)
                      -.-.++.|+.+||..++.....+.+..+-  +.+.-..++..+|+|++-..+...+.   +-+....||||.-
T Consensus        17 ~~~Ga~~aA~~lG~~v~~~~da~~d~~~Q--~~~i~~~I~~gvDaIii~p~d~~a~~~~v~~A~~aGIpVv~~   87 (294)
T cd06316          17 QVRGAKDEFAKLGIEVVATTDAQFDPAKQ--VADIETTISQKPDIIISIPVDPVSTAAAYKKVAEAGIKLVFM   87 (294)
T ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCHHHH--HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99999999998399899966998899999--999999998599999993888678799999999819967983


No 81 
>PRK06388 amidophosphoribosyltransferase; Provisional
Probab=80.00  E-value=3.2  Score=21.73  Aligned_cols=131  Identities=15%  Similarity=0.214  Sum_probs=81.8

Q ss_pred             ECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHC--CCE-EEEEECCCCH--HHHHHCCCC
Q ss_conf             4288835789999898634754333321000012321079999----975300--101-1121013200--677630124
Q gi|255764473|r   51 FEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTA----KVLSRY--VDA-IVMRTTNHSR--LLELTEYAT  121 (306)
Q Consensus        51 F~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~----~~ls~~--~D~-iviR~~~~~~--~~~~~~~~~  121 (306)
                      +.+++....++||-         +||.-.+|.+. |.++...=    +.|+.-  +|+ +|+-.|+.+.  ..-+++.+.
T Consensus       245 ~~~~~~~~~C~FEy---------IYFaRpdS~~~-g~~Vy~~R~~lG~~LA~e~~~~~DiVi~VPdSg~~aa~gya~~sg  314 (474)
T PRK06388        245 KLDGDKVAHCMFEY---------VYFSRPDSIID-GINVYQARVRMGMRLAKESPVEADVVVPVPDSGRSQAIGFSMASG  314 (474)
T ss_pred             ECCCCCCCCCEEEE---------HHHCCCCCCCC-CCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHCC
T ss_conf             68999866545550---------23238873028-818999999999998634798888899578861999999998659


Q ss_pred             CCEECCCCC-C------CHHHHHHHHHHHHHH---HCCCCCCCCEEEECC---CCCCCCCHHHCCCCCCEE---EEEECH
Q ss_conf             412404333-2------024678765576642---001336773046104---555543101001233125---765200
Q gi|255764473|r  122 VPVINALTD-N------THPCQIIADIMTFEE---HRGSVKGKLFSWSGD---GNNILHSLIEGAARFNYL---LNIATP  185 (306)
Q Consensus       122 vpvINa~~~-~------~HPtQaL~D~~Ti~e---~~g~l~~~~i~~vGd---~~~v~hS~i~~~~~~g~~---v~~~~P  185 (306)
                      +|...+.-. .      =-|+|.+=+.-.=.+   .+..++|++|..|-|   .+++..+.+..+.+.|++   +.+++|
T Consensus       315 ip~~~glikn~y~gRTFI~p~q~~R~~~v~~Kln~i~~~i~gK~vvlVDDSIVRGtT~k~iv~~Lr~aGAkeVh~ri~sP  394 (474)
T PRK06388        315 IPYTEGLIKNRYSERTFIMPTQSDRKAAIKLKLNPIREVISGKRIVLVDDSIVRGNTMRFIVKIMRKYGAKEVHVRIGSP  394 (474)
T ss_pred             CCCHHCEEECCCCCCCCCCCCHHHHHHCCCEEEEEEEEEECCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             94110056535447652388677787444266665024417988999816616566799999999977998899997899


Q ss_pred             HCCCCC
Q ss_conf             001321
Q gi|255764473|r  186 IGSEPR  191 (306)
Q Consensus       186 ~~~~~~  191 (306)
                      +-..|.
T Consensus       395 pi~~pC  400 (474)
T PRK06388        395 HIIAPC  400 (474)
T ss_pred             CCCCCC
T ss_conf             967886


No 82 
>PRK09246 amidophosphoribosyltransferase; Provisional
Probab=79.93  E-value=3.5  Score=21.42  Aligned_cols=89  Identities=20%  Similarity=0.207  Sum_probs=60.4

Q ss_pred             EEEEECCCCH--HHHHHCCCCCCEECCCCC-C-----C-HHHHHHHHHHHHHH---HCCCCCCCCEEEECC---CCCCCC
Q ss_conf             1121013200--677630124412404333-2-----0-24678765576642---001336773046104---555543
Q gi|255764473|r  103 IVMRTTNHSR--LLELTEYATVPVINALTD-N-----T-HPCQIIADIMTFEE---HRGSVKGKLFSWSGD---GNNILH  167 (306)
Q Consensus       103 iviR~~~~~~--~~~~~~~~~vpvINa~~~-~-----~-HPtQaL~D~~Ti~e---~~g~l~~~~i~~vGd---~~~v~h  167 (306)
                      +|+=.|+.+.  ...+++.+.+|.-.+.-. .     . -|+|.+=+...-.+   ....++|++|.+|=|   -+++..
T Consensus       296 vVi~VPdSg~~aA~gya~~sgipy~~gliKNrYvgRTFI~P~q~~R~~~vr~Kln~i~~~i~gK~vvlVDDSIVRGtT~k  375 (503)
T PRK09246        296 VVIPIPDTSRDAALEIARILGVPYREGFVKNRYVGRTFIMPGQAQRKKSVRQKLNAIRAEFKGKNVLLVDDSIVRGTTSE  375 (503)
T ss_pred             CEEECCCCCHHHHHHHHHHCCCCHHEEEEECCCCCCCCCCCCHHHHHHHHHHCEECCHHHCCCCEEEEEECCEECCCCHH
T ss_conf             25007997188999999971996120121036557677698688999867652003643156976999845531164199


Q ss_pred             CHHHCCCCCCEE---EEEECHHCCCCC
Q ss_conf             101001233125---765200001321
Q gi|255764473|r  168 SLIEGAARFNYL---LNIATPIGSEPR  191 (306)
Q Consensus       168 S~i~~~~~~g~~---v~~~~P~~~~~~  191 (306)
                      ..+..+...|++   +.+++|+-..|.
T Consensus       376 ~Iv~~Lr~aGAkeVh~riasPpi~~Pc  402 (503)
T PRK09246        376 QIVQMARDAGAKKVYFASAAPPVRYPN  402 (503)
T ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             999999975998899996799857877


No 83 
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily. Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.
Probab=79.88  E-value=2.6  Score=22.25  Aligned_cols=71  Identities=21%  Similarity=0.260  Sum_probs=46.4

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECCCCC
Q ss_conf             5789999898634754333321000012321079999975300101112101320067---7630124412404333
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINALTD  130 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa~~~  130 (306)
                      .-+-.++.+++++|.+++.++.....-..-+-++   ..+++.+|+|++-..+...+.   +-+....||||..-++
T Consensus        16 ~~~~G~~~~A~~~G~~~~v~d~~~d~~~Q~~~i~---~~i~~~vDgIii~p~d~~~~~~~l~~a~~aGIPVV~~d~~   89 (273)
T cd06305          16 AYLAGTKAEAEALGGDLRVYDAGGDDAKQADQID---QAIAQKVDAIIIQHGRAEVLKPWVKRALDAGIPVVAFDVD   89 (273)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHH---HHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             9999999999974998999739999999999999---9998599999994687144489999999859978998177


No 84 
>PRK05225 ketol-acid reductoisomerase; Validated
Probab=79.66  E-value=1.6  Score=23.75  Aligned_cols=13  Identities=23%  Similarity=0.245  Sum_probs=7.9

Q ss_pred             CCCCCCEEEEEEC
Q ss_conf             4437987999942
Q gi|255764473|r   40 KPLSGKVLAMIFE   52 (306)
Q Consensus        40 ~~l~gk~i~~lF~   52 (306)
                      ..|+||.|+.+=|
T Consensus        33 ~~LKgKkI~IiG~   45 (489)
T PRK05225         33 SYLKGKKIVIVGC   45 (489)
T ss_pred             HHHCCCEEEEECC
T ss_conf             6752885999803


No 85 
>KOG0069 consensus
Probab=79.63  E-value=3.4  Score=21.51  Aligned_cols=143  Identities=15%  Similarity=0.177  Sum_probs=70.3

Q ss_pred             CCCHHHHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHHHC---------------------CCCCCCCEEEECCCCCC
Q ss_conf             320067763012441240433320246--7876557664200---------------------13367730461045555
Q gi|255764473|r  109 NHSRLLELTEYATVPVINALTDNTHPC--QIIADIMTFEEHR---------------------GSVKGKLFSWSGDGNNI  165 (306)
Q Consensus       109 ~~~~~~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e~~---------------------g~l~~~~i~~vGd~~~v  165 (306)
                      ++-.+... +.-.|.|=|..+...--|  -++..++.+.+.+                     .+++|++|.++|-+ ++
T Consensus        96 D~vDl~a~-~krgI~V~nvp~~~~~~vAd~~~~lil~~~R~~~~g~~~~~~g~w~~~~~~~~g~~~~gK~vgilG~G-~I  173 (336)
T KOG0069          96 DHVDLEAA-RKRGIRVANVPDVLTDDVADLAVSLLLALLRRFSEGNEMVRNGGWGWAGGWPLGYDLEGKTVGILGLG-RI  173 (336)
T ss_pred             CHHHHHHH-HHCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEECCC-HH
T ss_conf             32138989-86596686058742178899999999999851024344432577665577544666567779996274-78


Q ss_pred             CCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCC
Q ss_conf             43101001233125765200001321000024320133222136646630687332221000000220133310011123
Q gi|255764473|r  166 LHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQ  245 (306)
Q Consensus       166 ~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~  245 (306)
                      ......-+..||+.+....-  ..++.+..   ...+.+   ..|.++-+..+|+|..-+  .++.++.         --
T Consensus       174 G~~ia~rL~~Fg~~i~y~~r--~~~~~~~~---~~~~~~---~~d~~~~~~~sD~ivv~~--pLt~~T~---------~l  234 (336)
T KOG0069         174 GKAIAKRLKPFGCVILYHSR--TQLPPEEA---YEYYAE---FVDIEELLANSDVIVVNC--PLTKETR---------HL  234 (336)
T ss_pred             HHHHHHHHHHCCCEEEEECC--CCCCHHHH---HHHCCC---CCCHHHHHHHCCEEEEEC--CCCHHHH---------HH
T ss_conf             89999963532662554113--57763668---874354---367888873288799926--8977888---------77


Q ss_pred             CCHHHHHCCCCCCEEECCCCCCCCCCCCHH
Q ss_conf             368899628987299259998748735767
Q gi|255764473|r  246 VNLSLMSMAHPDALFMHCLPAHRGEEVINE  275 (306)
Q Consensus       246 i~~~~l~~a~~~~~vmHplP~~rg~EI~~~  275 (306)
                      +|.+.++++|+.+++--+.   ||-=|+.+
T Consensus       235 iNk~~~~~mk~g~vlVN~a---RG~iide~  261 (336)
T KOG0069         235 INKKFIEKMKDGAVLVNTA---RGAIIDEE  261 (336)
T ss_pred             HHHHHHHHCCCCEEEEECC---CCCCCCHH
T ss_conf             6099998647976999646---42402599


No 86 
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=79.26  E-value=1.6  Score=23.70  Aligned_cols=32  Identities=22%  Similarity=0.251  Sum_probs=18.0

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             44379879999428883578999989863475433
Q gi|255764473|r   40 KPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTI   74 (306)
Q Consensus        40 ~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~   74 (306)
                      .+|+||+|+.+=+-+--|-   -....+.-|.+|+
T Consensus        14 ~~LkgK~iaIIGYGsQG~a---halNlRDSGlnVi   45 (338)
T COG0059          14 DLLKGKKVAIIGYGSQGHA---QALNLRDSGLNVI   45 (338)
T ss_pred             HHHCCCEEEEEECCHHHHH---HHHHHHHCCCCEE
T ss_conf             5654986999902708788---8742242487479


No 87 
>cd05295 MDH_like Malate dehydrogenase-like. These MDH-like proteins are related to other groups in the MDH family but do not have conserved substrate and cofactor binding residues. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subgroup are uncharacterized MDH-like proteins from animals. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=78.13  E-value=2.4  Score=22.55  Aligned_cols=123  Identities=14%  Similarity=0.038  Sum_probs=62.6

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCC---CCCCE----EEEEECHHCCC-C----CCCCHHHHHCCCCCCCCCCCHHHHC
Q ss_conf             01336773046104555543101001---23312----57652000013-2----1000024320133222136646630
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGA---ARFNY----LLNIATPIGSE-P----RNEYLNWARNQGASVALFHDAVQAV  215 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~---~~~g~----~v~~~~P~~~~-~----~~~~~~~~~~~g~~i~~~~d~~eal  215 (306)
                      .+.+.-++|++.|-.+-++.|++..+   ..||.    .+++..-+... .    .-++.+-+-..-.++..++|+++|+
T Consensus       118 ~~~~~Pl~V~VTgAag~iaYsLi~~lasGevFG~d~~i~L~LlDip~~~e~L~Gv~MELeDcAfPlL~~v~~t~d~~~AF  197 (452)
T cd05295         118 RSKINPLQVCITNASAPLCYHLIPSLASGEVFGMEEEISIHLLDSPENLEKLKGLVMEVEDLAFPLLRGISVTTDLDVAF  197 (452)
T ss_pred             HHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHCHHHHHHHHCCCCCCCEEEECCHHHHH
T ss_conf             71588746999468447689999997376734898717999547740778863633567653440017106767999985


Q ss_pred             CCCCCCCC-CCEEECCCCCHHHH-HHCCCCCCCCHHHH-HCCCCCCEEECCC--CCCCCC
Q ss_conf             68733222-10000002201333-10011123368899-6289872992599--987487
Q gi|255764473|r  216 KGAHCVFT-DTWISMNQEFKARE-EHVFQPFQVNLSLM-SMAHPDALFMHCL--PAHRGE  270 (306)
Q Consensus       216 ~~aD~V~~-~~~~~~~~~~~~~~-~~~~~~y~i~~~~l-~~a~~~~~vmHpl--P~~rg~  270 (306)
                      +++|+++. +...+.......+. +.-..-|+.-.+.+ +.|+++++|+=-|  |+|-+-
T Consensus       198 ~dad~ailvga~pr~~gmer~dlL~~n~~IF~~qG~aln~~Ak~~vKVLVvG~nPaNtNa  257 (452)
T cd05295         198 KDAHVIVLLDDFLIKEGEDLEGCIRSRVAICQLYGPLIEKNAKEDVKVIVAGRTFLNLKT  257 (452)
T ss_pred             CCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHH
T ss_conf             579889995884788887188999987799999999998544568669996788651688


No 88 
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=78.12  E-value=1.3  Score=24.19  Aligned_cols=14  Identities=14%  Similarity=0.031  Sum_probs=6.2

Q ss_pred             HHCCCCCCCCHHHH
Q ss_conf             10011123368899
Q gi|255764473|r  238 EHVFQPFQVNLSLM  251 (306)
Q Consensus       238 ~~~~~~y~i~~~~l  251 (306)
                      .+|+.+|+-..+.+
T Consensus       245 ~~~~~~~g~~~~~~  258 (308)
T PRK06129        245 ADYAQRYGPMYERM  258 (308)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999873899999


No 89 
>pfam07991 IlvN Acetohydroxy acid isomeroreductase, catalytic domain. Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine.
Probab=77.90  E-value=1.8  Score=23.33  Aligned_cols=66  Identities=23%  Similarity=0.182  Sum_probs=39.5

Q ss_pred             CCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             36773046104555543101001233125765200001321000024320133222136646630687332221
Q gi|255764473|r  151 VKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTD  224 (306)
Q Consensus       151 l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~  224 (306)
                      +++++|+++|-++ =.|....=+.--|++|.+.--++    ....+.+++.|-++   .+..|+.+++|+|+..
T Consensus         2 lk~k~iaViGYGs-QG~AhAlNLrDSG~~V~vglr~~----s~S~~kA~~dGf~v---~~~~eA~~~aDiim~L   67 (165)
T pfam07991         2 LKGKKIAVIGYGS-QGHAHALNLRDSGVNVIVGLRPG----SKSWEKAKKDGFEV---YTVAEAVKKADVVMIL   67 (165)
T ss_pred             CCCCEEEEEEECC-HHHHHHHHHHHCCCCEEEEECCC----CHHHHHHHHCCCCC---CCHHHHHHHCCEEEEE
T ss_conf             6799899993461-64888723053499789997899----86799999789700---4899998657899983


No 90 
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, 
Probab=77.62  E-value=0.89  Score=25.36  Aligned_cols=119  Identities=17%  Similarity=0.165  Sum_probs=68.8

Q ss_pred             HHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCC
Q ss_conf             64200133677304610455554310100123312-57652000013210000243201332221366466306873322
Q gi|255764473|r  144 FEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY-LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVF  222 (306)
Q Consensus       144 i~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~  222 (306)
                      ..+.+++++++++.++|-+. +....+..+...|. ++.++....    +.....+...|.+..-+.++.+.+.++|+|+
T Consensus       169 a~~~~~~l~~~~vLviGaGe-m~~l~~~~L~~~g~~~i~v~nRt~----~ra~~la~~~g~~~~~~~~l~~~l~~~Dvvi  243 (311)
T cd05213         169 AEKIFGNLKGKKVLVIGAGE-MGELAAKHLAAKGVAEITIANRTY----ERAEELAKELGGNAVPLDELLELLNEADVVI  243 (311)
T ss_pred             HHHHHCCCCCCEEEEECCCH-HHHHHHHHHHHCCCCEEEEECCCH----HHHHHHHHHCCCEEECHHHHHHHHHHCCEEE
T ss_conf             99871872116799986879-999999999965998259976867----8999999974989972999999997689999


Q ss_pred             CCCEEECCCCCHHHHHHCCCCCCCCHHHHHC---CCCCCEEECCCCCCCCCCCCHHHHCCCCCHHH
Q ss_conf             2100000022013331001112336889962---89872992599987487357679679971068
Q gi|255764473|r  223 TDTWISMNQEFKAREEHVFQPFQVNLSLMSM---AHPDALFMHCLPAHRGEEVINEVLDGPQSVVF  285 (306)
Q Consensus       223 ~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~---a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~  285 (306)
                      +-+= +             ..|.++.+.+..   -+|-.+|=-..|  |+  |+.+|.+-|...++
T Consensus       244 saT~-s-------------~~~~~~~~~~~~~~~~~~~~iiDLavP--Rd--id~~v~~l~~v~L~  291 (311)
T cd05213         244 SATG-A-------------PHYAKIVERAMKKRSGKPRLIVDLAVP--RD--IEPEVGELEGVRLY  291 (311)
T ss_pred             EECC-C-------------CCCHHHHHHHHHHCCCCCEEEEEECCC--CC--CCHHHCCCCCEEEE
T ss_conf             9279-9-------------962035999975347997699991799--98--77334776997998


No 91 
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]
Probab=77.62  E-value=5.9  Score=19.99  Aligned_cols=239  Identities=17%  Similarity=0.108  Sum_probs=127.2

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEE-CCCCCHHHHHHHHHHHHCCCCCCCCCCC-----C--
Q ss_conf             7844589999999999999999665236665443798799994-2888357899998986347543333210-----0--
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIF-EKPSTRTRVSFEVAMKHLGGDTIFLSGS-----E--   80 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF-~e~StRTR~SFe~A~~~LG~~~~~~~~~-----~--   80 (306)
                      +++.++.+.+|+.--..---+....+.+...+||+|.+|+.-. .+  .-|-. +--.-+.+|+.|..-+..     +  
T Consensus        10 isla~~Gr~~i~wAe~~MP~L~~iR~~f~~~kPlkG~~i~~~lH~t--~kTAv-LietL~a~GAeV~~a~cNplSTqD~v   86 (420)
T COG0499          10 ISLADEGRKEIEWAEREMPVLMAIREEFAEEKPLKGARIAGCLHMT--AKTAV-LIETLKAGGAEVRWASCNPLSTQDDV   86 (420)
T ss_pred             HHHHHHHHHHHHHHHHHCHHHHHHHHHHHHCCCCCCCEEEEEEEEH--HHHHH-HHHHHHHCCCEEEEECCCCCCCCHHH
T ss_conf             2333554677899986586999999987522897765789987315--87999-99999855856998527887666789


Q ss_pred             -----------CCCCCCCCHHHHHH----HHHH--------CCCEEEEEECCC------------------CHHHHHHCC
Q ss_conf             -----------00123210799999----7530--------010111210132------------------006776301
Q gi|255764473|r   81 -----------MQLGRAETIGDTAK----VLSR--------YVDAIVMRTTNH------------------SRLLELTEY  119 (306)
Q Consensus        81 -----------ss~~kgEsl~Dt~~----~ls~--------~~D~iviR~~~~------------------~~~~~~~~~  119 (306)
                                 .-..|||+.++...    +|+-        ..|++.+=|...                  ..++.+.+.
T Consensus        87 aaAl~~~~GipVfA~kGe~~eeY~~~~~~vl~~~p~iiiDDG~D~~~~vh~~~~~l~~~i~G~tEETTTGV~RL~am~~~  166 (420)
T COG0499          87 AAALAAKEGIPVFAWKGETLEEYYEAIDQVLDWEPNIIIDDGGDLTKLVHLERPELLDAIKGGTEETTTGVHRLRAMEKD  166 (420)
T ss_pred             HHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCCCEEEEEECCCHHHHHHHCCCCCCCCHHHHHHHHHHHC
T ss_conf             99987505961799707878999999999956599879824732021000054878877428775342289999989766


Q ss_pred             --CCCCEECCCCC-------CCHHH-HHHHHHHHHHHHCC-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCC
Q ss_conf             --24412404333-------20246-78765576642001-336773046104555543101001233125765200001
Q gi|255764473|r  120 --ATVPVINALTD-------NTHPC-QIIADIMTFEEHRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGS  188 (306)
Q Consensus       120 --~~vpvINa~~~-------~~HPt-QaL~D~~Ti~e~~g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~  188 (306)
                        ..+|+||--|.       +-|-| |.+.|-.  .+.-+ -+.|++++.+|- +.+.+--...+.-+|++|.+.--.  
T Consensus       167 G~L~fPai~VNDs~tK~~FDNrYGtgqS~~DgI--~RaTn~liaGK~vVV~GY-G~vGrG~A~~~rg~GA~ViVtEvD--  241 (420)
T COG0499         167 GVLKFPAINVNDSVTKSLFDNRYGTGQSLLDGI--LRATNVLLAGKNVVVAGY-GWVGRGIAMRLRGMGARVIVTEVD--  241 (420)
T ss_pred             CCCCCCEEEECCHHHHCCCCCCCCCCHHHHHHH--HHHHCEEECCCEEEEECC-CCCCHHHHHHHHCCCCEEEEEECC--
T ss_conf             973235586043444131456656412489999--864200114866999635-644366999862289869998248--


Q ss_pred             CCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCC
Q ss_conf             32100002432013322213664663068733222100000022013331001112336889962898729925999874
Q gi|255764473|r  189 EPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHR  268 (306)
Q Consensus       189 ~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~r  268 (306)
                       |  -..-.+.-.|..+   ..+++|.+.+|++.|..    +..           =-++.+-+...|+++++---|-  -
T Consensus       242 -P--I~AleA~MdGf~V---~~m~~Aa~~gDifiT~T----Gnk-----------dVi~~eh~~~MkDgaIl~N~GH--F  298 (420)
T COG0499         242 -P--IRALEAAMDGFRV---MTMEEAAKTGDIFVTAT----GNK-----------DVIRKEHFEKMKDGAILANAGH--F  298 (420)
T ss_pred             -C--HHHHHHHHCCCEE---EEHHHHHHCCCEEEECC----CCC-----------CCCCHHHHHHCCCCEEEECCCC--C
T ss_conf             -1--7889986357188---78667442189899866----885-----------7578999972648849962656--4


Q ss_pred             CCCCCHHHHC
Q ss_conf             8735767967
Q gi|255764473|r  269 GEEVINEVLD  278 (306)
Q Consensus       269 g~EI~~~v~d  278 (306)
                      ++||+-..+.
T Consensus       299 d~EI~~~~L~  308 (420)
T COG0499         299 DVEIDVAGLE  308 (420)
T ss_pred             CEEECHHHHH
T ss_conf             0000688888


No 92 
>cd02812 PcrB_like PcrB_like proteins. One member of this family, a protein from Archaeoglobus fulgidus, has been characterized as a (S)-3-O-geranylgeranylglyceryl phosphate synthase (AfGGGPS). AfGGGPS catalyzes the formation of an ether linkage between sn-glycerol-1-phosphate (G1P) and geranylgeranyl diphosphate (GGPP), the committed step in archaeal lipid biosynthesis. Therefore, it has been proposed that PcrB-like proteins are either prenyltransferases or are involved in lipoteichoic acid biosynthesis although the exact function is still unknown.
Probab=77.25  E-value=6  Score=19.93  Aligned_cols=164  Identities=12%  Similarity=0.100  Sum_probs=84.4

Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCC-EEEEEECCC-CHHHHHHCCCC-CCEECCCCCCCH---H
Q ss_conf             99989863475433332100001232107999997530010-111210132-00677630124-412404333202---4
Q gi|255764473|r   61 SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVD-AIVMRTTNH-SRLLELTEYAT-VPVINALTDNTH---P  134 (306)
Q Consensus        61 SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D-~iviR~~~~-~~~~~~~~~~~-vpvINa~~~~~H---P  134 (306)
                      ..+..+.+-|.+.+.++.+...   .+++..+.+.+....+ .-|+=-|.+ ..+..-+...- ..++|+.+..+.   -
T Consensus        16 ~l~~~~~~sgtDai~VGGS~~~---~~~~~~~v~~ik~~~~~~PvilfPg~~~~is~~aDa~lf~sllNs~n~~~lig~~   92 (219)
T cd02812          16 EIAKLAEESGTDAIMVGGSDGV---SSTLDNVVRLIKRIRRPVPVILFPSNPEAVSPGADAYLFPSVLNSGDPYWIIGAQ   92 (219)
T ss_pred             HHHHHHHHHCCCEEEECCCCCC---HHHHHHHHHHHHHHCCCCCEEEECCCHHHCCCCCCEEEEEEEECCCCCHHHHHHH
T ss_conf             9999999769999999375574---4779999999997378999899579866568677868868753389923677889


Q ss_pred             HHHHHHHHHH---HHHC--CC--C-CCCCEEEECCCC-----CCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCC
Q ss_conf             6787655766---4200--13--3-677304610455-----55431010012331257652000013210000243201
Q gi|255764473|r  135 CQIIADIMTF---EEHR--GS--V-KGKLFSWSGDGN-----NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQ  201 (306)
Q Consensus       135 tQaL~D~~Ti---~e~~--g~--l-~~~~i~~vGd~~-----~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~  201 (306)
                      -++.--+-.+   .|..  |.  + .|.++++++...     ..+.+...++..||+.+...--.+-.-+++.+...++.
T Consensus        93 ~~aa~~~~~~~~~~e~ip~gYiv~~~g~~v~~v~~a~~~~~~~~~~ayAlaae~lg~~~iYLEgSGa~v~~e~V~~vk~~  172 (219)
T cd02812          93 AEAAPEVGKIIPWLELIPEGYLVLNPDSTVARVTGAKTDLKPEDAAAYALAAEYLGMPIVYLEYSGAYGPPEVVRAVKKV  172 (219)
T ss_pred             HHHHHHHHHCCCCCCEEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHH
T ss_conf             99999874316763220057899879981488824647999899999999999829938999568997999999999984


Q ss_pred             --------CCCCCCCCCHHHHCC-CCCCCCCCCEE
Q ss_conf             --------332221366466306-87332221000
Q gi|255764473|r  202 --------GASVALFHDAVQAVK-GAHCVFTDTWI  227 (306)
Q Consensus       202 --------g~~i~~~~d~~eal~-~aD~V~~~~~~  227 (306)
                              |..+.-.....+.++ +||.|.+....
T Consensus       173 l~~~~LivGGGIrs~e~a~~~~~AgAD~IVvGn~i  207 (219)
T cd02812         173 LGDTPLIVGGGIRSGEQAKEMAEAGADTIVVGNIV  207 (219)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCCE
T ss_conf             67970999289799999999998699999988722


No 93 
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=77.06  E-value=3.3  Score=21.66  Aligned_cols=75  Identities=20%  Similarity=0.178  Sum_probs=47.1

Q ss_pred             ECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECC
Q ss_conf             4288835789999898634754333321000012321079999975300101112101320067---7630124412404
Q gi|255764473|r   51 FEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINA  127 (306)
Q Consensus        51 F~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa  127 (306)
                      ||+.   -+-.++.|++++|.++.+..+...+..+--  ...-..++..+|+|++-..+...+.   +-+.-..||||.-
T Consensus        14 f~~~---v~~G~~~aA~~~Gv~v~~~~~~~~d~~~Q~--~~i~~~i~~~vDaIii~p~~~~~~~~~i~~a~~agIpVv~~   88 (271)
T cd06312          14 FWTV---VKNGAEDAAKDLGVDVEYRGPETFDVADMA--RLIEAAIAAKPDGIVVTIPDPDALDPAIKRAVAAGIPVISF   88 (271)
T ss_pred             HHHH---HHHHHHHHHHHHCCEEEEEECCCCCHHHHH--HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             8999---999999999996998999968989999999--99999997599989993788300269999999659869999


Q ss_pred             CCC
Q ss_conf             333
Q gi|255764473|r  128 LTD  130 (306)
Q Consensus       128 ~~~  130 (306)
                      -++
T Consensus        89 ds~   91 (271)
T cd06312          89 NAG   91 (271)
T ss_pred             ECC
T ss_conf             478


No 94 
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors, non-NMDA ionotropic receptors which respond to the neurotransmitter glutamate.  While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. Kainate receptors have five subunits, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeri
Probab=76.91  E-value=6.1  Score=19.87  Aligned_cols=111  Identities=14%  Similarity=0.210  Sum_probs=54.4

Q ss_pred             EEEEECCCCC-HHHHHHHHHHHHCCCCCCCCC-----CCCCCCCCCCCHHHHHHHHHHC-CCEEEEEECCC----CHHHH
Q ss_conf             9999428883-578999989863475433332-----1000012321079999975300-10111210132----00677
Q gi|255764473|r   47 LAMIFEKPST-RTRVSFEVAMKHLGGDTIFLS-----GSEMQLGRAETIGDTAKVLSRY-VDAIVMRTTNH----SRLLE  115 (306)
Q Consensus        47 i~~lF~e~St-RTR~SFe~A~~~LG~~~~~~~-----~~~ss~~kgEsl~Dt~~~ls~~-~D~iviR~~~~----~~~~~  115 (306)
                      |+.+|.+++. ..+.+|+.|+.+.-...-.+.     +..-.+....|+.=+.++...+ -++.+|=+|.+    ..+..
T Consensus         2 IGaiF~~~~~~~~e~Af~~Ai~~vN~~~~~l~~~~L~~~i~~~~~~dsF~~~~~~C~~l~~GV~AI~Gp~s~~~~~~v~s   81 (327)
T cd06382           2 IGAIFDDDDDSGEELAFRYAIDRINREKELLANTTLEYDIKRVKPDDSFETTKKVCDLLQQGVAAIFGPSSSEASSIVQS   81 (327)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHH
T ss_conf             68885589975899999999999755876578957999987446698179999999988549389996787237899999


Q ss_pred             HHCCCCCCEECC-CCC-----C-----CHHH-----HHHHHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             630124412404-333-----2-----0246-----78765576642001336773046104
Q gi|255764473|r  116 LTEYATVPVINA-LTD-----N-----THPC-----QIIADIMTFEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus       116 ~~~~~~vpvINa-~~~-----~-----~HPt-----QaL~D~~Ti~e~~g~l~~~~i~~vGd  161 (306)
                      ++....||.|-- .+.     .     -||.     ||++|+..-..+    +...+.|-.|
T Consensus        82 ic~~l~IP~i~~~~~~~~~~~~~~~i~l~P~~~~l~~Ai~dlv~~~~W----~~v~~iY~~d  139 (327)
T cd06382          82 ICDAKEIPHIQTRWDPEPKSNRQFTINLYPSNADLSRAYADIVKSFNW----KSFTIIYESA  139 (327)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHCCC----CEEEEEEECC
T ss_conf             874316852683578655556576388348888999999999986798----4899999684


No 95 
>cd00704 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. MDHs belong to the NAD-dependent, lactate dehydrogenase (LDH)-like, 2-hydroxycarboxylate dehydrogenase family, which also includes the GH4 family of glycoside hydrolases. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=76.03  E-value=3.2  Score=21.74  Aligned_cols=23  Identities=17%  Similarity=0.030  Sum_probs=10.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             475433332100001232107999
Q gi|255764473|r   69 LGGDTIFLSGSEMQLGRAETIGDT   92 (306)
Q Consensus        69 LG~~~~~~~~~~ss~~kgEsl~Dt   92 (306)
                      -|++++.+.++- ....|||-.|.
T Consensus        75 ~~aDvViitaG~-prkpG~tR~DL   97 (323)
T cd00704          75 KDVDVAILVGAF-PRKPGMERADL   97 (323)
T ss_pred             CCCCEEEECCCC-CCCCCCCHHHH
T ss_conf             799889982787-88999827999


No 96 
>PRK06719 precorrin-2 dehydrogenase; Validated
Probab=76.00  E-value=1.5  Score=23.84  Aligned_cols=126  Identities=16%  Similarity=0.120  Sum_probs=63.8

Q ss_pred             HHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             64200133677304610455554310100123312576520000132100002432013322213664663068733222
Q gi|255764473|r  144 FEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       144 i~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                      |.-.+=+++|+++.++|.++ |+--.+..+..+|..+++++|.-.   +++.+..   ...+....=..+.++++++|++
T Consensus         4 ~~Pifl~l~~k~vLVvGGG~-VA~rK~~~Ll~~ga~VtVvsp~~~---~el~~l~---~i~~~~r~~~~~dl~~~~lVia   76 (157)
T PRK06719          4 MYPLMFNLHNKVVVIIGGGK-IAYRKASGLKDTGAFVTVVSPEIC---EEMKELP---YITWKQKTFSNDDIKDAHLIYA   76 (157)
T ss_pred             CCEEEEECCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCCCC---HHHHHCC---CEEEECCCCCHHHHCCCEEEEE
T ss_conf             43068975998799988989-999999999878796999999868---9998455---7088704678468378439998


Q ss_pred             CCEEECCCCCHHHH-HHCCCCCC-CCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHH
Q ss_conf             10000002201333-10011123-368899628987299259998748735767967997106
Q gi|255764473|r  224 DTWISMNQEFKARE-EHVFQPFQ-VNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVV  284 (306)
Q Consensus       224 ~~~~~~~~~~~~~~-~~~~~~y~-i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~  284 (306)
                      -.    ++...... ...-...+ +|..  + -++.+-|.-|-=++|| ++.-.|.-+-+|-.
T Consensus        77 AT----dd~~lN~~i~~~a~~~~lvN~~--d-~~~~~dF~~Paiv~rg-~l~IaIST~G~SP~  131 (157)
T PRK06719         77 AT----NQHAVNMMVKQAAHDFQWVNVV--S-DGTESSFHTPGVIRND-EYVVTISTSGKDPS  131 (157)
T ss_pred             CC----CCHHHHHHHHHHHHHCCCEEEE--C-CCCCCCEEEEEEEEEC-CEEEEEECCCCCCH
T ss_conf             68----9989999999999778958982--8-9888976870389858-97999988998929


No 97 
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=75.85  E-value=4.7  Score=20.59  Aligned_cols=79  Identities=25%  Similarity=0.321  Sum_probs=52.0

Q ss_pred             HHHHCCCCCCCCEEEECC---C--CCCCCC----HHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHH
Q ss_conf             642001336773046104---5--555431----0100123312576520000132100002432013322213664663
Q gi|255764473|r  144 FEEHRGSVKGKLFSWSGD---G--NNILHS----LIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQA  214 (306)
Q Consensus       144 i~e~~g~l~~~~i~~vGd---~--~~v~hS----~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~ea  214 (306)
                      |.++.+ ++|++|++.|=   +  -++.-|    .+..+...|+++..--|...+.       ++.....+.+..++.++
T Consensus       302 i~~~~~-l~Gk~iavlgLafKpnTDD~ReSpa~~vi~~L~~~Ga~V~aYDP~a~~~-------~~~~~~~~~~~~~~~~~  373 (414)
T COG1004         302 ILNHLG-LKGKTIAVLGLAFKPNTDDMRESPALDIIKRLQEKGAEVIAYDPVAMEN-------AFRNFPDVELESDAEEA  373 (414)
T ss_pred             HHHHCC-CCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCEEEEECCHHHHH-------HHHCCCCCEEECCHHHH
T ss_conf             998468-7786799998741699842000317999999997799899978254377-------77307871674899999


Q ss_pred             CCCCCCCCCC-CEEECC
Q ss_conf             0687332221-000000
Q gi|255764473|r  215 VKGAHCVFTD-TWISMN  230 (306)
Q Consensus       215 l~~aD~V~~~-~~~~~~  230 (306)
                      ++++|++..- .|....
T Consensus       374 ~~~aDaivi~tew~ef~  390 (414)
T COG1004         374 LKGADAIVINTEWDEFR  390 (414)
T ss_pred             HHHCCEEEEECCHHHHH
T ss_conf             84098999955579875


No 98 
>PRK07847 amidophosphoribosyltransferase; Provisional
Probab=75.26  E-value=3.8  Score=21.25  Aligned_cols=128  Identities=19%  Similarity=0.277  Sum_probs=76.9

Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHC--CCE-EEEEECCCCH--HHHHHCCCCCCE
Q ss_conf             8835789999898634754333321000012321079999----975300--101-1121013200--677630124412
Q gi|255764473|r   54 PSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTA----KVLSRY--VDA-IVMRTTNHSR--LLELTEYATVPV  124 (306)
Q Consensus        54 ~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~----~~ls~~--~D~-iviR~~~~~~--~~~~~~~~~vpv  124 (306)
                      ++.+.-++||-         +||.-.+|.+. |.++.+.=    +.|+.-  +|+ +|+-.|+.+.  ..-+++.+.+|.
T Consensus       234 ~~~~~~C~FEy---------IYFaRpdS~~~-g~~Vy~~R~~~G~~LA~e~~~~~D~Vi~VPdSg~~aA~gyA~~sgip~  303 (489)
T PRK07847        234 EPTPKGCVFEY---------VYLARPDSTIA-GRSVHAARVEIGRRLAREHPVEADLVIPVPESGTPAAVGYAQESGIPF  303 (489)
T ss_pred             CCCCCCCEEEE---------HHHCCCCCCCC-CEEHHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHCCCCH
T ss_conf             88875415650---------24318971147-818999999999998743788899798569971999999999739954


Q ss_pred             ECCCCC-C------CHHHHHHHHHHHHHHH---CCCCCCCCEEEECCC---CCCCCCHHHCCCCCCEE---EEEECHHCC
Q ss_conf             404333-2------0246787655766420---013367730461045---55543101001233125---765200001
Q gi|255764473|r  125 INALTD-N------THPCQIIADIMTFEEH---RGSVKGKLFSWSGDG---NNILHSLIEGAARFNYL---LNIATPIGS  188 (306)
Q Consensus       125 INa~~~-~------~HPtQaL~D~~Ti~e~---~g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~~---v~~~~P~~~  188 (306)
                      -.+.-. .      =-|+|.+=+.-.=.+.   +..++|++|.+|-|.   +++..+.+..+...|++   +.+++|+-.
T Consensus       304 ~~gliKn~yvgRTFI~p~q~~R~~~v~~Kln~i~~~i~gK~vvlVDDSIVRGtT~k~iv~~Lr~aGAkeVh~riasPpi~  383 (489)
T PRK07847        304 GQGLVKNAYVGRTFIQPSQTIRQLGIRLKLNPLREVIRGKRLVVVDDSIVRGNTQRALVRMLREAGAAEVHVRIASPPVK  383 (489)
T ss_pred             HHCEEECCCCCCCEECCCHHHHHHCCCEEEECCHHEECCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             44200146147401378665666365147740264177987999847835667799999999976998899996899857


Q ss_pred             CCC
Q ss_conf             321
Q gi|255764473|r  189 EPR  191 (306)
Q Consensus       189 ~~~  191 (306)
                      .|.
T Consensus       384 ~PC  386 (489)
T PRK07847        384 WPC  386 (489)
T ss_pred             CCC
T ss_conf             887


No 99 
>PRK05793 amidophosphoribosyltransferase; Provisional
Probab=75.14  E-value=5.9  Score=19.95  Aligned_cols=130  Identities=17%  Similarity=0.251  Sum_probs=75.4

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHH----HHHH-C-CCE-EEEEECCCCH--HHHHHCCCCC
Q ss_conf             2888357899998986347543333210000123210799999----7530-0-101-1121013200--6776301244
Q gi|255764473|r   52 EKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAK----VLSR-Y-VDA-IVMRTTNHSR--LLELTEYATV  122 (306)
Q Consensus        52 ~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~----~ls~-~-~D~-iviR~~~~~~--~~~~~~~~~v  122 (306)
                      .+++.+.-++||-         +||.-.+|.+. |.++.+.=+    .|+. + +|+ +|+-.|+.+.  ..-+++.+.+
T Consensus       246 ~~~~~~~~C~FE~---------IYFaRpdS~i~-g~~Vy~~R~~lG~~LA~e~~~~~DvV~~VPdSg~~aA~gya~~sgi  315 (472)
T PRK05793        246 SEKTKCQTCAFEY---------IYFARPDSVID-GISVYESRVRAGEQLYKEYPVDADIVIGVPDSGIPAAIGYAKASGI  315 (472)
T ss_pred             CCCCCCCCCEEEE---------EECCCCCCEEC-CEEHHHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHCCC
T ss_conf             5888776653765---------20138973047-7089999999999987357888887981799759999999986199


Q ss_pred             CEECCCCC-C------CHHHHHHHHHHHHHH---HCCCCCCCCEEEECCC---CCCCCCHHHCCCCCCEE---EEEECHH
Q ss_conf             12404333-2------024678765576642---0013367730461045---55543101001233125---7652000
Q gi|255764473|r  123 PVINALTD-N------THPCQIIADIMTFEE---HRGSVKGKLFSWSGDG---NNILHSLIEGAARFNYL---LNIATPI  186 (306)
Q Consensus       123 pvINa~~~-~------~HPtQaL~D~~Ti~e---~~g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~~---v~~~~P~  186 (306)
                      |.-.+.-. .      =-|+|.+=+.--=.+   .+..++|++|+.|=|.   +++..-.+..+...|++   +.+++|+
T Consensus       316 p~~~glikn~yvgRTFI~p~q~~R~~~v~~Kln~~~~~v~gK~vvlvDDSIVRGtT~k~iv~~Lr~aGakeVh~ri~sPp  395 (472)
T PRK05793        316 PYGIGFIKNKYVGRTFIAPSQELRERAVRVKLNPLKVNVEGKRVVLIDDSIVRGTTSKRLVESLRRAGAKEVHFRVSSPP  395 (472)
T ss_pred             CHHHHHHHCCCCCCCCCCCCHHHHHHCCCCCEEEEEECCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             43440122052155576886778975146232320210069869998077055767999999999779998999968999


Q ss_pred             CCCCC
Q ss_conf             01321
Q gi|255764473|r  187 GSEPR  191 (306)
Q Consensus       187 ~~~~~  191 (306)
                      -..|.
T Consensus       396 i~~pc  400 (472)
T PRK05793        396 VKYPC  400 (472)
T ss_pred             CCCCC
T ss_conf             68876


No 100
>TIGR01723 hmd_TIGR coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin reductase; InterPro: IPR010062   The N(5),N(10)-methylenetetrahydromethanopterin dehydrogenase system of methanogenic archaea is composed of H2-forming methylenetetrahydromethanopterin dehydrogenase (Hmd, IPR004889 from INTERPRO) and F420-dependent methylenetetrahydromethanopterin dehydrogenase (IPR002844 from INTERPRO) , . Hmd is an iron-sulphur-cluster-free enzyme that contains an intrinsic CO ligand bound to iron . The Hmd enzymes can be divide into two distinct subgroups: one has been experimentally characterised as H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase (Hmd or HmdI), and the other one contains isozymes that have not been experimentally characterised (HmdII and HmdIII). Because all three isozyme forms are present in each of the corresponding sequenced genomes, it has been suggested that HmdII and HmdIII may not exhibit Hmd activity and may have a different biological function .   This entry represents the experimentally characterised (HmdI) subgroup of the N(5),N(10)-methylenetetrahydromethanopterin dehydrogenases.; GO: 0047068 N5N10-methenyltetrahydromethanopterin hydrogenase activity, 0019386 methanogenesis from carbon dioxide.
Probab=75.11  E-value=3.1  Score=21.77  Aligned_cols=91  Identities=12%  Similarity=0.187  Sum_probs=49.1

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCC-CEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEE
Q ss_conf             336773046104555543101001233-1257652000013210000243201332221366466306873322210000
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARF-NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS  228 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~-g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~  228 (306)
                      +++|-.=.+++....+++....-+.|= ..-+++..|+...-           ...+.+++|-.||+++||+|++  |..
T Consensus        93 H~~G~PE~iMP~iRe~V~~~A~elPKPP~gaIH~~~PEe~ed-----------~l~~~vTtDD~EAV~dAD~ii~--WlP  159 (359)
T TIGR01723        93 HLEGNPEDIMPKIREVVNEVAKELPKPPKGAIHFVHPEEMED-----------DLGLKVTTDDREAVEDADIIIT--WLP  159 (359)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCC-----------CCCEEEECCHHHHHCCCCEEEE--ECC
T ss_conf             137885002426689999998507768542061257302214-----------3560561470887507977998--358


Q ss_pred             CCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECC
Q ss_conf             00220133310011123368899628987299259
Q gi|255764473|r  229 MNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHC  263 (306)
Q Consensus       229 ~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHp  263 (306)
                      -|+.-.          .+=.++.+..++.++|-|-
T Consensus       160 KG~~QP----------dI~~K~~D~I~eGaIV~~a  184 (359)
T TIGR01723       160 KGDVQP----------DIIKKFIDDIPEGAIVTHA  184 (359)
T ss_pred             CCCCCH----------HHHHHHHHCCCCCCEECCC
T ss_conf             888862----------6899887417998467056


No 101
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily. Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, the periplasmic xylose-binding protein is homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR.
Probab=75.01  E-value=4.2  Score=20.93  Aligned_cols=68  Identities=26%  Similarity=0.427  Sum_probs=45.2

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECC
Q ss_conf             57899998986347543333210000123210799999753001011121013200---677630124412404
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSR---LLELTEYATVPVINA  127 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa  127 (306)
                      +..-.+|.+++++|..++..+...+ ..+-  +...-..++..+|+|++-..+...   ..+.++...+|||.-
T Consensus        16 ~~~~g~e~~A~e~G~~v~~~~~~~d-~~~Q--~~~i~~lia~~vD~Iii~p~d~~a~~~~l~~a~~agIPVV~~   86 (288)
T cd01538          16 RDRPNFEAALKELGAEVIVQNANGD-PAKQ--ISQIENMIAKGVDVLVIAPVDGEALASAVEKAADAGIPVIAY   86 (288)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCC-HHHH--HHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9999999999976998999718999-9999--999999998499899986775344399999999759999998


No 102
>cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen (N2) to ammonia.  This group contains the beta subunits of component 1 of the three known genetically distinct types of nitrogenase systems: a molybdenum-dependent  nitrogenase (Mo-nitrogenase), a vanadium-dependent nitrogenase (V-nitrogenase), and an iron-only nitrogenase (Fe-nitrogenase). These nitrogenase systems consist of component 1 (MoFe protein, VFe protein or, FeFe protein respectively) and, component 2 (Fe protein). The most widespread and best characterized of these systems is the Mo-nitrogenase. MoFe is an alpha2beta2 tetramer, the alternative nitrogenases are alpha2beta2delta2 hexamers having  alpha and beta subunits similar to the alpha and beta subunits of MoFe. For MoFe, each alphabeta pair contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (Fe
Probab=73.82  E-value=7.3  Score=19.35  Aligned_cols=115  Identities=17%  Similarity=0.083  Sum_probs=55.0

Q ss_pred             HHHCCCCCCCCC-CCC-----------CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCC-CC
Q ss_conf             863475433332-100-----------00123210799999753001011121013200677630124412404333-20
Q gi|255764473|r   66 MKHLGGDTIFLS-GSE-----------MQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD-NT  132 (306)
Q Consensus        66 ~~~LG~~~~~~~-~~~-----------ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~-~~  132 (306)
                      ...+|.++..+. .++           .-...|-+++|..++=+....+.+-+.........+.+...+|.++-... .-
T Consensus       178 l~~~Gl~v~~l~d~s~~ld~~~~~~~~~~~~ggt~~~~i~~~~~A~~ni~~~~~~~~~~a~~L~~~~giP~~~~~~P~G~  257 (428)
T cd01965         178 LEAFGLEPIILPDLSDSLDGHLTDGYSPLTKGGTTLEEIRDAGNAKATIALGEYSGRKAAKALEEKFGVPYILFPTPIGL  257 (428)
T ss_pred             HHHCCCCEEEECCCHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHHCCCEEECCCCCCH
T ss_conf             99849916981571211477666765201689986999986565999999888899999999999859984843776467


Q ss_pred             HHH-----------------------HHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEE
Q ss_conf             246-----------------------787655766420013367730461045555431010012331257652
Q gi|255764473|r  133 HPC-----------------------QIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA  183 (306)
Q Consensus       133 HPt-----------------------QaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~  183 (306)
                      +.|                       +-+.|.+.  +....+.|+++++.||+.. +.++...+.-+|+++..+
T Consensus       258 ~~T~~~l~~la~~~g~~~~~~~~~er~r~~d~~~--d~~~~l~gkrvai~~~~~~-~~~l~~~L~elG~~~~~~  328 (428)
T cd01965         258 KATDEFLRALSKLSGKPIPEELERERGRLLDAML--DSHFYLGGKRVAIAGDPDL-LLGLSRFLLEMGAEPVAA  328 (428)
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH--HHHHHCCCCEEEEECCCHH-HHHHHHHHHHCCCEEEEE
T ss_conf             9999999999998489955999999999999999--9998607978999888188-999999999859956799


No 103
>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems. Periplasmic sugar-binding domain of uncharacterized transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily. The members of this group are predicted to be involved in the transport of sugar-containing molecules across cellular and organellar membranes.
Probab=73.65  E-value=5.7  Score=20.08  Aligned_cols=69  Identities=14%  Similarity=0.140  Sum_probs=45.1

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECC
Q ss_conf             89999898634754333321000012321079999975300101112101320067---7630124412404
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINA  127 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa  127 (306)
                      +--+|.|++++|...+..+....+-...+.+.+....++..+|+|++=..+...+.   +-+....+|||.-
T Consensus        18 ~~Gie~aa~~~~~~~v~v~~~~~~~~d~~~~~~~l~~i~~~vDgiii~~~d~~~~~~~i~~a~~~GIPVV~~   89 (275)
T cd06307          18 AAALEAAAAAFPDARIRVRIHFVESFDPAALAAALLRLGARSDGVALVAPDHPQVRAAVARLAAAGVPVVTL   89 (275)
T ss_pred             HHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             999999998656864999998779899999999999985589889998998177899999999879849997


No 104
>PRK05562 precorrin-2 dehydrogenase; Provisional
Probab=73.15  E-value=2.5  Score=22.45  Aligned_cols=68  Identities=10%  Similarity=0.025  Sum_probs=31.4

Q ss_pred             CCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             677304610455554310100123312576520000132100002432013322213664663068733222
Q gi|255764473|r  152 KGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       152 ~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                      +++++.+||-+. |+.--+..+-+.|+.+++++|.-   .+++.+.++..+..+....=-.+.+++++.|+.
T Consensus        23 ~klkvLVVGGG~-VA~RKi~~Ll~agA~VtVVSP~~---~~el~~L~~~~~I~~i~r~y~~~dL~~~~LVIa   90 (222)
T PRK05562         23 NKIKVLVIGGGK-AAFIKGKTFLKKGCYVEILSKEF---SKEFLDLKKYGNLKLIKGNYDKEFIKDKHLIII   90 (222)
T ss_pred             CCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCCC---CHHHHHHHHCCCEEEEECCCCHHHCCCCCEEEE
T ss_conf             676699999879-99999999987899899987866---889999997598699968679778088739999


No 105
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]
Probab=73.05  E-value=2.3  Score=22.69  Aligned_cols=71  Identities=14%  Similarity=0.047  Sum_probs=42.1

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCC-CCCCCHHHHCCCCCCCCC
Q ss_conf             0133677304610455554310100123312576520000132100002432013322-213664663068733222
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASV-ALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i-~~~~d~~eal~~aD~V~~  223 (306)
                      +=+++|++++++|.++ |+-=.+.++...|.++++++|..   .+++..+++..+... .-..+. +.+.++++|++
T Consensus         7 ~~~l~~k~VlvvGgG~-va~rKa~~ll~~ga~v~Vvs~~~---~~el~~~~~~~~i~~~~~~~~~-~~~~~~~lvia   78 (210)
T COG1648           7 FLDLEGKKVLVVGGGS-VALRKARLLLKAGADVTVVSPEF---EPELKALIEEGKIKWIEREFDA-EDLDDAFLVIA   78 (210)
T ss_pred             EEECCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCCC---CHHHHHHHHHCCCCHHHCCCCH-HHHCCCEEEEE
T ss_conf             9981997799989989-99999999974699799987874---4999999983485310022363-65368249999


No 106
>TIGR00575 dnlj DNA ligase, NAD-dependent; InterPro: IPR001679   DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalyzing the formation of an internucleotide ester bond between phosphate and deoxyribose. It is active during DNA replication, DNA repair and DNA recombination. There are two forms of DNA ligase: one requires ATP (6.5.1.1 from EC), the other NAD (6.5.1.2 from EC).   This family is predominantly composed of NAD-dependent bacterial DNA ligases. They are proteins of about 75 to 85 Kd whose sequence is well conserved , . They also show similarity to yicF, an Escherichia coli hypothetical protein of 63 Kd.; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair.
Probab=73.02  E-value=7.7  Score=19.23  Aligned_cols=53  Identities=17%  Similarity=0.041  Sum_probs=25.1

Q ss_pred             CHHHHHHHHHHHHCCCC-CCCCCCCCCCCCCCCCHHHHHH-------HHHHCCCEEEEEECC
Q ss_conf             35789999898634754-3333210000123210799999-------753001011121013
Q gi|255764473|r   56 TRTRVSFEVAMKHLGGD-TIFLSGSEMQLGRAETIGDTAK-------VLSRYVDAIVMRTTN  109 (306)
Q Consensus        56 tRTR~SFe~A~~~LG~~-~~~~~~~~ss~~kgEsl~Dt~~-------~ls~~~D~iviR~~~  109 (306)
                      .+|..--=...+++|.. |...-..----+.+| +.+..+       -|.+-.|++|+-..+
T Consensus       239 ~~t~~~~L~~L~~~GF~TV~~~~~~~~ln~~~e-V~~~~~~~~~~R~~L~y~IDGvV~Kvd~  299 (706)
T TIGR00575       239 FRTQYEALAWLKKLGFPTVNPHIRLCKLNSIEE-VLEYYEEIEKKRDSLPYEIDGVVVKVDD  299 (706)
T ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHHHCCCCHHH-HHHHHHHHHHHHHCCCCCCCCEEEEECC
T ss_conf             677899999998638842012577630389889-9999999998752078730437898378


No 107
>PRK05479 ketol-acid reductoisomerase; Provisional
Probab=72.99  E-value=2.7  Score=22.20  Aligned_cols=33  Identities=18%  Similarity=0.249  Sum_probs=18.4

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             544379879999428883578999989863475433
Q gi|255764473|r   39 NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTI   74 (306)
Q Consensus        39 ~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~   74 (306)
                      ..+|+||+|+.+=+=+--|-   -....+.-|.+|+
T Consensus        12 l~~lk~k~iaViGYGsQG~A---hAlNLrDSG~~V~   44 (336)
T PRK05479         12 LSLIKGKKVAIIGYGSQGHA---HALNLRDSGVDVV   44 (336)
T ss_pred             HHHHCCCEEEEECCCCHHHH---HHHHHHHCCCCEE
T ss_conf             47877997999752707689---8855374499779


No 108
>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=72.95  E-value=3.9  Score=21.17  Aligned_cols=66  Identities=23%  Similarity=0.296  Sum_probs=46.1

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCC---CHHHHHHCCCCCCEECC
Q ss_conf             8999989863475433332100001232107999997530010111210132---00677630124412404
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNH---SRLLELTEYATVPVINA  127 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~---~~~~~~~~~~~vpvINa  127 (306)
                      .-.++-|++.||-++..+|...+--..   ....-..++..+|+||+-..+.   ....+.++...||||..
T Consensus        19 ~~G~~eaA~~lGw~v~v~D~~g~~~~~---~~~i~~ai~~k~D~Iii~~~D~~~~~~~l~~A~~agIPvv~~   87 (280)
T cd06315          19 GEGVREAAKAIGWNLRILDGRGSEAGQ---AAALNQAIALKPDGIVLGGVDAAELQAELELAQKAGIPVVGW   87 (280)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHH---HHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             889999999759879998899999999---999999996399999999829788789999999879978962


No 109
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=72.76  E-value=4  Score=21.04  Aligned_cols=68  Identities=28%  Similarity=0.329  Sum_probs=44.1

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECCC
Q ss_conf             7899998986347543333210000123210799999753001011121013200---6776301244124043
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSR---LLELTEYATVPVINAL  128 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa~  128 (306)
                      -.-.+|.+++++|..++..+...+.-..-+   ..-..++..+|+|++-..+...   ..+.++...||||...
T Consensus        17 ~~~G~~~~a~~~G~~~~~~~~~~d~~~q~~---~i~~~i~~~vDgIii~p~~~~~~~~~~~~a~~~gIPvv~~d   87 (277)
T cd06319          17 MGRGVKSKAKALGYDAVELSAENSAKKELE---NLRTAIDKGVSGIIISPTNSSAAVTLLKLAAQAKIPVVIAD   87 (277)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHHHH---HHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             999999999972998999769999999999---99999966998799647774110999999997699789986


No 110
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=72.57  E-value=4.3  Score=20.85  Aligned_cols=70  Identities=20%  Similarity=0.280  Sum_probs=45.9

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECCCCC
Q ss_conf             7899998986347543333210000123210799999753001011121013200---677630124412404333
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSR---LLELTEYATVPVINALTD  130 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa~~~  130 (306)
                      -.-.++.+++++|.+++..+... +..+-  +...-..++..+|+|++-..+...   ..+.++...||||.--++
T Consensus        17 ~~~g~~~~a~~~G~~v~~~~~~~-d~~~Q--~~~i~~~i~~~vd~iii~~~d~~~~~~~~~~a~~aGIPVv~~d~~   89 (282)
T cd06318          17 LTEAAKAHAKALGYELISTDAQG-DLTKQ--IADVEDLLTRGVNVLIINPVDPEGLVPAVAAAKAAGVPVVVVDSS   89 (282)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCC-CHHHH--HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             99999999997299999976999-99999--999999997699879981168056699999999779988997377


No 111
>PRK07349 amidophosphoribosyltransferase; Provisional
Probab=72.20  E-value=8  Score=19.11  Aligned_cols=117  Identities=15%  Similarity=0.269  Sum_probs=72.7

Q ss_pred             CCCCCCCCCCCCCCCHHHHHH----HHHH--CCCE-EEEEECCCCH--HHHHHCCCCCCEECCCC-----C-C-CHHHHH
Q ss_conf             333210000123210799999----7530--0101-1121013200--67763012441240433-----3-2-024678
Q gi|255764473|r   74 IFLSGSEMQLGRAETIGDTAK----VLSR--YVDA-IVMRTTNHSR--LLELTEYATVPVINALT-----D-N-THPCQI  137 (306)
Q Consensus        74 ~~~~~~~ss~~kgEsl~Dt~~----~ls~--~~D~-iviR~~~~~~--~~~~~~~~~vpvINa~~-----~-~-~HPtQa  137 (306)
                      +||.-.+|.+ -|.++.+.=+    .|+.  -+|+ +|+-.|+.+.  ..-+++.+.+|.--+.-     + . =-|+|.
T Consensus       275 IYFaRPDS~i-~g~~Vy~~R~~~G~~LA~e~~v~~DiVi~VPdSg~~aA~gya~~sgipy~~glikn~YvgRTFI~p~q~  353 (495)
T PRK07349        275 IYFARPDSRM-HGESLYSYRQRLGQQLAKESPVDADLVIGVPDSGIPAAIGFSQASGIPYAEGLIKNRYVGRTFIQPTQA  353 (495)
T ss_pred             HHHCCCCCEE-CCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHCCCCCHHHHHHCCCCCCCCCCCCHH
T ss_conf             2204775124-781899999999998726068888638978996299999999973997122012045446555187588


Q ss_pred             HHHHHHHHH---HCCCCCCCCEEEECCC---CCCCCCHHHCCCCCCEE---EEEECHHCCCCC
Q ss_conf             765576642---0013367730461045---55543101001233125---765200001321
Q gi|255764473|r  138 IADIMTFEE---HRGSVKGKLFSWSGDG---NNILHSLIEGAARFNYL---LNIATPIGSEPR  191 (306)
Q Consensus       138 L~D~~Ti~e---~~g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~~---v~~~~P~~~~~~  191 (306)
                      +=++-.-.+   .+..++|++|.+|-|.   +++....+..+...|++   +.+++|+-..|.
T Consensus       354 ~R~~~vr~Kln~~~~~i~gK~vvlvDDSIVRGtT~k~iv~~Lr~aGAkeVh~riasPpi~~pC  416 (495)
T PRK07349        354 MRESGIRMKLNPLKDVLAGKRIIIVDDSIVRGTTSRKIVKALRDAGATEVHMRISSPPVTHPC  416 (495)
T ss_pred             HHHHCCCEEEEECHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             876320132013678858985999826605574699999999976998899996899857777


No 112
>PRK07502 cyclohexadienyl dehydrogenase; Validated
Probab=71.89  E-value=2  Score=22.99  Aligned_cols=77  Identities=13%  Similarity=0.113  Sum_probs=33.0

Q ss_pred             HHHHHHHHHCCC--CCCCCCCCCCCCC--CCCCHHHHH-----HHHHHCCCEEEEEECCCCH---HHHHHCCC--CCCEE
Q ss_conf             999989863475--4333321000012--321079999-----9753001011121013200---67763012--44124
Q gi|255764473|r   60 VSFEVAMKHLGG--DTIFLSGSEMQLG--RAETIGDTA-----KVLSRYVDAIVMRTTNHSR---LLELTEYA--TVPVI  125 (306)
Q Consensus        60 ~SFe~A~~~LG~--~~~~~~~~~ss~~--kgEsl~Dt~-----~~ls~~~D~iviR~~~~~~---~~~~~~~~--~vpvI  125 (306)
                      -|+-.|.++-|.  +++-++.+..++.  +..-+.|..     ..+ ..+|++|+=+|.+..   +.++..+.  +.-|.
T Consensus        19 gSlA~alk~~~~~~~I~g~d~~~~~l~~A~~~g~id~~~~~~~e~~-~~~DlIilatPv~~~~~vl~~l~~~l~~~~ivT   97 (307)
T PRK07502         19 SSLARAIRRQGLAGEIVGAARSAETRARARELGLGDRVTTSAAEAV-KGADLVILCVPVGASGAVAAEIAPHLKPGAIVT   97 (307)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCCHHCCCHHHHH-CCCCEEEEECCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             9999999854998579998499999999998699751127776640-458979991789999999999985558996899


Q ss_pred             CCCCCCCHHHHH
Q ss_conf             043332024678
Q gi|255764473|r  126 NALTDNTHPCQI  137 (306)
Q Consensus       126 Na~~~~~HPtQa  137 (306)
                      -.|+-....++.
T Consensus        98 DvgSvK~~I~~~  109 (307)
T PRK07502         98 DVGSVKASVIAA  109 (307)
T ss_pred             ECCCCHHHHHHH
T ss_conf             663211899999


No 113
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=71.84  E-value=2.5  Score=22.42  Aligned_cols=36  Identities=17%  Similarity=0.012  Sum_probs=16.7

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             336773046104555543101001233125765200
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      +++|++++++|-.+.|..--..++++-|.++.+++.
T Consensus        25 dl~g~~~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R   60 (194)
T cd01078          25 DLKGKTAVVLGGTGPVGQRAAVLLAREGARVVLVGR   60 (194)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             867988999858857899999999983997999958


No 114
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Pperiplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=71.20  E-value=5.1  Score=20.41  Aligned_cols=68  Identities=19%  Similarity=0.339  Sum_probs=43.1

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECCCC
Q ss_conf             89999898634754333321000012321079999975300101112101320067---763012441240433
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINALT  129 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa~~  129 (306)
                      .-.+|.+++++|.+++..+.... ..+-  ++..-..++..+|+|++-..+...+.   .-+....+|||...+
T Consensus        19 ~~g~e~~A~~~G~~~~v~~~~~d-~~~q--~~~i~~~i~~~vd~Iii~p~d~~~~~~~i~~a~~agIpVv~~d~   89 (275)
T cd06317          19 NKAFQAAAEEDGVEVIVLDANGD-VARQ--AAQVEDLIAQKVDGIILWPTDGQAYIPGLRKAKQAGIPVVITNS   89 (275)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCC-HHHH--HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             99999999976998999779999-9999--99999999759999999678712457999999986994999768


No 115
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed
Probab=70.78  E-value=2.8  Score=22.13  Aligned_cols=82  Identities=22%  Similarity=0.286  Sum_probs=52.2

Q ss_pred             CCCCCCCCCCC-------CCCCCCCCHHHHHHHHHHC-CCEEEEEECC----CCHHHHHHCCCCCCEECCCC--C-CCHH
Q ss_conf             75433332100-------0012321079999975300-1011121013----20067763012441240433--3-2024
Q gi|255764473|r   70 GGDTIFLSGSE-------MQLGRAETIGDTAKVLSRY-VDAIVMRTTN----HSRLLELTEYATVPVINALT--D-NTHP  134 (306)
Q Consensus        70 G~~~~~~~~~~-------ss~~kgEsl~Dt~~~ls~~-~D~iviR~~~----~~~~~~~~~~~~vpvINa~~--~-~~HP  134 (306)
                      +-+++.+++++       +++.+||..   ++.++.+ +|+.++=--+    ...+....+.++.|+++|=-  . ..-|
T Consensus        75 ~~n~llldaGD~~qGt~~s~l~~g~p~---i~~mN~lgyDa~tlGNHEFD~G~~~l~~~~~~a~fP~LsANi~~~~~g~~  151 (551)
T PRK09558         75 GGSVLLLSGGDINTGVPESDLQDAEPD---FRGMNLIGYDAMAVGNHEFDNPLSVLRKQEKWAKFPFLSANIYQKSTGER  151 (551)
T ss_pred             CCCEEEEECCCCCCCCCCCHHCCCCHH---HHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEEEECCCCCC
T ss_conf             998799958855567746042288079---99986189888977754455787899999852799779866567788981


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             678765576642001336773046104
Q gi|255764473|r  135 CQIIADIMTFEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus       135 tQaL~D~~Ti~e~~g~l~~~~i~~vGd  161 (306)
                         +..-|+|.+    ..|.||+++|=
T Consensus       152 ---~~~py~I~e----~~G~kVGiIGl  171 (551)
T PRK09558        152 ---LFKPYKIFD----VQGLKIAVIGL  171 (551)
T ss_pred             ---CCCCEEEEE----ECCEEEEEEEC
T ss_conf             ---557769999----79969999971


No 116
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent.
Probab=70.42  E-value=2  Score=23.03  Aligned_cols=65  Identities=18%  Similarity=0.120  Sum_probs=38.9

Q ss_pred             CEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             3046104555543101001233125765200001321000024320133222136646630687332221
Q gi|255764473|r  155 LFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTD  224 (306)
Q Consensus       155 ~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~  224 (306)
                      ||+++|- +|+..+++..+.+-|.++.+++...   ++......+..+..+ ...+..++++++|+|+.-
T Consensus         1 KIg~IG~-G~mg~ai~~~l~~~g~~~~~~~~r~---~~~~~~~~~~~~~~~-~~~~~~~~~~~~DvIila   65 (93)
T pfam03807         1 KIGIIGA-GNMGEALARGLAAAGHEVIIANSRN---PEKAAALAEELGVGA-TAVSNEEAAEEADVVILA   65 (93)
T ss_pred             CEEEECC-HHHHHHHHHHHHHCCCCCEEEECCC---HHHHHHHHHHHCCCC-CCCCHHHHHHCCCEEEEE
T ss_conf             9899970-0999999999997799612786487---899999999819976-458999997449989999


No 117
>PRK13403 ketol-acid reductoisomerase; Provisional
Probab=70.29  E-value=3  Score=21.87  Aligned_cols=16  Identities=31%  Similarity=0.299  Sum_probs=10.2

Q ss_pred             CCCCCCEEEEEECCCC
Q ss_conf             4437987999942888
Q gi|255764473|r   40 KPLSGKVLAMIFEKPS   55 (306)
Q Consensus        40 ~~l~gk~i~~lF~e~S   55 (306)
                      .+|++|+|+.+=+=+-
T Consensus        12 ~~lk~k~iaVIGYGsQ   27 (335)
T PRK13403         12 ELLQGKTVAVIGYGSQ   27 (335)
T ss_pred             HHHCCCEEEEEEECCH
T ss_conf             8887997999756707


No 118
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=70.17  E-value=3.4  Score=21.52  Aligned_cols=17  Identities=24%  Similarity=0.300  Sum_probs=7.7

Q ss_pred             HHHCCHHHHHHHHHHHH
Q ss_conf             44589999999999999
Q gi|255764473|r   11 LSNISSSNLSCIIEVAK   27 (306)
Q Consensus        11 ~~dl~~~~i~~ll~~A~   27 (306)
                      +.|.+.+.+....+...
T Consensus        30 l~D~~~e~l~~~~~~i~   46 (289)
T PRK09260         30 LVDISQEQLASAQQEIE   46 (289)
T ss_pred             EEECCHHHHHHHHHHHH
T ss_conf             99799899999999999


No 119
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]
Probab=69.61  E-value=5.9  Score=19.99  Aligned_cols=106  Identities=20%  Similarity=0.192  Sum_probs=60.9

Q ss_pred             HHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCC-EEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             420013367730461045555431010012331-2576520000132100002432013322213664663068733222
Q gi|255764473|r  145 EEHRGSVKGKLFSWSGDGNNILHSLIEGAARFN-YLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       145 ~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g-~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                      ++.+|+++++++.++|-+- +...-+..+..-| ..++++.- .+.   ...+.+++.|..+...+++.+.+.++|+|++
T Consensus       170 ~~~~~~L~~~~vlvIGAGe-m~~lva~~L~~~g~~~i~IaNR-T~e---rA~~La~~~~~~~~~l~el~~~l~~~DvVis  244 (414)
T COG0373         170 KRIFGSLKDKKVLVIGAGE-MGELVAKHLAEKGVKKITIANR-TLE---RAEELAKKLGAEAVALEELLEALAEADVVIS  244 (414)
T ss_pred             HHHHCCCCCCEEEEECCCH-HHHHHHHHHHHCCCCEEEEECC-CHH---HHHHHHHHHCCEEECHHHHHHHHHHCCEEEE
T ss_conf             9983654467699986518-9999999998589877999758-789---9999999838702218778876520799999


Q ss_pred             CCEEECCCCCHHHHHHCCCCCCCCHHHHHCC---CCC-CEEECCCCCCCCCC
Q ss_conf             1000000220133310011123368899628---987-29925999874873
Q gi|255764473|r  224 DTWISMNQEFKAREEHVFQPFQVNLSLMSMA---HPD-ALFMHCLPAHRGEE  271 (306)
Q Consensus       224 ~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a---~~~-~~vmHplP~~rg~E  271 (306)
                      -+        .      -..|.++.+.++.+   ++. .+|==-.|  |++|
T Consensus       245 sT--------s------a~~~ii~~~~ve~a~~~r~~~livDiavP--Rdie  280 (414)
T COG0373         245 ST--------S------APHPIITREMVERALKIRKRLLIVDIAVP--RDVE  280 (414)
T ss_pred             EC--------C------CCCCCCCHHHHHHHHHCCCCEEEEEECCC--CCCC
T ss_conf             06--------9------98554078889988741167599982699--9987


No 120
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=69.38  E-value=3.2  Score=21.71  Aligned_cols=19  Identities=5%  Similarity=0.060  Sum_probs=7.3

Q ss_pred             CCEEEEEECCCCHHHHHHC
Q ss_conf             1011121013200677630
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELTE  118 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~~  118 (306)
                      .|+|..=..+.-.+.++++
T Consensus       112 ~~~IlaSNTSsl~it~la~  130 (288)
T PRK08293        112 EKTIFATNSSTLLPSQFAD  130 (288)
T ss_pred             CCEEEEECCCCCCHHHHHH
T ss_conf             7669986687676579988


No 121
>TIGR01469 cobA_cysG_Cterm uroporphyrin-III C-methyltransferase; InterPro: IPR006366   This domain is found in a family of sequences that represent enzymes, or enzyme domains, with uroporphyrin-III C-methyltransferase activity. This enzyme catalyzes the first step committed to the biosynthesis of either siroheme or cobalamin (vitamin B12) rather than protoheme (heme). Cobalamin contains cobalt while siroheme contains iron. Siroheme is a cofactor for nitrite and sulphite reductases and therefore plays a role in cysteine biosynthesis; many members of this family are CysG, siroheme synthase, with an additional N-terminal domain and with additional oxidation and iron insertion activities.; GO: 0008168 methyltransferase activity, 0006779 porphyrin biosynthetic process.
Probab=69.34  E-value=7.1  Score=19.44  Aligned_cols=13  Identities=23%  Similarity=0.350  Sum_probs=7.1

Q ss_pred             HHCCCCCCCCCCC
Q ss_conf             6306873322210
Q gi|255764473|r  213 QAVKGAHCVFTDT  225 (306)
Q Consensus       213 eal~~aD~V~~~~  225 (306)
                      ++|+.||+|..|+
T Consensus        22 r~L~~ADVvlYD~   34 (242)
T TIGR01469        22 RLLQEADVVLYDR   34 (242)
T ss_pred             HHHHHCCEEEEEC
T ss_conf             9986299789842


No 122
>PRK10936 periplasmic sensory protein associated with the TorRS two-component regulatory system; Provisional
Probab=69.24  E-value=9.2  Score=18.69  Aligned_cols=115  Identities=14%  Similarity=0.101  Sum_probs=64.2

Q ss_pred             CEEEEEECCCC---CH-HHHHHHHHHHHCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCC
Q ss_conf             87999942888---35-78999989863475433332100-001232107999997530010111210132006776301
Q gi|255764473|r   45 KVLAMIFEKPS---TR-TRVSFEVAMKHLGGDTIFLSGSE-MQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEY  119 (306)
Q Consensus        45 k~i~~lF~e~S---tR-TR~SFe~A~~~LG~~~~~~~~~~-ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~  119 (306)
                      -.||.+|-.-+   +. -+--.+.++++||.++..+++.. -...+-  +...-..++..+|+|++=..+...+......
T Consensus        46 ~ki~~~~p~lkd~yW~~v~~G~~~~Ak~lGv~l~v~~a~~~~d~~~Q--~~qie~~i~~~vDAIil~~vd~~a~~~~~~~  123 (340)
T PRK10936         46 WKLCALYPHLKDSYWLSVNYGLVQEAKRLGVDLKVLEAGGYYNLATQ--QQQLEQCVAWGADAILLGAVTPDGPDLQLQA  123 (340)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHH--HHHHHHHHHCCCCEEEECCCCCCCHHHHHHH
T ss_conf             17999806888869999999999999980986999858998899999--9999999975999999867883411568985


Q ss_pred             CCCCEECCCCCCCHH---HHHHHHHHHHHHH--------CCC-CCCCCEEEE-CC
Q ss_conf             244124043332024---6787655766420--------013-367730461-04
Q gi|255764473|r  120 ATVPVINALTDNTHP---CQIIADIMTFEEH--------RGS-VKGKLFSWS-GD  161 (306)
Q Consensus       120 ~~vpvINa~~~~~HP---tQaL~D~~Ti~e~--------~g~-l~~~~i~~v-Gd  161 (306)
                      .++|||..-++...|   +..-.|-+.+-..        .+. =+..+|+|+ |.
T Consensus       124 agIPVI~~dn~i~~~~~~~~vg~dn~~~G~~ag~~la~~~~~~~~~~~Va~l~G~  178 (340)
T PRK10936        124 ANIPVIALVNGIDSPQVTTRVGVSWYQMGYQAGRYLAQWHPKGSGKLNVALLPGP  178 (340)
T ss_pred             CCCCEEEEECCCCCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC
T ss_conf             8997899966777776444884567999999999999973157984399995287


No 123
>PRK09123 amidophosphoribosyltransferase; Provisional
Probab=68.02  E-value=9.7  Score=18.55  Aligned_cols=117  Identities=16%  Similarity=0.275  Sum_probs=70.5

Q ss_pred             CCCCCCCCCCCCCCCHHHHH----HHHHH--CCCE-EEEEECCCCH--HHHHHCCCCCCEECCCC-----C-C-CHHHHH
Q ss_conf             33321000012321079999----97530--0101-1121013200--67763012441240433-----3-2-024678
Q gi|255764473|r   74 IFLSGSEMQLGRAETIGDTA----KVLSR--YVDA-IVMRTTNHSR--LLELTEYATVPVINALT-----D-N-THPCQI  137 (306)
Q Consensus        74 ~~~~~~~ss~~kgEsl~Dt~----~~ls~--~~D~-iviR~~~~~~--~~~~~~~~~vpvINa~~-----~-~-~HPtQa  137 (306)
                      +||.-.+|-+ -|.++.+.=    +.|+.  -+|+ +|+-.|+.+.  ..-+++.+.+|.-.+.-     + . =-|+|.
T Consensus       254 IYFaRpdS~i-~g~~Vy~~R~~~G~~LA~e~~~~~DiVi~VPdSg~~aA~gya~~~gip~~~glikn~yvgRTFI~p~q~  332 (480)
T PRK09123        254 VYFARPDSVV-GGRSVYEVRKNIGRELARESPVDADVVVPVPDSGVPAAIGYAQESGIPFELGIIRNHYVGRTFIQPTQQ  332 (480)
T ss_pred             EECCCCCCEE-CCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCCCHHHCEEECCCCCCCCCCCCHH
T ss_conf             5215798103-694799999999999960079875527756676446789888763996112253124215774388787


Q ss_pred             HHHHHHHHH---HCCCCCCCCEEEECCC---CCCCCCHHHCCCCCCEE---EEEECHHCCCCC
Q ss_conf             765576642---0013367730461045---55543101001233125---765200001321
Q gi|255764473|r  138 IADIMTFEE---HRGSVKGKLFSWSGDG---NNILHSLIEGAARFNYL---LNIATPIGSEPR  191 (306)
Q Consensus       138 L~D~~Ti~e---~~g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~~---v~~~~P~~~~~~  191 (306)
                      +=+...-.+   .+..++|++|.+|-|.   +++....+..+...|++   +.+++|+-..|.
T Consensus       333 ~R~~~v~~Kln~~~~~i~gK~vvlVDDSIVRGtT~k~iv~~Lr~aGAkeVh~ri~sPpi~~pc  395 (480)
T PRK09123        333 IRNLGVKLKHNANRAVIEGKRVVLVDDSIVRGTTSRKIVQMLRDAGAKEVHLRIASPPTTHPC  395 (480)
T ss_pred             HHHHCCEEEEEECCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             776370775640333458982999806615367699999999977998899996899857876


No 124
>PRK13940 glutamyl-tRNA reductase; Provisional
Probab=67.54  E-value=7.2  Score=19.40  Aligned_cols=106  Identities=13%  Similarity=0.140  Sum_probs=58.1

Q ss_pred             HHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCCHHHHHCC-CCCCCCCCCHHHHCCCCCCC
Q ss_conf             64200133677304610455554310100123312-57652000013210000243201-33222136646630687332
Q gi|255764473|r  144 FEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY-LLNIATPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCV  221 (306)
Q Consensus       144 i~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~~~~~~~~-g~~i~~~~d~~eal~~aD~V  221 (306)
                      ..+.+++++++++.++|-+. +..-.+.-+...|. ++.++....    ......+... |.......++.+.+..+|+|
T Consensus       172 a~~~~~~l~~~~vlvvGaGe-m~~l~~k~L~~~g~~~i~v~nRt~----~ra~~la~~~~~~~~~~~~~l~~~l~~aDiv  246 (414)
T PRK13940        172 AKRQLDNISSKNVLIIGAGQ-TGELLFRHVTALAPKQIMLANRTI----EKAQKITSAFRNASAHYLSELPQLIKKADII  246 (414)
T ss_pred             HHHHCCCCCCCEEEEECCCH-HHHHHHHHHHHCCCCEEEEECCCH----HHHHHHHHHHCCCCCCCHHHHHHHHHHCCEE
T ss_conf             99862871228389966864-789999999976998799945756----7799999970888501699999998638879


Q ss_pred             CCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCC
Q ss_conf             22100000022013331001112336889962898729925999874873
Q gi|255764473|r  222 FTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEE  271 (306)
Q Consensus       222 ~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~E  271 (306)
                      ++-+    +          -..|-++.+.++. +|-.+|=-..|  |++|
T Consensus       247 isaT----~----------a~~~ii~~~~~~~-~p~~~iDLavP--Rdid  279 (414)
T PRK13940        247 IAAV----N----------VLEYIVTCKYVGD-KPRVFIDISIP--QALD  279 (414)
T ss_pred             EEEC----C----------CCHHHCCHHHHCC-CCEEEEEECCC--CCCC
T ss_conf             9816----9----------8244404866457-97589984588--8888


No 125
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase. The NAD-binding domain of methylene-tetrahydrofolate dehydrogenase (m-THF DH).  M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. M-THF DH is a component of an unusual monofunctional enzyme; in eukaryotes, m-THF DH is typically found as part of a multifunctional protein.  NADP-dependent m-THF DHs in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofunctional DH, as well as bifunctional DH/cyclodrolase are found. In addition, yeast (S. cerevisiae) also express an monofunctional DH. This family contains only the monofunctional
Probab=67.08  E-value=8.1  Score=19.08  Aligned_cols=92  Identities=15%  Similarity=0.125  Sum_probs=47.2

Q ss_pred             CCHHHHHHHHHHHHHH--------HCC-CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCC--CCCCHHHHH
Q ss_conf             2024678765576642--------001-33677304610455554310100123312576520000132--100002432
Q gi|255764473|r  131 NTHPCQIIADIMTFEE--------HRG-SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEP--RNEYLNWAR  199 (306)
Q Consensus       131 ~~HPtQaL~D~~Ti~e--------~~g-~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~--~~~~~~~~~  199 (306)
                      ..-||-.++=+--+..        ..| +++|++++++|-.+-|..-+..++..-|+.++.+.-.....  .........
T Consensus        31 ~~iPCTP~gv~~LL~~~~i~~~~~~yg~~l~Gk~vvVIGRS~iVGkPla~LL~~~~ATVt~~d~~~~~~~~~~~~~~~~~  110 (197)
T cd01079          31 SILPCTPLAIVKILEFLGIYNKILPYGNRLYGKTITIINRSEVVGRPLAALLANDGARVYSVDINGIQVFTRGESIRHEK  110 (197)
T ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCEEEEECCCCEEEEECCCCCCCEE
T ss_conf             78778699999999971855433235778899989998987315488999997389967750344214640466522124


Q ss_pred             CCCCCCCCCCCHHHHCCCCCCCCCC
Q ss_conf             0133222136646630687332221
Q gi|255764473|r  200 NQGASVALFHDAVQAVKGAHCVFTD  224 (306)
Q Consensus       200 ~~g~~i~~~~d~~eal~~aD~V~~~  224 (306)
                      ..  --....+..+.++.||+|.+-
T Consensus       111 ~~--~~~~~~~~~~~~~~aDIvI~a  133 (197)
T cd01079         111 HH--VTDEEAMTLDCLSQSDVVITG  133 (197)
T ss_pred             EE--ECCCCHHHHHHCCCCCEEEEC
T ss_conf             56--414210056542347999988


No 126
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional
Probab=66.84  E-value=3.9  Score=21.15  Aligned_cols=25  Identities=32%  Similarity=0.525  Sum_probs=16.9

Q ss_pred             CCCCCCCHHHHCCCCCCCCCCCEEECC
Q ss_conf             222136646630687332221000000
Q gi|255764473|r  204 SVALFHDAVQAVKGAHCVFTDTWISMN  230 (306)
Q Consensus       204 ~i~~~~d~~eal~~aD~V~~~~~~~~~  230 (306)
                      .+.++.|-.|++++||+|+|  |...+
T Consensus       128 glkvt~dD~eAV~dAD~iit--WlPkG  152 (345)
T PRK00961        128 GLKVTTDDREAVKDADIVIT--WLPKG  152 (345)
T ss_pred             CCEEECCCHHHHCCCCEEEE--ECCCC
T ss_conf             81553370767447777999--54688


No 127
>pfam02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family. This family contains the bacterial Ornithine cyclodeaminase enzyme EC:4.3.1.12, which catalyses the deamination of ornithine to proline. This family also contains mu-Crystallin the major component of the eye lens in several Australian marsupials, mRNA for this protein has also been found in human retina.
Probab=66.82  E-value=3.5  Score=21.47  Aligned_cols=77  Identities=18%  Similarity=0.144  Sum_probs=45.3

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCCCC-CCE-EEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             0133677304610455554310100123-312-57652000013210000243201332221366466306873322210
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGAAR-FNY-LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~~~-~g~-~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      ...-+..+++++|-+. .+++.++++.. ++. ++.+..+.. .-...+....+..+..+....+++++++++|+|.+-.
T Consensus       124 Lar~da~~l~iiGaG~-QA~~~l~al~~v~~i~~v~v~~r~~-~~~~~f~~~~~~~~~~v~~~~~~~~av~~ADIIvtaT  201 (312)
T pfam02423       124 LAPPDASTLAIIGAGA-QAEFQAEALSAVLPIEEIRIYDRDP-EAAEKFARNLQGKGFEIVACTSAEEAVEGADIVVTVT  201 (312)
T ss_pred             HCCCCCCEEEEECCCH-HHHHHHHHHHHHCCCCEEEEEECCH-HHHHHHHHHHHHCCCCEEEECCHHHHHHCCCEEEEEE
T ss_conf             4169975799964625-3899999999619976899996898-9999999999834996599489999971499899973


Q ss_pred             E
Q ss_conf             0
Q gi|255764473|r  226 W  226 (306)
Q Consensus       226 ~  226 (306)
                      .
T Consensus       202 ~  202 (312)
T pfam02423       202 P  202 (312)
T ss_pred             C
T ss_conf             5


No 128
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=66.77  E-value=10  Score=18.38  Aligned_cols=70  Identities=23%  Similarity=0.295  Sum_probs=42.6

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHH---HHCCCCCCEECCCC
Q ss_conf             7899998986347543333210-000123210799999753001011121013200677---63012441240433
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGS-EMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLE---LTEYATVPVINALT  129 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~-~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~---~~~~~~vpvINa~~  129 (306)
                      -+-.+|.||+++|.+++...+. ..+..+-  ++..-..++..+|+|++-..+...+..   -+....+|||.-.+
T Consensus        17 v~~G~e~aA~~~G~~v~~~~~~~~~d~~~q--~~~i~~~i~~~vDgIii~p~~~~~~~~~l~~a~~~gIPvV~~d~   90 (273)
T cd06310          17 VKAGAEAAAKELGVKVTFQGPASETDVAGQ--VNLLENAIARGPDAILLAPTDAKALVPPLKEAKDAGIPVVLIDS   90 (273)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCHHHH--HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             999999999980998999728997899999--99999999749999999168714479999999984998589803


No 129
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases.
Probab=66.63  E-value=4.1  Score=20.99  Aligned_cols=103  Identities=16%  Similarity=0.085  Sum_probs=58.0

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCC------CCCCCHHHHCCCCCCCCC
Q ss_conf             33677304610455554310100123312576520000132100002432013322------213664663068733222
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASV------ALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i------~~~~d~~eal~~aD~V~~  223 (306)
                      .....+++++|-+. +.-.=+..+..+|..+.+..-..     ..++..+..+.+.      .....+.+.++++|+|+.
T Consensus        17 gv~pa~vvViG~Gv-~G~~A~~~A~~lGa~V~v~D~~~-----~~l~~~~~~~~~~v~~~~~~~~~~l~~~i~~aDvvIg   90 (150)
T pfam01262        17 GVPPAKVVVIGGGV-VGLGAAATAKGLGAPVTILDVRP-----ERLEQLDSLFAEFVETDIFSNCEYLAEAIAEADLVIG   90 (150)
T ss_pred             CCCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEEECCH-----HHHHHHHHHCCCCCCCHHHCCHHHHHHHHHHCCEEEE
T ss_conf             97677799989878-99999999986799899972999-----9999999864762001665379999999743879997


Q ss_pred             CCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCC
Q ss_conf             1000000220133310011123368899628987299259998748
Q gi|255764473|r  224 DTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRG  269 (306)
Q Consensus       224 ~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg  269 (306)
                      .....-.          ..+--|+++.++.+||..++- ..-+..|
T Consensus        91 avl~pg~----------~aP~lIt~~mv~~MkpGsVIV-DvaiDqG  125 (150)
T pfam01262        91 TVLIPGA----------RAPKLVTREMVKTMKPGSVIV-DVAIDQG  125 (150)
T ss_pred             EEECCCC----------CCCCEECHHHHHHHCCCCEEE-EEECCCC
T ss_conf             2031788----------699220799998447993999-9620489


No 130
>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria. TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria. The Tor respiratory system is consists of three proteins (TorC, TorA, and TorD) and is induced in the presence of TMAO. The TMAO control is tightly regulated by three proteins: TorS, TorT, and TorR. Thus, the disruption of any of these proteins can abolish the Tor respiratory induction. TorT shares homology with the sugar-binding domain of the type I periplasmic binding proteins. The members of TorT-like family bind TMAO or related compounds and are predicted to be involved in signal transduction and/or substrate transport.
Probab=66.46  E-value=10  Score=18.41  Aligned_cols=85  Identities=19%  Similarity=0.232  Sum_probs=51.5

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHH--HCCCCCCEECCCCC---C
Q ss_conf             78999989863475433332100-001232107999997530010111210132006776--30124412404333---2
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSE-MQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL--TEYATVPVINALTD---N  131 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~-ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~--~~~~~vpvINa~~~---~  131 (306)
                      -+-..+.|++++|..+..+++.. ....+  =+...-..+...+|+|++-..+...+...  +....+|||..-++   .
T Consensus        17 ~~~Ga~~aA~e~G~~v~~~~~~~~~d~~~--Qi~~ie~~i~~gvDaIii~p~d~~al~~~~~a~~agIPVV~~d~~i~~~   94 (268)
T cd06306          17 VNYGMVEEAKRLGVSLKLLEAGGYPNLAK--QIAQLEDCAAWGADAILLGAVSPDGLNEILQQVAASIPVIALVNDINSP   94 (268)
T ss_pred             HHHHHHHHHHHHCCEEEEEECCCCCCHHH--HHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             99999999999699799995899999999--9999999998399999986798677789999998698299994577875


Q ss_pred             CHHHHHHHHHHHH
Q ss_conf             0246787655766
Q gi|255764473|r  132 THPCQIIADIMTF  144 (306)
Q Consensus       132 ~HPtQaL~D~~Ti  144 (306)
                      ...++.-.|-+..
T Consensus        95 ~~~~~v~~dn~~~  107 (268)
T cd06306          95 DITAKVGVSWYEM  107 (268)
T ss_pred             CCCEEEECCHHHH
T ss_conf             5403675172799


No 131
>PRK08655 prephenate dehydrogenase; Provisional
Probab=65.45  E-value=4.8  Score=20.59  Aligned_cols=91  Identities=10%  Similarity=0.116  Sum_probs=42.9

Q ss_pred             CCCEEEEEECCCCHHH---HHHCCCCC--CEECCCCCCCHHHHHHHHH-------HHHHHHCCC----CCCCCEEEECCC
Q ss_conf             0101112101320067---76301244--1240433320246787655-------766420013----367730461045
Q gi|255764473|r   99 YVDAIVMRTTNHSRLL---ELTEYATV--PVINALTDNTHPCQIIADI-------MTFEEHRGS----VKGKLFSWSGDG  162 (306)
Q Consensus        99 ~~D~iviR~~~~~~~~---~~~~~~~v--pvINa~~~~~HPtQaL~D~-------~Ti~e~~g~----l~~~~i~~vGd~  162 (306)
                      .+|++++=.|-+.+..   +++.+..-  -+.--.+=.+-|.++++..       .-++--||.    +.|..|++|+-.
T Consensus        58 ~advVIvsVPI~~T~~VI~~laP~l~~~~lL~DitSvK~~p~~aMl~~~~~~~~viglHPMFGP~v~sl~gQvVVvcP~~  137 (441)
T PRK08655         58 DGDIVIVSVPINVTEDVIREVAPHVKEGSLLMDVTSVKERPVEAMKEFAPEGVEILPTHPMFGPRTPSLRGQVVILTPTE  137 (441)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHCCCCCCEECCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             49999998488999999999742489996999831041779999997565788774548887999866578889996389


Q ss_pred             C--CCCCCHH-HCCCCCCEEEEEECHHCCC
Q ss_conf             5--5543101-0012331257652000013
Q gi|255764473|r  163 N--NILHSLI-EGAARFNYLLNIATPIGSE  189 (306)
Q Consensus       163 ~--~v~hS~i-~~~~~~g~~v~~~~P~~~~  189 (306)
                      +  +-..+|+ ..+...|+.+..++|+...
T Consensus       138 ~~~~~~~~~l~~~l~~~Ga~v~~~tpeEHD  167 (441)
T PRK08655        138 KRSNPWFPKVRNFLEEEGARVIITTPEEHD  167 (441)
T ss_pred             CCCCHHHHHHHHHHHHCCCEEEECCHHHHH
T ss_conf             877177999999999779889994889986


No 132
>PRK09701 D-allose transporter subunit; Provisional
Probab=65.16  E-value=11  Score=18.17  Aligned_cols=69  Identities=14%  Similarity=0.121  Sum_probs=45.1

Q ss_pred             HHHHHHHHHHHHCCCCCCCCC-CCCCCCCC-CCCHHHHHHHHHHCCCEEEEEECCCCHH---HHHHCCCCCCEECCC
Q ss_conf             578999989863475433332-10000123-2107999997530010111210132006---776301244124043
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLS-GSEMQLGR-AETIGDTAKVLSRYVDAIVMRTTNHSRL---LELTEYATVPVINAL  128 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~-~~~ss~~k-gEsl~Dt~~~ls~~~D~iviR~~~~~~~---~~~~~~~~vpvINa~  128 (306)
                      .-+-.++.|++.+|.++..+. +.+....+ -+-++|   .+...+|+|++-..+...+   .+-+.-..||||+--
T Consensus        41 ~~~~Ga~~aAk~~G~~v~v~~~~~~~D~~~Qi~~Ie~---~I~~gvdaIii~p~d~~a~~~~i~~A~~aGIpVV~~D  114 (311)
T PRK09701         41 DMKKGIEDEAKTLGVSVDIFASPSEGDFQSQLQLFED---LSNKNYKGIAFAPLSSVNLVMPVARAWKKGIYLVNLD  114 (311)
T ss_pred             HHHHHHHHHHHHHCCEEEEEECCCCCCHHHHHHHHHH---HHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEECC
T ss_conf             9999999999986997999927987899999999999---9975999999918987788999999997799189636


No 133
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems. Periplasmic binding domain of ABC-type YtfQ-like transport systems. The YtfQ protein from Escherichia coli is up-regulated under glucose-limited conditions and shares homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily. Members of this group are predicted to be involved in the transport of sugar-containing molecules across cellular and organellar membranes; however their ligand specificity is not determined experimentally.
Probab=65.11  E-value=7.9  Score=19.13  Aligned_cols=67  Identities=21%  Similarity=0.229  Sum_probs=42.4

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECCC
Q ss_conf             899998986347543333210000123210799999753001011121013200---6776301244124043
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSR---LLELTEYATVPVINAL  128 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa~  128 (306)
                      --.+|.+++++|.+++..+.... ..+-  +...-..++..+|+|++-..+...   ....++...+|||.-.
T Consensus        18 ~~gie~~a~~~G~~l~~~~~~~d-~~~q--~~~i~~li~~~vDgIii~p~~~~~~~~~l~~a~~agIPvV~~d   87 (273)
T cd06309          18 TKSIKDAAEKRGFDLKFADAQQK-QENQ--ISAIRSFIAQGVDVIILAPVVETGWDPVLKEAKAAGIPVILVD   87 (273)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCC-HHHH--HHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999976998999769999-9999--9999999975999999805765435899999997499889982


No 134
>TIGR02371 ala_DH_arch alanine dehydrogenase; InterPro: IPR012742   This enzyme, a homologue of bacterial ornithine cyclodeaminases and marsupial mu-crystallins, is a homodimeric NAD-dependent alanine dehydrogenase found in Archaeoglobus fulgidus and several other archaea..
Probab=63.61  E-value=5.1  Score=20.39  Aligned_cols=113  Identities=15%  Similarity=0.208  Sum_probs=56.1

Q ss_pred             CCCCEEEECCCCCCCCCHHHCCCC-CCE---EEEEECHHCCCCCCCCHHHHH-CCCCCCCCCCCHHHHCCCCCCCCCCC-
Q ss_conf             677304610455554310100123-312---576520000132100002432-01332221366466306873322210-
Q gi|255764473|r  152 KGKLFSWSGDGNNILHSLIEGAAR-FNY---LLNIATPIGSEPRNEYLNWAR-NQGASVALFHDAVQAVKGAHCVFTDT-  225 (306)
Q Consensus       152 ~~~~i~~vGd~~~v~hS~i~~~~~-~g~---~v~~~~P~~~~~~~~~~~~~~-~~g~~i~~~~d~~eal~~aD~V~~~~-  225 (306)
                      +...+.++|.++ =+.-.++++++ |..   +++-..++   ..++++..+. ..+.-+..+.++.|.+.+.|++.|.. 
T Consensus       128 dssv~G~iGaG~-QA~tQL~Al~rVfd~eeV~~y~rt~~---~~~kF~~~~skd~~~~~~a~~~p~E~v~~cDilVTtTP  203 (327)
T TIGR02371       128 DSSVLGLIGAGR-QAYTQLEALSRVFDLEEVKVYSRTKE---AAEKFVKRASKDYEVPVRAATDPAEKVEDCDILVTTTP  203 (327)
T ss_pred             CCCEEEEEECCH-HHHHHHHHHHHHCCCCEEEEEECCHH---HHHHHHHHHHCCCCCCEEECCCCHHHHCCCCEEEEECC
T ss_conf             663355763685-79999999876255450699861768---89999987520246512421267477707867998568


Q ss_pred             ---------EEECCCCCHHHHHHCCCCCCCCHHHHHCCC---CCCE-EECCCCCCC
Q ss_conf             ---------000002201333100111233688996289---8729-925999874
Q gi|255764473|r  226 ---------WISMNQEFKAREEHVFQPFQVNLSLMSMAH---PDAL-FMHCLPAHR  268 (306)
Q Consensus       226 ---------~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~---~~~~-vmHplP~~r  268 (306)
                               |.+.|.--..---+.--+=-+|-++|+++|   ++.. =.|-|=+|.
T Consensus       204 sRkPvVkA~WV~eGTHInAiGADapGKqELDpeiLk~aki~vDdleQA~HsGEiNV  259 (327)
T TIGR02371       204 SRKPVVKADWVEEGTHINAIGADAPGKQELDPEILKKAKIVVDDLEQAKHSGEINV  259 (327)
T ss_pred             CCCCEEEEECCCCCCCEEEECCCCCCCCCCCHHHHHCCCEEEECHHHCCCCCEEEE
T ss_conf             98960754225988825510578888310036876327068851332001764710


No 135
>pfam01861 DUF43 Protein of unknown function DUF43. This family includes archaebacterial proteins of unknown function. All the members are 350-400 amino acids long.
Probab=62.60  E-value=12  Score=17.87  Aligned_cols=51  Identities=22%  Similarity=0.300  Sum_probs=28.0

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEEC
Q ss_conf             202467876557664200133677304610455554310100123312576520
Q gi|255764473|r  131 NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIAT  184 (306)
Q Consensus       131 ~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~  184 (306)
                      ..-|--++.=+.-|. .+|++.|++|..+||.-  +-|+..++..++.++.++-
T Consensus        24 ~~T~ET~v~Ra~l~~-~rgdL~Gk~iL~vGDDD--LtSlA~al~~~p~~I~VvD   74 (243)
T pfam01861        24 FVTPETTVARVALMY-SRGDLEGKEILVLGDDD--LTSLAAALTGLPKRIAVVD   74 (243)
T ss_pred             CCCHHHHHHHHHHHH-HCCCCCCCEEEEECCCC--HHHHHHHHCCCCCEEEEEE
T ss_conf             316288999999998-73885798799972861--8789999648985489996


No 136
>PRK08525 amidophosphoribosyltransferase; Provisional
Probab=62.43  E-value=12  Score=17.85  Aligned_cols=116  Identities=15%  Similarity=0.199  Sum_probs=68.6

Q ss_pred             CCCCCCCCCCCCCCCHHHHHH----HHHHC--CCE-EEEEECCCCH--HHHHHCCCCCCEECCCC-----C-C-CHHHHH
Q ss_conf             333210000123210799999----75300--101-1121013200--67763012441240433-----3-2-024678
Q gi|255764473|r   74 IFLSGSEMQLGRAETIGDTAK----VLSRY--VDA-IVMRTTNHSR--LLELTEYATVPVINALT-----D-N-THPCQI  137 (306)
Q Consensus        74 ~~~~~~~ss~~kgEsl~Dt~~----~ls~~--~D~-iviR~~~~~~--~~~~~~~~~vpvINa~~-----~-~-~HPtQa  137 (306)
                      +||.-.+|.+ .|.++.+.=+    .|+.-  ++. +|+=.|+.+.  ..-+++.+.+|.-.+.-     + . -.|+|.
T Consensus       243 iYfarpdS~~-~g~~Vy~~R~~~G~~La~~~~v~~D~Vi~VPdsg~~~a~gya~~~~ip~~~~likn~y~gRtFI~p~q~  321 (445)
T PRK08525        243 IYFARPDSIV-EGKNVYEVRKKMGEELAKKFAVKADFVVPVPDSGVSAAIGYAQESGIPFEMAIVRNHYVGRTFIEPTQE  321 (445)
T ss_pred             EECCCCCCEE-CCEEHHHHHHHHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCHH
T ss_conf             1125786103-780899999999999862568678817865898578899999982994555312220026301488544


Q ss_pred             HHHHHHHHHHC----CCCCCCCEEEECCC---CCCCCCHHHCCCCCCEE---EEEECHHCCCCC
Q ss_conf             76557664200----13367730461045---55543101001233125---765200001321
Q gi|255764473|r  138 IADIMTFEEHR----GSVKGKLFSWSGDG---NNILHSLIEGAARFNYL---LNIATPIGSEPR  191 (306)
Q Consensus       138 L~D~~Ti~e~~----g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~~---v~~~~P~~~~~~  191 (306)
                      +-+.-. +.++    ..++|++|.+|-|.   +++....+..+...|++   +.+++|+--.|.
T Consensus       322 ~R~~~v-~~Klnp~~~~i~gK~vvlvDDSIVRGtT~k~ii~~Lr~aGakeVh~~i~sPpi~~pC  384 (445)
T PRK08525        322 MRNLKV-KLKLNPMRKVLEGKRIVVIDDSIVRGTTSKKIVSLLRAAGASEIHMAIACPEIKFPC  384 (445)
T ss_pred             HHHHHH-CCCEEEHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             556532-323002345217986999817615577899999999977998899996899968886


No 137
>COG0565 LasT rRNA methylase [Translation, ribosomal structure and biogenesis]
Probab=61.97  E-value=8.9  Score=18.79  Aligned_cols=20  Identities=15%  Similarity=0.192  Sum_probs=9.1

Q ss_pred             CCCCCHHHHCCCCCCCCCCC
Q ss_conf             21366466306873322210
Q gi|255764473|r  206 ALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       206 ~~~~d~~eal~~aD~V~~~~  225 (306)
                      .++++++|++.+.|+|+.+.
T Consensus        61 ~i~~tL~eAl~d~~~v~aTt   80 (242)
T COG0565          61 KIVDTLEEALADCDLVVATT   80 (242)
T ss_pred             EEECCHHHHHCCCCEEEEEC
T ss_conf             66467999960788799805


No 138
>TIGR00644 recJ single-stranded-DNA-specific exonuclease RecJ; InterPro: IPR004610 All proteins in this family are 5'-3' single-strand DNA exonucleases. These proteins are used in some aspects of mismatch repair, recombination, and recombinational repair. RecJ is a single-stranded DNA-specific endonuclease which is required for many types of recombination events, although the stringency of the requirement for RecJ appears to vary with the type of recombinational event monitored, and the other recombination gene products which are available.; GO: 0008409 5'-3' exonuclease activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=61.61  E-value=4.6  Score=20.67  Aligned_cols=96  Identities=20%  Similarity=0.184  Sum_probs=55.4

Q ss_pred             CCH-HHHHHHHHHHHHHHCC-C-CCCCCEEEECCC---CCCCCC-HHHCCCCCC--EEEEEECH----HCCCCCCCCHHH
Q ss_conf             202-4678765576642001-3-367730461045---555431-010012331--25765200----001321000024
Q gi|255764473|r  131 NTH-PCQIIADIMTFEEHRG-S-VKGKLFSWSGDG---NNILHS-LIEGAARFN--YLLNIATP----IGSEPRNEYLNW  197 (306)
Q Consensus       131 ~~H-PtQaL~D~~Ti~e~~g-~-l~~~~i~~vGd~---~~v~hS-~i~~~~~~g--~~v~~~~P----~~~~~~~~~~~~  197 (306)
                      +.| |-+-|.||.---+... - -++-+|++.||+   +-+.=+ +++.+..||  ..+.+..|    ++|.|.++....
T Consensus        30 ~l~~~p~~l~dm~kAv~ri~~A~~~~eki~i~GDyDvDGiTSt~~l~~~L~~lGp~~~~~~~IPnR~~egYG~~~~~~~~  109 (705)
T TIGR00644        30 HLHDPPFLLKDMEKAVERIIEAIENNEKILIFGDYDVDGITSTAILVEFLRELGPYVQVDYYIPNRFTEGYGLSPEALRE  109 (705)
T ss_pred             CCCCCCHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHH
T ss_conf             88787021143689999999999728938999617522689999999999950997324666266357777889899999


Q ss_pred             HHCCCCCCCCCCCH-HHH--------CCCCCCCCCCCE
Q ss_conf             32013322213664-663--------068733222100
Q gi|255764473|r  198 ARNQGASVALFHDA-VQA--------VKGAHCVFTDTW  226 (306)
Q Consensus       198 ~~~~g~~i~~~~d~-~ea--------l~~aD~V~~~~~  226 (306)
                      +...|.++.++=|- ..+        -.+.|||.||=-
T Consensus       110 ~~~~G~~LiiTVD~Gi~a~~e~~~a~~~G~dVIVtDHH  147 (705)
T TIGR00644       110 LKENGVSLIITVDNGISAHEEIEYAKELGIDVIVTDHH  147 (705)
T ss_pred             HHHCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             98669839998268742699999998669819997256


No 139
>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs. Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs from other bacteria. They are a member of the type I periplasmic binding protein superfamily which consists of two domains connected by a three-stranded hinge. TmGBP is specific for glucose and its binding pocket is buried at the interface of the two domains. TmGBP also exhibits high thermostability and the highest structural similarity to E. coli glucose binding protein (ecGBP).
Probab=61.31  E-value=12  Score=18.07  Aligned_cols=71  Identities=17%  Similarity=0.238  Sum_probs=42.7

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHH---HHHCCCCCCEECCCCC
Q ss_conf             5789999898634754333321000012321079999975300101112101320067---7630124412404333
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLL---ELTEYATVPVINALTD  130 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~---~~~~~~~vpvINa~~~  130 (306)
                      .-+-.++.|++.+|.++..+.+.+.+..+-  ++..-..++..+|+|++-..+...+.   +-+. ..+|||.-.++
T Consensus        15 ~v~~G~~~aA~e~Gv~v~~~~~~~~d~~~Q--~~~i~~~i~~~vDaIii~p~d~~~~~~~~~~a~-agIpVv~~d~~   88 (271)
T cd06314          15 IAEAGVKAAGKELGVDVEFVVPQQGTVNAQ--LRMLEDLIAEGVDGIAISPIDPKAVIPALNKAA-AGIKLITTDSD   88 (271)
T ss_pred             HHHHHHHHHHHHHCCEEEEEECCCCCHHHH--HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHH-CCCCEEEEECC
T ss_conf             999999999998599899996899999999--999999997599999992687455699999996-59988998078


No 140
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents glutamyl-tRNA reductase (1.2.1.70 from EC), which reduces glutamyl-tRNA to glutamate-1-semialdehyde during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme required NADPH as a coenzyme.; GO: 0008883 glutamyl-tRNA reductase activity, 0050661 NADP binding, 0033014 tetrapyrrole biosynthetic process.
Probab=61.09  E-value=6.3  Score=19.78  Aligned_cols=114  Identities=23%  Similarity=0.150  Sum_probs=61.5

Q ss_pred             HHHCCC--CCCCCEEEECCCCCCCCCHHHCCCCCC-EEEEEECHHCCCCCCCCHHHHHCCCC-C-CCCC----CCHHHHC
Q ss_conf             420013--367730461045555431010012331-25765200001321000024320133-2-2213----6646630
Q gi|255764473|r  145 EEHRGS--VKGKLFSWSGDGNNILHSLIEGAARFN-YLLNIATPIGSEPRNEYLNWARNQGA-S-VALF----HDAVQAV  215 (306)
Q Consensus       145 ~e~~g~--l~~~~i~~vGd~~~v~hS~i~~~~~~g-~~v~~~~P~~~~~~~~~~~~~~~~g~-~-i~~~----~d~~eal  215 (306)
                      ++.||+  |+++|+.++|=+. ++.=.+..+...| .++.++.- .+.=   ..+.++.-+. . +...    +++.+++
T Consensus       175 ~~ifG~erL~~~~~LliGAGe-Mg~Lva~~L~~~~v~~~~i~NR-t~~r---A~~LA~e~~~P~~~~f~~La~~~L~~~L  249 (436)
T TIGR01035       175 EKIFGSERLKGKKVLLIGAGE-MGELVAKHLREKGVGKVLIANR-TYER---AEKLAKELGGPEAVKFEALALEKLEEAL  249 (436)
T ss_pred             HHHHCCCCCCCCEEEEEECCH-HHHHHHHHHHHCCCCEEEEECC-CHHH---HHHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             987256211664189982745-7999999996489528988556-7789---9999987078664544455489999997


Q ss_pred             CCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCC----------CCCCEEECCCCCCCCCCCCHHHHCCCC
Q ss_conf             687332221000000220133310011123368899628----------987299259998748735767967997
Q gi|255764473|r  216 KGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMA----------HPDALFMHCLPAHRGEEVINEVLDGPQ  281 (306)
Q Consensus       216 ~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a----------~~~~~vmHplP~~rg~EI~~~v~d~~~  281 (306)
                      +.+|+|++=+    +.          ..|-|+.+.++.+          .|-.+|==-.|  |+  |+.+|-+=|.
T Consensus       250 ~~~DivissT----gA----------~~pi~~~~~~e~a~~~Rr~de~~~pl~~~DIAvP--Rd--vd~~v~~L~~  307 (436)
T TIGR01035       250 AEADIVISST----GA----------PEPIVSKEDVERALKERRRDEAARPLFIVDIAVP--RD--VDPEVAKLEG  307 (436)
T ss_pred             HHCCEEEEEC----CC----------CCCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCC--CC--CCHHHHCCCC
T ss_conf             4288999855----76----------5310020348999997222001588699975889--98--6378622296


No 141
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=60.91  E-value=11  Score=18.10  Aligned_cols=68  Identities=16%  Similarity=0.131  Sum_probs=43.8

Q ss_pred             HHHHHHHHHHCCCC-----CCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECCCC
Q ss_conf             89999898634754-----3333210000123210799999753001011121013200---67763012441240433
Q gi|255764473|r   59 RVSFEVAMKHLGGD-----TIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSR---LLELTEYATVPVINALT  129 (306)
Q Consensus        59 R~SFe~A~~~LG~~-----~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa~~  129 (306)
                      +-..+.+++++|..     ++.+++....-..-+-++   ..++..+|+|++=..+...   ..+-++...||||.--.
T Consensus        18 ~~~~~~~a~~~g~~~~~v~~~~~da~~D~~~Q~~~ie---~lI~qgvDaIiv~p~d~~a~~~~v~~a~~aGIpVV~~D~   93 (274)
T cd06311          18 VWHAQAAAKKLEAAYPDVEFILVTASNDTEQQNAQQD---LLINRKIDALVILPFESAPLTQPVAKAKKAGIFVVVVDR   93 (274)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHH---HHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             9999999998276468927999718999999999999---999749999999579778889999999986997999788


No 142
>PRK07272 amidophosphoribosyltransferase; Provisional
Probab=60.68  E-value=13  Score=17.65  Aligned_cols=130  Identities=21%  Similarity=0.215  Sum_probs=77.0

Q ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHH--CCCE-EEEEECCCCH--HHHHHCCCCC
Q ss_conf             288835789999898634754333321000012321079999----97530--0101-1121013200--6776301244
Q gi|255764473|r   52 EKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTA----KVLSR--YVDA-IVMRTTNHSR--LLELTEYATV  122 (306)
Q Consensus        52 ~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~----~~ls~--~~D~-iviR~~~~~~--~~~~~~~~~v  122 (306)
                      .+++....++||-         +||.-.+|.+ .|.++.+.=    +.|+.  -+|+ +|+=.|+.+.  ..-+++.+.+
T Consensus       240 ~~~~~~~~C~FEy---------IYFaRpdS~i-~g~~Vy~~R~~~G~~LA~e~~~~~DvVi~VPdSg~~aA~Gya~~~gi  309 (484)
T PRK07272        240 TDETQLAICSMEY---------IYFARPDSTI-HGVNVHTARKRMGKRLAQEFPVDADIVIGVPNSSLSAASGYAEESGL  309 (484)
T ss_pred             CCCCCCCCCEEEE---------EECCCCCCEE-CCEEHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             7999887453442---------1116798138-78689999999999998357877872500788538999999987299


Q ss_pred             CEECCCC-----C-C-CHHHHHHHHHHHHHH---HCCCCCCCCEEEECC---CCCCCCCHHHCCCCCCEE---EEEECHH
Q ss_conf             1240433-----3-2-024678765576642---001336773046104---555543101001233125---7652000
Q gi|255764473|r  123 PVINALT-----D-N-THPCQIIADIMTFEE---HRGSVKGKLFSWSGD---GNNILHSLIEGAARFNYL---LNIATPI  186 (306)
Q Consensus       123 pvINa~~-----~-~-~HPtQaL~D~~Ti~e---~~g~l~~~~i~~vGd---~~~v~hS~i~~~~~~g~~---v~~~~P~  186 (306)
                      |.--+.-     + . =-|+|.+-+.--=.+   .+..++|++|.+|-|   -+++....+..+...|++   +.+++|+
T Consensus       310 p~~~glikn~yvgRTFI~p~q~~R~~~v~~Kln~~~~~i~gK~vvlVDDSIVRGtT~k~iv~~Lr~aGAkeVh~rissPp  389 (484)
T PRK07272        310 PYEMGLVKNQYVARTFIQPTQELREQGVRMKLSAVSGVVKGKRVVMVDDSIVRGTTSRRIVKLLKEAGAKEVHVRIASPE  389 (484)
T ss_pred             CHHCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             51105145031134578996788887363401025455379759998254112675999999999779988999968998


Q ss_pred             CCCCC
Q ss_conf             01321
Q gi|255764473|r  187 GSEPR  191 (306)
Q Consensus       187 ~~~~~  191 (306)
                      --.|.
T Consensus       390 i~~pc  394 (484)
T PRK07272        390 LKYPC  394 (484)
T ss_pred             CCCCC
T ss_conf             57875


No 143
>PRK06545 prephenate dehydrogenase; Validated
Probab=60.49  E-value=6  Score=19.94  Aligned_cols=19  Identities=21%  Similarity=0.162  Sum_probs=10.6

Q ss_pred             CCCEEEEEECCCCHHHHHH
Q ss_conf             0101112101320067763
Q gi|255764473|r   99 YVDAIVMRTTNHSRLLELT  117 (306)
Q Consensus        99 ~~D~iviR~~~~~~~~~~~  117 (306)
                      -.|++|+=+|.......+.
T Consensus        60 ~~DlVvlatPv~~~~~~l~   78 (357)
T PRK06545         60 EADLIVLAVPVDATAALLA   78 (357)
T ss_pred             CCCEEEECCCHHHHHHHHH
T ss_conf             7999999499999999999


No 144
>COG1609 PurR Transcriptional regulators [Transcription]
Probab=60.09  E-value=14  Score=17.58  Aligned_cols=161  Identities=14%  Similarity=0.173  Sum_probs=91.2

Q ss_pred             HCCHHHHHHHHHHHHHHHHHHHCCCCCCCCC---CCEEEEEECCCCC----HHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             5899999999999999996652366654437---9879999428883----57899998986347543333210000123
Q gi|255764473|r   13 NISSSNLSCIIEVAKKIKNSSENIFENKPLS---GKVLAMIFEKPST----RTRVSFEVAMKHLGGDTIFLSGSEMQLGR   85 (306)
Q Consensus        13 dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~---gk~i~~lF~e~St----RTR~SFe~A~~~LG~~~~~~~~~~ss~~k   85 (306)
                      ..+.+.-+.+++.++++--.+...  .+.|+   -++|++++..-+.    ......+.++.+.|.+++......    .
T Consensus        26 ~Vs~eTr~rV~~a~~elgY~pn~~--Ar~L~~~~s~~Ig~i~p~~~~~~~~~i~~gi~~~~~~~gy~~~l~~~~~----~   99 (333)
T COG1609          26 YVSEETREKVLAAIKELGYRPNAV--ARSLRTGRTKTIGLVVPDITNPFFAEILKGIEEAAREAGYSLLLANTDD----D   99 (333)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCHH--HHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC----C
T ss_conf             879999999999999978998989--9998747788899994687775899999999999998399899983789----8


Q ss_pred             CCCHHHHHHHH-HHCCCEEEEEEC-CCCHHHHHHCCCCCCEECCCCC---CCHHHHHHHHHHHHH---HHCCCCCCCCEE
Q ss_conf             21079999975-300101112101-3200677630124412404333---202467876557664---200133677304
Q gi|255764473|r   86 AETIGDTAKVL-SRYVDAIVMRTT-NHSRLLELTEYATVPVINALTD---NTHPCQIIADIMTFE---EHRGSVKGKLFS  157 (306)
Q Consensus        86 gEsl~Dt~~~l-s~~~D~iviR~~-~~~~~~~~~~~~~vpvINa~~~---~~HPtQaL~D~~Ti~---e~~g~l~~~~i~  157 (306)
                      .|..++....+ +..+|++++=.. .+....++.....+|++-.+..   ..+|+=..-|..-.+   ++.-..-..+|+
T Consensus       100 ~~~e~~~~~~l~~~~vdGiIi~~~~~~~~~~~~l~~~~~P~V~i~~~~~~~~~~~V~~Dn~~~~~~a~~~L~~~G~~~i~  179 (333)
T COG1609         100 PEKEREYLETLLQKRVDGLILLGERPNDSLLELLAAAGIPVVVIDRSPPGLGVPSVGIDNFAGAYLATEHLIELGHRRIA  179 (333)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             69999999999876989899935878808899998659998999376777789779709899999999999987998599


Q ss_pred             EECCCC--CCC----CCHHHCCCCCCEE
Q ss_conf             610455--554----3101001233125
Q gi|255764473|r  158 WSGDGN--NIL----HSLIEGAARFNYL  179 (306)
Q Consensus       158 ~vGd~~--~v~----hS~i~~~~~~g~~  179 (306)
                      ++|...  .+.    ..+..++...|..
T Consensus       180 ~i~~~~~~~~~~~R~~Gf~~al~~~~~~  207 (333)
T COG1609         180 FIGGPLDSSASRERLEGYRAALREAGLP  207 (333)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9967987721899999999999975999


No 145
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]
Probab=59.51  E-value=14  Score=17.52  Aligned_cols=94  Identities=18%  Similarity=0.206  Sum_probs=47.4

Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHH--HHHCCCEEEEEECCCCHHHHHHC---CCCCCEECCCC-CC-CH
Q ss_conf             99989863475433332100001232107999997--53001011121013200677630---12441240433-32-02
Q gi|255764473|r   61 SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKV--LSRYVDAIVMRTTNHSRLLELTE---YATVPVINALT-DN-TH  133 (306)
Q Consensus        61 SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~--ls~~~D~iviR~~~~~~~~~~~~---~~~vpvINa~~-~~-~H  133 (306)
                      ++...+.++|++|.-.|.+       |..-++++.  ....+. +-.|+.   ..++++.   .-++ |+++.= -| .+
T Consensus        72 ~Lse~mAr~Ga~VtgiD~s-------e~~I~~Ak~ha~e~gv~-i~y~~~---~~edl~~~~~~FDv-V~cmEVlEHv~d  139 (243)
T COG2227          72 ILSEPLARLGASVTGIDAS-------EKPIEVAKLHALESGVN-IDYRQA---TVEDLASAGGQFDV-VTCMEVLEHVPD  139 (243)
T ss_pred             HHHHHHHHCCCEEEEECCC-------HHHHHHHHHHHHHCCCC-CCCHHH---HHHHHHHCCCCCCE-EEEHHHHHCCCC
T ss_conf             8649999779946974387-------67789998754424632-252233---29999724897448-977358771699


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHC
Q ss_conf             467876557664200133677304610455554310100
Q gi|255764473|r  134 PCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEG  172 (306)
Q Consensus       134 PtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~  172 (306)
                      |-+.+.++..+.+.-|      +++.-..||...|+..+
T Consensus       140 p~~~~~~c~~lvkP~G------~lf~STinrt~ka~~~~  172 (243)
T COG2227         140 PESFLRACAKLVKPGG------ILFLSTINRTLKAYLLA  172 (243)
T ss_pred             HHHHHHHHHHHCCCCC------EEEEECCCCCHHHHHHH
T ss_conf             9999999998629992------89994201388999999


No 146
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. The SalR binds to glucose based compound Salicin which is chemically related to aspirin. The ligand-binding of SalR is structurally homologous to the periplasmic sugar-binding domain of ABC-transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand bind
Probab=59.48  E-value=14  Score=17.60  Aligned_cols=116  Identities=14%  Similarity=0.183  Sum_probs=60.0

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEE--CCCCHHHHHHCCCCCCEECCCCCC---C
Q ss_conf             89999898634754333321000012321079999975-30010111210--132006776301244124043332---0
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRT--TNHSRLLELTEYATVPVINALTDN---T  132 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~--~~~~~~~~~~~~~~vpvINa~~~~---~  132 (306)
                      -.+.|.++++.|-+++.++.+......   .++..+++ +..+|++++-.  ..+....+.-+..++|++--+...   .
T Consensus        18 ~~gi~~~~~~~GY~~~i~~~~~~~~~~---~~~~~~~l~~~~vdGiIl~~~~~~~~~~~~~l~~~~iPvV~i~~~~~~~~   94 (270)
T cd01545          18 QLGALDACRDTGYQLVIEPCDSGSPDL---AERVRALLQRSRVDGVILTPPLSDNPELLDLLDEAGVPYVRIAPGTPDPD   94 (270)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCHHH---HHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             999999999849989999699999899---99999999966999899947888999999999977997999878877899


Q ss_pred             HHHHHHHHHH-HH---HHHCCCCCCCCEEEECCCC--CCCCCHH----HCCCCCCE
Q ss_conf             2467876557-66---4200133677304610455--5543101----00123312
Q gi|255764473|r  133 HPCQIIADIM-TF---EEHRGSVKGKLFSWSGDGN--NILHSLI----EGAARFNY  178 (306)
Q Consensus       133 HPtQaL~D~~-Ti---~e~~g~l~~~~i~~vGd~~--~v~hS~i----~~~~~~g~  178 (306)
                      .|+ +..|-+ ..   -++.-..-..+|++++...  .....+.    .++...|.
T Consensus        95 ~~~-V~~Dn~~~~~~a~~~L~~~G~~~I~~i~g~~~~~~~~~R~~Gf~~a~~~~gi  149 (270)
T cd01545          95 SPC-VRIDDRAAAREMTRHLIDLGHRRIAFIAGPPDHRASAERLEGYRDALAEAGL  149 (270)
T ss_pred             CCE-EEECHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             978-9978899999999999974996599936997773699999999999998399


No 147
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=59.32  E-value=9.9  Score=18.49  Aligned_cols=73  Identities=23%  Similarity=0.262  Sum_probs=44.4

Q ss_pred             HHCCCCCCCCEEEECC-----CCCCCCCH----HHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCC
Q ss_conf             2001336773046104-----55554310----10012331257652000013210000243201332221366466306
Q gi|255764473|r  146 EHRGSVKGKLFSWSGD-----GNNILHSL----IEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVK  216 (306)
Q Consensus       146 e~~g~l~~~~i~~vGd-----~~~v~hS~----i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~  216 (306)
                      +..+.+++.+|+++|=     .+.+..|-    +..+...|+++.+.-|..  ++..      .  ..+....++.++++
T Consensus       306 ~~l~~~~~~~I~ilGlafK~~tdD~R~Sps~~ii~~L~~~g~~V~~~DP~v--~~~~------~--~~~~~~~~~~~~~~  375 (411)
T TIGR03026       306 DLLGPLKGKTVLILGLAFKPNTDDVRESPALDIIELLKEKGAKVKAYDPLV--PEEE------V--KGLPLIDDLEEALK  375 (411)
T ss_pred             HHHHCCCCCEEEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCC--CHHH------H--HCCCCCCCHHHHHH
T ss_conf             866311666137874110699985345829999999997889899999989--9899------8--12777799999984


Q ss_pred             CCCCCCC-CCEEE
Q ss_conf             8733222-10000
Q gi|255764473|r  217 GAHCVFT-DTWIS  228 (306)
Q Consensus       217 ~aD~V~~-~~~~~  228 (306)
                      ++|++.. +.|..
T Consensus       376 ~aD~iii~t~h~e  388 (411)
T TIGR03026       376 GADALVILTDHDE  388 (411)
T ss_pred             CCCEEEEECCCHH
T ss_conf             6988999559866


No 148
>PRK06141 ornithine cyclodeaminase; Validated
Probab=58.48  E-value=4.8  Score=20.58  Aligned_cols=72  Identities=15%  Similarity=0.093  Sum_probs=41.5

Q ss_pred             CCCCEEEECCCCCCCCCHHHCC-CCCCE-EEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             6773046104555543101001-23312-57652000013210000243201332221366466306873322210
Q gi|255764473|r  152 KGKLFSWSGDGNNILHSLIEGA-ARFNY-LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       152 ~~~~i~~vGd~~~v~hS~i~~~-~~~g~-~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      +..+++++|-+. .+.+.++++ ..++. ++.+..+. ..-.+.+.+..+..|..+....+.+++++++|+|.+-.
T Consensus       124 ~~~~l~iiG~G~-QA~~~l~a~~~v~~i~~v~v~~r~-~~~a~~~~~~~~~~~~~~~~~~~~~~av~~aDII~taT  197 (313)
T PRK06141        124 DARRLLVVGTGR-LASLLALAHASVRPIKQVRVWGRN-PAKAAALAAELREQGFDAEVVTDLEAAVRQADIISCAT  197 (313)
T ss_pred             CCCEEEEECCHH-HHHHHHHHHHHHCCCCEEEEECCC-HHHHHHHHHHHHHCCCCEEEECCHHHHHHHCCEEEECC
T ss_conf             976799977889-999999999972897589999389-89999999999850997599589999861087799716


No 149
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional
Probab=58.39  E-value=15  Score=17.41  Aligned_cols=10  Identities=20%  Similarity=0.285  Sum_probs=4.4

Q ss_pred             CCCCCCCCCC
Q ss_conf             0687332221
Q gi|255764473|r  215 VKGAHCVFTD  224 (306)
Q Consensus       215 l~~aD~V~~~  224 (306)
                      ++++|+|++.
T Consensus       246 ~~~aDiVItT  255 (510)
T PRK09424        246 AKEVDIIITT  255 (510)
T ss_pred             HHHCCEEEEE
T ss_conf             7424779986


No 150
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus. NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain.
Probab=57.88  E-value=7.1  Score=19.43  Aligned_cols=20  Identities=25%  Similarity=0.345  Sum_probs=12.8

Q ss_pred             CCCCCCCHHHHCCCCCCCCC
Q ss_conf             22213664663068733222
Q gi|255764473|r  204 SVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       204 ~i~~~~d~~eal~~aD~V~~  223 (306)
                      .+..+.|++++++++|+|+.
T Consensus        57 ~i~~~~dl~~a~~~adiIii   76 (159)
T pfam01210        57 NLRATTDLEEAIKGADIIVL   76 (159)
T ss_pred             CEEECCCHHHHHHCCCEEEE
T ss_conf             30542889999837989999


No 151
>PRK08291 ornithine cyclodeaminase; Validated
Probab=57.86  E-value=5.7  Score=20.08  Aligned_cols=74  Identities=16%  Similarity=0.143  Sum_probs=42.0

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCC-CCCE-EEEEECHHCCCCCCCCHHH-HHCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             3367730461045555431010012-3312-5765200001321000024-3201332221366466306873322210
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAA-RFNY-LLNIATPIGSEPRNEYLNW-ARNQGASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~-~~g~-~v~~~~P~~~~~~~~~~~~-~~~~g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      +-+-.+++++|-+. .+++.++++. .++. ++.+..+..-.- +.+... ....|..+....+.+++++++|+|.+-.
T Consensus       129 r~da~~l~iiG~G~-QA~~~l~Al~~v~~i~~v~v~~r~~~~a-~~f~~~~~~~~g~~v~~~~~~~~av~~aDIIvtaT  205 (330)
T PRK08291        129 REDASRVAVFGAGE-QARLQLEALTLVRDIREVRVWARDAAKA-EAFAAELRAALGIPVTVARDVHAALAGADIVVTTT  205 (330)
T ss_pred             CCCCCEEEEECCHH-HHHHHHHHHHHHCCCCEEEEECCCHHHH-HHHHHHHHHHHCCCEEEECCHHHHHHCCCEEEEEE
T ss_conf             89985699987648-8999999999738976899983898999-99999998976996699299999972288899976


No 152
>cd01979 Pchlide_reductase_N Pchlide_reductase_N: N protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase. Pchlide reductase catalyzes the reductive formation of chlorophyllide (chlide) from protochlorophyllide (pchlide) during biosynthesis of chlorophylls and bacteriochlorophylls. This group contains both the light-independent Pchlide reductase (DPOR) and light-dependent Pchlide reductase (LPOR).  Angiosperms contain only LPOR, cyanobacteria, algae and gymnosperms contain both DPOR and LPOR, primitive anoxygenic photosynthetic bacteria contain only DPOR. NB is structurally similar to the FeMo protein of nitrogenase, forming an N2B2 heterotetramer. N and B are homologous to the FeMo alpha and beta subunits respectively. Also in common with nitrogenase in vitro DPOR activity requires ATP hydrolysis and dithoionite or ferredoxin as electron donor. The NB protein complex may serve as a catalytic site for Pchlide reduction similar to MoFe for nitrogen reduction.
Probab=57.51  E-value=15  Score=17.30  Aligned_cols=65  Identities=9%  Similarity=0.089  Sum_probs=26.8

Q ss_pred             HCCCCCCEECC-CCC-CCHHHHHHHHHHH-HHHHCC--CCCCCCEEEECCCCCCCCCHH-HCCCCCCEEEE
Q ss_conf             30124412404-333-2024678765576-642001--336773046104555543101-00123312576
Q gi|255764473|r  117 TEYATVPVINA-LTD-NTHPCQIIADIMT-FEEHRG--SVKGKLFSWSGDGNNILHSLI-EGAARFNYLLN  181 (306)
Q Consensus       117 ~~~~~vpvINa-~~~-~~HPtQaL~D~~T-i~e~~g--~l~~~~i~~vGd~~~v~hS~i-~~~~~~g~~v~  181 (306)
                      ++...+||||. ++| ..+-||+---.+. +-....  .-....+.++|+.+.+.-.++ ..+.++|..+.
T Consensus       114 s~~~~v~Vv~vs~sGiettFTQGEDa~LaAlvp~~P~~~~~~~~LvlvGsl~d~vedq~~~ll~~lGI~vv  184 (396)
T cd01979         114 SAEIGVPILVASASGLDYTFTQGEDTVLAALVPRCPEKPSPERSLVLVGSLPDIVEDQLRRELEQLGIPVV  184 (396)
T ss_pred             HHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCEE
T ss_conf             32679559995268754757679999999998647432378886489970581689999999997699246


No 153
>pfam00793 DAHP_synth_1 DAHP synthetase I family. Members of this family catalyse the first step in aromatic amino acid biosynthesis from chorismate. E-coli has three related synthetases, which are inhibited by different aromatic amino acids. This family also includes KDSA which has very similar catalytic activity but is involved in the first step of liposaccharide biosynthesis.
Probab=57.36  E-value=5.1  Score=20.41  Aligned_cols=103  Identities=27%  Similarity=0.354  Sum_probs=57.2

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHH-HHHHHHHHHCCCCC-CCC--CCC-CCCCCC-
Q ss_conf             458999999999999999966523666544379879999428883578-99998986347543-333--210-000123-
Q gi|255764473|r   12 SNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTR-VSFEVAMKHLGGDT-IFL--SGS-EMQLGR-   85 (306)
Q Consensus        12 ~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR-~SFe~A~~~LG~~~-~~~--~~~-~ss~~k-   85 (306)
                      --.+.+..+.+++.|..+|....+..  -.+.   .-.-|++|  ||+ .||+-    +|.+. +..  +.. ...+.- 
T Consensus        23 GPCsies~~~~~~~A~~lk~~~~~~~--i~~i---~ra~f~Kp--rts~~~~~G----~g~~~gL~~l~~i~~~~glpv~   91 (271)
T pfam00793        23 GPCSIESPEAAMEYAERLKELGAKLK--LPII---MRAYFEKP--RTSPVGFKG----LGNDPGLKILFRVKDGLGLPIA   91 (271)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHC--CEEE---EEECCCCC--CCCCCCCCC----CCCCCCCHHHHHHHHHCCCCHH
T ss_conf             78804399999999999999998709--5089---98434468--999967518----8877560267757765299546


Q ss_pred             CCCHH-HHHHHHHHCCCE--EEEEECCCCHHHHHHCCCCCCEE
Q ss_conf             21079-999975300101--11210132006776301244124
Q gi|255764473|r   86 AETIG-DTAKVLSRYVDA--IVMRTTNHSRLLELTEYATVPVI  125 (306)
Q Consensus        86 gEsl~-Dt~~~ls~~~D~--iviR~~~~~~~~~~~~~~~vpvI  125 (306)
                      -|-+. ..+..++.++|.  |..|...+..+.+.+...+.||-
T Consensus        92 TEv~~~~~~~~~~d~vd~~qIgAr~~~~~~l~~~as~~~~pV~  134 (271)
T pfam00793        92 TEVLDPIDPQYVAEVADIGQIGARTTESQDLLEAASGTSKPVG  134 (271)
T ss_pred             HHHCCHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHCCCCEEE
T ss_conf             5652746699998417655345511258999999852698478


No 154
>PRK10653 D-ribose transporter subunit RbsB; Provisional
Probab=55.89  E-value=16  Score=17.13  Aligned_cols=83  Identities=12%  Similarity=0.267  Sum_probs=52.6

Q ss_pred             CCCCEEEEEECCCCC----HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHCCCEEEEEECCCCHH---
Q ss_conf             379879999428883----57899998986347543333210000123210799999-7530010111210132006---
Q gi|255764473|r   42 LSGKVLAMIFEKPST----RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAK-VLSRYVDAIVMRTTNHSRL---  113 (306)
Q Consensus        42 l~gk~i~~lF~e~St----RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~-~ls~~~D~iviR~~~~~~~---  113 (306)
                      +.-+||+++.-.-+-    ...-..|.+++++|.+++..+.... ..+-  + +.++ .++..+|+|++=..+...+   
T Consensus        24 ~a~~TIgvivp~i~npff~~v~~gie~~a~~~Gy~l~v~~s~~d-~~~q--~-~~i~~li~~~vdgiii~p~d~~~~~~~   99 (295)
T PRK10653         24 MAKDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLVVLDSQNN-PAKE--L-ANVQDLTVRGTKILLINPTDSDAVGNA   99 (295)
T ss_pred             HCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCC-HHHH--H-HHHHHHHHCCCCEEEECCCCHHHHHHH
T ss_conf             52997999948987979999999999999976998999839999-9999--9-999999976998899847770656999


Q ss_pred             HHHHCCCCCCEECCC
Q ss_conf             776301244124043
Q gi|255764473|r  114 LELTEYATVPVINAL  128 (306)
Q Consensus       114 ~~~~~~~~vpvINa~  128 (306)
                      ...+....+|||.-.
T Consensus       100 ~~~a~~~gIPvV~~d  114 (295)
T PRK10653        100 VKMANQANIPVITLD  114 (295)
T ss_pred             HHHHHHCCCEEEEEE
T ss_conf             999997698199995


No 155
>PRK06823 ornithine cyclodeaminase; Validated
Probab=55.72  E-value=6  Score=19.92  Aligned_cols=72  Identities=19%  Similarity=0.131  Sum_probs=41.4

Q ss_pred             CCCCEEEECCCCCCCCCHHHCC-CCCCE-EEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             6773046104555543101001-23312-57652000013210000243201332221366466306873322210
Q gi|255764473|r  152 KGKLFSWSGDGNNILHSLIEGA-ARFNY-LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       152 ~~~~i~~vGd~~~v~hS~i~~~-~~~g~-~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      +-.+++++|-+. .++..++++ ..++. ++.+..... .-...+.+..+..|..+....+.++++.++|+|.+-.
T Consensus       127 da~~l~iiGtG~-QA~~~l~a~~~v~~i~~v~v~~r~~-~~~~~f~~~~~~~~~~v~~~~~~~eav~~ADIIvtaT  200 (315)
T PRK06823        127 HVKAIGIVGTGI-QARMQLMYLKNVTDCRQLWVWGRSE-TALEEYRQYAQALGFAVNTTLDAAEVAHAANLIVTTT  200 (315)
T ss_pred             CCCEEEEECCHH-HHHHHHHHHHHHCCCEEEEEECCCH-HHHHHHHHHHHHCCCCEEEECCHHHHHHHCCEEEEEE
T ss_conf             985699977189-9999999998718710999946997-9999999999861990799489999974277479887


No 156
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional
Probab=55.17  E-value=16  Score=17.08  Aligned_cols=111  Identities=19%  Similarity=0.145  Sum_probs=53.8

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHH--HCCCEEEEEECCCCHHHHHH
Q ss_conf             4437987999942888357899998986347543333210000123210799999753--00101112101320067763
Q gi|255764473|r   40 KPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLS--RYVDAIVMRTTNHSRLLELT  117 (306)
Q Consensus        40 ~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls--~~~D~iviR~~~~~~~~~~~  117 (306)
                      .+|+|+.|-=+=|=..   .+|-.  ..++|++|.-+|++.-+       -+.|+.-+  ...+ +-.|+   ..+++++
T Consensus        45 ~~l~G~~ILDVGCGgG---~lse~--LAr~Ga~VtGID~S~~~-------I~~Ar~ha~~~~l~-i~y~~---~~~e~l~  108 (233)
T PRK05134         45 GGLFGKRVLDVGCGGG---ILSES--MARLGATVTGIDASEEN-------IEVARLHALESGLK-IDYRQ---ITAEELA  108 (233)
T ss_pred             CCCCCCEEEEECCCCC---HHHHH--HHHCCCEEEEECCCHHH-------HHHHHHHHHHCCCC-CEEEE---CCHHHHH
T ss_conf             4668998999755897---11289--99679979998799899-------99999985644345-11675---1476654


Q ss_pred             CC--CCCCEECCCCCC---CHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHC
Q ss_conf             01--244124043332---02467876557664200133677304610455554310100
Q gi|255764473|r  118 EY--ATVPVINALTDN---THPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEG  172 (306)
Q Consensus       118 ~~--~~vpvINa~~~~---~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~  172 (306)
                      ..  .+.=+|-+..-.   ..|-+.|..+.-+.+--|      +.++--.||+..|++.+
T Consensus       109 ~~~~~~FDvV~~~EVlEHV~d~~~~l~~~~rlLKPGG------~l~lsTiNrt~~S~l~~  162 (233)
T PRK05134        109 AEHPGQFDVVTCMEMLEHVPDPASFIRACAKLVKPGG------LVFFSTLNRNLKSYLLA  162 (233)
T ss_pred             HHCCCCEEEEEEEHHHHHCCCHHHHHHHHHHHHCCCC------EEEEECCCCCHHHHHHH
T ss_conf             3057863477442147753899999999999738991------49997267898999999


No 157
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily. Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. Members of this group are predicted to be involved in the transport of sugar-containing molecules across cellular and organellar membranes; however their substrate specificity is not known in detail.
Probab=54.68  E-value=17  Score=17.00  Aligned_cols=82  Identities=22%  Similarity=0.277  Sum_probs=47.7

Q ss_pred             HHHHHHHHHHCCCC-----CCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECCCCC
Q ss_conf             89999898634754-----3333210000123210799999753001011121013200---677630124412404333
Q gi|255764473|r   59 RVSFEVAMKHLGGD-----TIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSR---LLELTEYATVPVINALTD  130 (306)
Q Consensus        59 R~SFe~A~~~LG~~-----~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa~~~  130 (306)
                      .-.+|.+++.||..     ++..|.....-..-+-++   ..+++.+|+|++-..+...   ..+.++...||||.--+.
T Consensus        18 ~~~~~~~ak~~~~~~~~~~~~~~da~~D~~kQ~~~ie---~~I~qgvD~Iiv~p~d~~a~~~~l~~A~~aGIpVV~~d~~   94 (272)
T cd06300          18 LDEFKAQAKELKKAGLISEFIVTSADGDVAQQIADIR---NLIAQGVDAIIINPASPTALNPVIEEACEAGIPVVSFDGT   94 (272)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHH---HHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             9999999986376674158999769999999999999---9998599999997897678899999999859969996687


Q ss_pred             CCHHH--HHHHHHHH
Q ss_conf             20246--78765576
Q gi|255764473|r  131 NTHPC--QIIADIMT  143 (306)
Q Consensus       131 ~~HPt--QaL~D~~T  143 (306)
                      ...|+  .+-.|-+.
T Consensus        95 ~~~~~~~~V~~dn~~  109 (272)
T cd06300          95 VTTPCAYNVNEDQAE  109 (272)
T ss_pred             CCCCCEEEECCCHHH
T ss_conf             897641895464899


No 158
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. This group includes the periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=54.51  E-value=16  Score=17.06  Aligned_cols=67  Identities=22%  Similarity=0.209  Sum_probs=41.5

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH--CCCEEEEEECCCCH---HHHHHCCCCCCEECCCC
Q ss_conf             8999989863475433332100001232107999997530--01011121013200---67763012441240433
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSR--YVDAIVMRTTNHSR---LLELTEYATVPVINALT  129 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~--~~D~iviR~~~~~~---~~~~~~~~~vpvINa~~  129 (306)
                      +-..+.|++++|.++..++.....-...+-+++   .++.  .+|+|++= +....   +.+.++...||||..-+
T Consensus        19 ~~g~~~aA~~~Gv~l~v~~~~~d~~~q~~~ie~---~I~~~~~vd~Iii~-p~~~~~~~~l~~A~~agIPVv~~d~   90 (305)
T cd06324          19 ARFMQAAADDLGIELEVLYAERDRFLMLQQART---ILQRPDKPDALIFT-NEKSVAPELLRLAEGAGVKLFLVNS   90 (305)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH---HHHCCCCCEEEEEC-CCCCCHHHHHHHHHHCCCEEEEECC
T ss_conf             999999999729989997399999999999999---98363797099987-9620018999999976983999658


No 159
>PRK00048 dihydrodipicolinate reductase; Provisional
Probab=54.44  E-value=11  Score=18.33  Aligned_cols=68  Identities=25%  Similarity=0.178  Sum_probs=31.8

Q ss_pred             CCCEEEEEECCCCHHH--HHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCC---CCCCCHHHCC
Q ss_conf             0101112101320067--7630124412404333202467876557664200133677304610455---5543101001
Q gi|255764473|r   99 YVDAIVMRTTNHSRLL--ELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGN---NILHSLIEGA  173 (306)
Q Consensus        99 ~~D~iviR~~~~~~~~--~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~---~v~hS~i~~~  173 (306)
                      -+|++|==..++....  +++....+|+|-+=+|.+ +.|    +-.|++.   -++..+.|.+..+   |+..-++..+
T Consensus        69 ~~DVvIDFS~p~~~~~~~~~~~~~~~~~ViGTTG~~-~~~----~~~i~~~---s~~ipil~apNfSlGvnll~~l~~~a  140 (265)
T PRK00048         69 DFDVLIDFTTPEATLENLEFALEHGKPLVIGTTGFT-EEQ----LAALREA---AKKIPVVIAPNFSVGVNLLMKLAEKA  140 (265)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCC-HHH----HHHHHHH---CCCCCEEEECCHHHHHHHHHHHHHHH
T ss_conf             599899899889999999999974997799608999-899----9999974---65887899785589999999999999


Q ss_pred             C
Q ss_conf             2
Q gi|255764473|r  174 A  174 (306)
Q Consensus       174 ~  174 (306)
                      +
T Consensus       141 a  141 (265)
T PRK00048        141 A  141 (265)
T ss_pred             H
T ss_conf             9


No 160
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann
Probab=53.87  E-value=8.2  Score=19.04  Aligned_cols=80  Identities=15%  Similarity=0.155  Sum_probs=43.7

Q ss_pred             HHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCC
Q ss_conf             7664200133677304610455554310100123312-576520000132100002432013322213664663068733
Q gi|255764473|r  142 MTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY-LLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHC  220 (306)
Q Consensus       142 ~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~  220 (306)
                      .++++....++++++.++|.++ +++|-+.++..+|. ++.+.....-.. ..+.+........+ ...+..+...+.|+
T Consensus         8 ~~l~~~~~~~~~k~vlIlGaGG-aarai~~aL~~~g~~~I~i~nR~~~r~-~~l~~~~~~~~~~~-~~~~~~~~~~~~dl   84 (155)
T cd01065           8 RALEEAGIELKGKKVLILGAGG-AARAVAYALAELGAAKIVIVNRTLEKA-KALAERFGELGIAI-AYLDLEELLAEADL   84 (155)
T ss_pred             HHHHHCCCCCCCCEEEEECCCH-HHHHHHHHHHHCCCCEEEEEECCHHHH-HHHHHHHHHCCCCE-EECCHHHHHCCCCE
T ss_conf             9999729985799999986758-999999999971998228860899999-99999850136640-10453443156887


Q ss_pred             CCCC
Q ss_conf             2221
Q gi|255764473|r  221 VFTD  224 (306)
Q Consensus       221 V~~~  224 (306)
                      |+-.
T Consensus        85 iIN~   88 (155)
T cd01065          85 IINT   88 (155)
T ss_pred             EEEC
T ss_conf             9876


No 161
>PRK13656 trans-2-enoyl-CoA reductase; Provisional
Probab=53.66  E-value=17  Score=16.90  Aligned_cols=62  Identities=19%  Similarity=0.250  Sum_probs=44.2

Q ss_pred             CEEEEEECCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEE
Q ss_conf             8799994288835789---------9998986347543333210000123210799999753001011121
Q gi|255764473|r   45 KVLAMIFEKPSTRTRV---------SFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMR  106 (306)
Q Consensus        45 k~i~~lF~e~StRTR~---------SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR  106 (306)
                      .||+-.|+.|.+..|+         .|+.++++-|.-...++...=|-.-.+-+-|+++.--.-+|++|.-
T Consensus        68 ~TiGV~fEr~~~~~k~gtaGWYN~~aF~~~A~~~Gl~a~~~ngDAFS~e~K~~vI~~Ik~~~G~vDlvVYS  138 (400)
T PRK13656         68 DTLGVFFERPGSEKKPGTAGWYNSAAFDKFAKAAGLYAKSINGDAFSDEIKQKVIELIKQDLGQVDLVVYS  138 (400)
T ss_pred             CEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEECCCCCCCHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             72678851588899877864316899999999779721214520067899999999999865984679996


No 162
>PRK06701 short chain dehydrogenase; Provisional
Probab=53.32  E-value=5.6  Score=20.10  Aligned_cols=93  Identities=17%  Similarity=0.184  Sum_probs=46.5

Q ss_pred             CCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC-CCEEEEEEC--CCCHH
Q ss_conf             665443798799994288835789999898634754333321000012321079999975300-101112101--32006
Q gi|255764473|r   37 FENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY-VDAIVMRTT--NHSRL  113 (306)
Q Consensus        37 ~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~-~D~iviR~~--~~~~~  113 (306)
                      ..+-.|+||++ ++ ==.|.-==.++..+..+.|+++...+..     ..+..+++...++.+ .+++.+...  +...+
T Consensus        38 ~~~grL~GKva-lV-TGgs~GIG~aiA~~la~~GA~V~i~~~~-----~~~~a~~~~~~~~~~G~~~~~~~~Dv~d~~~v  110 (289)
T PRK06701         38 KGSGKLKGKVA-LI-TGGDSGIGRAVAVAFAKEGADIAIVYLD-----EHEDANETKQRVEKEGVKCLLIPGDVSDEQFC  110 (289)
T ss_pred             CCCCCCCCCEE-EE-ECCCCHHHHHHHHHHHHCCCEEEEEECC-----CHHHHHHHHHHHHHCCCEEEEEECCCCCHHHH
T ss_conf             66887799989-99-6825799999999999879989998289-----46789999999996399089998478999999


Q ss_pred             HHHH-----C--CCCCCEECCCCC-CCHHHH
Q ss_conf             7763-----0--124412404333-202467
Q gi|255764473|r  114 LELT-----E--YATVPVINALTD-NTHPCQ  136 (306)
Q Consensus       114 ~~~~-----~--~~~vpvINa~~~-~~HPtQ  136 (306)
                      ..+.     +  ..++-|-|||.. ..-|..
T Consensus       111 ~~~v~~~~~~fG~iDiLVNNAG~~~~~~~~~  141 (289)
T PRK06701        111 KDAVEETVRELGRLDILVNNAAQQYPQQSLE  141 (289)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCHH
T ss_conf             9999999998599989998883467888724


No 163
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=52.28  E-value=8.5  Score=18.93  Aligned_cols=18  Identities=11%  Similarity=0.183  Sum_probs=6.4

Q ss_pred             CEEEEEECCCCHHHHHHC
Q ss_conf             011121013200677630
Q gi|255764473|r  101 DAIVMRTTNHSRLLELTE  118 (306)
Q Consensus       101 D~iviR~~~~~~~~~~~~  118 (306)
                      ++|..=..+.-.+.++++
T Consensus       107 ~~IlASNTSsl~is~ia~  124 (310)
T PRK06130        107 QTIFATNTSGLSINAIAQ  124 (310)
T ss_pred             CCEEEECCCCCCCHHHHH
T ss_conf             838996488776067888


No 164
>PRK07589 ornithine cyclodeaminase; Validated
Probab=52.14  E-value=7  Score=19.50  Aligned_cols=72  Identities=14%  Similarity=0.103  Sum_probs=39.1

Q ss_pred             CCCCEEEECCCCCCCCCHHHCC-CCCCEE-EEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             6773046104555543101001-233125-7652000013210000243201332221366466306873322210
Q gi|255764473|r  152 KGKLFSWSGDGNNILHSLIEGA-ARFNYL-LNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       152 ~~~~i~~vGd~~~v~hS~i~~~-~~~g~~-v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      +...++++|-+. -+...++++ ..++.+ +.+.....- -...+.......|..+....+.++++++||+|.|-.
T Consensus       128 ds~~l~iIGtG~-QA~~Q~~A~~~vr~i~~V~v~~r~~~-~a~~~a~~l~~~g~~v~~~~s~~eAv~~ADIIvTaT  201 (346)
T PRK07589        128 DSRTMALIGNGA-QSEFQALAFKALLGIEEIRLYDIDPA-ATAKLARNLAGPGLRIVRCRSVAEAVEGADIITTVT  201 (346)
T ss_pred             CCCEEEEECCCH-HHHHHHHHHHHHCCCCEEEEEECCHH-HHHHHHHHHHHCCCEEEEECCHHHHHHCCCEEEEEC
T ss_conf             987699974708-89999999998589868999828879-999999998726980899499999972198888711


No 165
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed
Probab=51.81  E-value=19  Score=16.71  Aligned_cols=31  Identities=26%  Similarity=0.318  Sum_probs=14.4

Q ss_pred             CCCEEEEEECCCC---HHHHHHCC-CCCCEECCCC
Q ss_conf             0101112101320---06776301-2441240433
Q gi|255764473|r   99 YVDAIVMRTTNHS---RLLELTEY-ATVPVINALT  129 (306)
Q Consensus        99 ~~D~iviR~~~~~---~~~~~~~~-~~vpvINa~~  129 (306)
                      -+|++++=.+++.   .+.++..+ .+..||+-.-
T Consensus        66 ~~d~IilavKP~~~~~vl~~i~~~~~~~~iISi~A  100 (245)
T PRK07634         66 SVDTIVLAMPPSAHEELLAELSPLLSNQLVVTVAA  100 (245)
T ss_pred             HCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             59999999891749999999877606988999817


No 166
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion]
Probab=51.56  E-value=11  Score=18.24  Aligned_cols=25  Identities=24%  Similarity=0.521  Sum_probs=17.6

Q ss_pred             CCCCCCCHHHHCCCCCCCCCCCEEECC
Q ss_conf             222136646630687332221000000
Q gi|255764473|r  204 SVALFHDAVQAVKGAHCVFTDTWISMN  230 (306)
Q Consensus       204 ~i~~~~d~~eal~~aD~V~~~~~~~~~  230 (306)
                      .+.+++|-.|++++||+|++  |..-+
T Consensus       126 g~~vttddreavedad~iit--wlpkg  150 (343)
T COG4074         126 GIVVTTDDREAVEDADMIIT--WLPKG  150 (343)
T ss_pred             EEEEECCCHHHHCCCCEEEE--ECCCC
T ss_conf             13885372766457775999--44688


No 167
>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945   Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors . The enzymes in this entry are found in archaea, bacteria and eukaryotes and fall into two distinct groups. The first group are cytoplamsic, NAD-dependent enzymes which participate in the citric acid cycle (1.1.1.37 from EC). The second group are found in plant chloroplasts, use NADP as cofactor, and participate in the C4 cycle (1.1.1.82 from EC).   Structural studies indicate that these enzymes are homodimers with very sinmilar overall topology, though the chloroplast enzymes also have N- and C-terminal extensions, and all contain the classical Rossman fold for NAD(P)H binding , , , . Substrate specificity is determined by a mobile loop at the active site which uses charge balancing to discriminate between the correct substrates (malate and oxaloacetate) and other potential oxo/hydroxyacid substrates the enzyme may encounter within the cell .; GO: 0016615 malate dehydrogenase activity, 0006108 malate metabolic process.
Probab=51.46  E-value=16  Score=17.13  Aligned_cols=119  Identities=16%  Similarity=0.089  Sum_probs=58.3

Q ss_pred             CCEEEECCCCCCCCCHHHCC---CCCCEE----EEEECHHC-CCCC----CCCHHHHHCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf             73046104555543101001---233125----76520000-1321----000024320133222136646630687332
Q gi|255764473|r  154 KLFSWSGDGNNILHSLIEGA---ARFNYL----LNIATPIG-SEPR----NEYLNWARNQGASVALFHDAVQAVKGAHCV  221 (306)
Q Consensus       154 ~~i~~vGd~~~v~hS~i~~~---~~~g~~----v~~~~P~~-~~~~----~~~~~~~~~~g~~i~~~~d~~eal~~aD~V  221 (306)
                      ++|++-|=.+-|..|++...   ..||.+    +.+.--+. ...-    -|+.+=|-..=..|..++|+.||++|+|+=
T Consensus         4 ~rV~VTGAAGQI~Y~Ll~~iA~G~~fG~Dqpv~L~LLdIP~A~~~LeGV~MEL~DCAFPlL~~v~~T~~p~eAF~dvD~A   83 (329)
T TIGR01759         4 VRVAVTGAAGQIGYSLLFRIASGELFGKDQPVVLHLLDIPQAMKALEGVVMELEDCAFPLLAGVVATTDPEEAFKDVDVA   83 (329)
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCEECCCHHHHHCCCCEE
T ss_conf             37997374467899998898556104889846888607723311334435535306452235112216868751898757


Q ss_pred             C-CCCEEE---CCCCCHHHHHHCCCCCCCCHHHHH-CCCCCCEEECCC-CCCCCCCCCH
Q ss_conf             2-210000---002201333100111233688996-289872992599-9874873576
Q gi|255764473|r  222 F-TDTWIS---MNQEFKAREEHVFQPFQVNLSLMS-MAHPDALFMHCL-PAHRGEEVIN  274 (306)
Q Consensus       222 ~-~~~~~~---~~~~~~~~~~~~~~~y~i~~~~l~-~a~~~~~vmHpl-P~~rg~EI~~  274 (306)
                      . .....+   |...+..+.+.  +=|+-.-+-|. .||||++|+==| |+|=|-.|..
T Consensus        84 lLvGa~PRK~GMER~DLL~~Ng--~IF~~QG~aLn~~Ak~~vKVLVVGNPaNTNaLIa~  140 (329)
T TIGR01759        84 LLVGAFPRKPGMERRDLLSKNG--KIFKEQGKALNKVAKKDVKVLVVGNPANTNALIAS  140 (329)
T ss_pred             EEECCCCCCCCCCHHHHHHHCC--HHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHH
T ss_conf             7613668958844799987222--54687999999861898569985298627999999


No 168
>PRK09117 consensus
Probab=51.23  E-value=9.6  Score=18.59  Aligned_cols=15  Identities=13%  Similarity=0.215  Sum_probs=7.1

Q ss_pred             HHHCCHHHHHHHHHH
Q ss_conf             445899999999999
Q gi|255764473|r   11 LSNISSSNLSCIIEV   25 (306)
Q Consensus        11 ~~dl~~~~i~~ll~~   25 (306)
                      +-|.+.+.+..-.+.
T Consensus        30 l~D~~~~~l~~~~~~   44 (282)
T PRK09117         30 MVDISDAAVQRGLAT   44 (282)
T ss_pred             EEECCHHHHHHHHHH
T ss_conf             998988999999999


No 169
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. This group includes the periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consist of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=51.03  E-value=18  Score=16.75  Aligned_cols=102  Identities=16%  Similarity=0.184  Sum_probs=52.7

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCC---HHHHHHCCCCCCEECCCC---CC
Q ss_conf             789999898634754333321000012321079999975300101112101320---067763012441240433---32
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHS---RLLELTEYATVPVINALT---DN  131 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~---~~~~~~~~~~vpvINa~~---~~  131 (306)
                      -.-..|.++++.|.+++..+... +..+ | .+..-..++..+|+|++-..+..   ...+.+....+|||.--.   +.
T Consensus        17 v~~gie~~a~~~G~~~~i~~s~~-d~~~-q-~~~i~~li~~~vDgiIi~p~~~~~~~~~~~~~~~~gIPvV~~d~~~~~~   93 (267)
T cd06322          17 LANAMKEEAKKQKVNLIVSIANQ-DLNK-Q-LSDVEDFITKKVDAIVLSPVDSKGIRAAIAKAKKAGIPVITVDIAAEGV   93 (267)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCC-CHHH-H-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99999999997499999983999-9999-9-9999999974999999906761010699999997599789983465556


Q ss_pred             CHHHHHHHHHHHH----HHHCCC-CCC-CCEEEECCC
Q ss_conf             0246787655766----420013-367-730461045
Q gi|255764473|r  132 THPCQIIADIMTF----EEHRGS-VKG-KLFSWSGDG  162 (306)
Q Consensus       132 ~HPtQaL~D~~Ti----~e~~g~-l~~-~~i~~vGd~  162 (306)
                      .-.+..-.|=+.-    -|+... +.+ .+|++++.+
T Consensus        94 ~~~~~V~~Dn~~~g~~a~~~l~~~l~g~~~i~~i~~~  130 (267)
T cd06322          94 AVVSHVATDNYAGGVLAGELAAKVLNGKGQVAIIDYP  130 (267)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             6432996262899999999999973389459999179


No 170
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=50.98  E-value=12  Score=17.86  Aligned_cols=22  Identities=14%  Similarity=0.179  Sum_probs=11.8

Q ss_pred             CCEEEEEECCCCHHHHHHCCCC
Q ss_conf             1011121013200677630124
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELTEYAT  121 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~~~~~  121 (306)
                      .|+|..=..+.-.+.++++..+
T Consensus       113 ~~~IlaSNTSsl~is~ia~~~~  134 (291)
T PRK06035        113 PETIIASNTSGIMIAEIATALE  134 (291)
T ss_pred             CCCEEEECCCCCCHHHHHHHCC
T ss_conf             9837986088778699997659


No 171
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=50.70  E-value=13  Score=17.73  Aligned_cols=128  Identities=14%  Similarity=0.037  Sum_probs=57.5

Q ss_pred             CEEEECCCCCCCCCHHHCCCCCC--EEEEEECHHCCCCCCCCHHHH---HCCCCCCCCCCCHHHHCCCCCCCCCCCE-EE
Q ss_conf             30461045555431010012331--257652000013210000243---2013322213664663068733222100-00
Q gi|255764473|r  155 LFSWSGDGNNILHSLIEGAARFN--YLLNIATPIGSEPRNEYLNWA---RNQGASVALFHDAVQAVKGAHCVFTDTW-IS  228 (306)
Q Consensus       155 ~i~~vGd~~~v~hS~i~~~~~~g--~~v~~~~P~~~~~~~~~~~~~---~~~g~~i~~~~d~~eal~~aD~V~~~~~-~~  228 (306)
                      ||+++|-+++|.-+....+..-+  -++.++.-..-....+..+..   ........+..+..++++++|+|....= .+
T Consensus         2 KV~IIGagg~VG~~~A~~l~~~~l~~elvL~D~~~~~a~g~alDl~~~~~~~~~~~~~~~~~~~~~~daDiVVitaG~~~   81 (142)
T pfam00056         2 KVAVVGAGGGVGSSLAFALALQGLADELVLVDINKDKAEGVAMDLSHGSTFLSVPGIVGGDDYEALKDADVVVITAGVPR   81 (142)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCCCCCCCCCEEECCCCHHHHCCCCEEEEECCCCC
T ss_conf             89998987789999999997479663478850577641179999861443478876974883888378999998157778


Q ss_pred             CCCCCHHHHHHCCCCCC----CCHHHHHCCCCCCE-EECCCCCCCCCCCCHHHHCCCCCHHH
Q ss_conf             00220133310011123----36889962898729-92599987487357679679971068
Q gi|255764473|r  229 MNQEFKAREEHVFQPFQ----VNLSLMSMAHPDAL-FMHCLPAHRGEEVINEVLDGPQSVVF  285 (306)
Q Consensus       229 ~~~~~~~~~~~~~~~y~----i~~~~l~~a~~~~~-vmHplP~~rg~EI~~~v~d~~~s~~~  285 (306)
                      .......+.  ...+-+    +-.++ .+..|+++ ++=-=|++.-.-+......-|+..++
T Consensus        82 k~g~~R~dl--l~~Na~I~~~i~~~i-~~~~p~~ivivvtNPvDvmt~~~~~~sg~p~~rVi  140 (142)
T pfam00056        82 KPGMTRLDL--LNRNAGIFKDIVPAI-AKSAPDAIVLVVSNPVDILTYIAWKVSGLPPERVI  140 (142)
T ss_pred             CCCCCHHHH--HHHHHHHHHHHHHHH-HHHCCCEEEEEECCCHHHHHHHHHHHHCCCCCCCC
T ss_conf             999877899--997469999999999-97699819999459468899999999784943110


No 172
>cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit. A group of proteins similar to the alpha subunit of the MoFe protein of the molybdenum (Mo-) nitrogenase. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen to ammonia. The Mo-nitrogenase is the most widespread and best characterized of these systems.  Mo-nitrogenase consists of the MoFe protein (component 1) and the Fe protein (component 2).  MoFe is an alpha2beta2 tetramer. Each alphabeta pair of MoFe contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha subunit. The Fe protein contains a single [4Fe-4S] cluster.  Electrons are transferred from the [4Fe-4S] cluster of the Fe protein to the P-cluster of the MoFe and in turn to FeMoCo, the site of substrate reduction.
Probab=50.04  E-value=20  Score=16.53  Aligned_cols=37  Identities=14%  Similarity=-0.009  Sum_probs=21.4

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             01336773046104555543101001233125765200
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      +..|+|+++++...+. -.+|++.++.-+|+++..++.
T Consensus       295 r~~L~GKrv~i~~Gg~-~~~~~i~~~~eLGmevV~~g~  331 (421)
T cd01976         295 RPRLEGKTVMLYVGGL-RPRHYIGAYEDLGMEVVGTGY  331 (421)
T ss_pred             HHHCCCCEEEEECCCC-CHHHHHHHHHHCCCEEEEEEE
T ss_conf             9870898899989987-468999999987988999731


No 173
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems. Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems, all of which contain the type I periplasmic binding protein-like fold. Their specific ligands include lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. The LacI family of proteins consists of transcriptional regulators related to the lac repressor; in general the sugar binding domain in this family binds a sugar, which in turn changes the DNA binding activity of the repressor domain.  The core structure of the periplasmic binding proteins is classified into two types and they differ in number and order of beta strands in each domain: type I, which has six beta strands, and type II, which has five beta strands. These two distinct structural arrangem
Probab=49.21  E-value=20  Score=16.45  Aligned_cols=80  Identities=16%  Similarity=0.245  Sum_probs=47.1

Q ss_pred             EEEEEECCCC----CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHH-HHHCCCEEEEEECC--CCHHHHHHC
Q ss_conf             7999942888----3578999989863475433332100001232107999997-53001011121013--200677630
Q gi|255764473|r   46 VLAMIFEKPS----TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKV-LSRYVDAIVMRTTN--HSRLLELTE  118 (306)
Q Consensus        46 ~i~~lF~e~S----tRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~-ls~~~D~iviR~~~--~~~~~~~~~  118 (306)
                      ||+++...-+    .+-.-.++.++.+.|.+++..+.....    +.-...++. ++..+|++++-...  .........
T Consensus         1 tIgvi~p~~~~~f~~~~~~gi~~~a~~~gy~~~~~~~~~~~----~~~~~~i~~~~~~~vDgiIi~~~~~~~~~~~~~~~   76 (264)
T cd01537           1 TIGVLVPDLDNPFFAQVLKGIEEAAKAAGYQVLLANSQNDA----EKQLSALENLIARGVDGIIIAPSDLTAPTIVKLAR   76 (264)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCH----HHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             98999788977999999999999999869989999799998----99999999999769999999679888689999999


Q ss_pred             CCCCCEECCCC
Q ss_conf             12441240433
Q gi|255764473|r  119 YATVPVINALT  129 (306)
Q Consensus       119 ~~~vpvINa~~  129 (306)
                      ..++|||.-+.
T Consensus        77 ~~~ipvV~~~~   87 (264)
T cd01537          77 KAGIPVVLVDR   87 (264)
T ss_pred             HCCCCEEEECC
T ss_conf             75997999856


No 174
>PRK09519 recA recombinase A; Reviewed
Probab=49.21  E-value=20  Score=16.44  Aligned_cols=99  Identities=21%  Similarity=0.312  Sum_probs=58.9

Q ss_pred             CCCEEEEEECCCCCHHHHHHHH--HHHHCCCCCCCCCCCC-------------------CCCCCCCCHHHHHHHH--HHC
Q ss_conf             7987999942888357899998--9863475433332100-------------------0012321079999975--300
Q gi|255764473|r   43 SGKVLAMIFEKPSTRTRVSFEV--AMKHLGGDTIFLSGSE-------------------MQLGRAETIGDTAKVL--SRY   99 (306)
Q Consensus        43 ~gk~i~~lF~e~StRTR~SFe~--A~~~LG~~~~~~~~~~-------------------ss~~kgEsl~Dt~~~l--s~~   99 (306)
                      +|+.+-..=.|.|-.|-++..+  .+++.||.+.++|..+                   |+...||-.-+.+.+|  |.-
T Consensus        59 rGRIvEIyGpESSGKTTLALH~IAeaQK~GG~aAfIDAEhAlDp~yA~~LGVdld~LLisQPdtGEqALeIae~LIrSga  138 (790)
T PRK09519         59 RGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGA  138 (790)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCHHHCEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             60499987897765899999999999853997999952002599999983957678068579808899999999985489


Q ss_pred             CCEEEEEECCCCHHHHHHCCCCCC--EECCCCCCCHHH-HHHHHHHHHHHHCCCC
Q ss_conf             101112101320067763012441--240433320246-7876557664200133
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELTEYATVP--VINALTDNTHPC-QIIADIMTFEEHRGSV  151 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~~~~~vp--vINa~~~~~HPt-QaL~D~~Ti~e~~g~l  151 (306)
                      +|+||+-.-  .        +-+|  -|.+.=+.+|.. ||-+==..|++.-+.+
T Consensus       139 vDlIVVDSV--A--------ALvPKaEieGemgD~~vGlQARLMSqALRKLT~~I  183 (790)
T PRK09519        139 LDIVVIDSV--A--------ALVPRAELEGEMGDSHVGLQARLMSQALRKMTGAL  183 (790)
T ss_pred             CCEEEEECC--C--------CCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             548998053--4--------56878886164566428899999999999998776


No 175
>KOG2711 consensus
Probab=49.17  E-value=14  Score=17.47  Aligned_cols=44  Identities=18%  Similarity=0.345  Sum_probs=19.9

Q ss_pred             CCEEEEEECCC---CHHHHHHCCC--CCCEECC---CC-CCCHH-HHHHHHHHH
Q ss_conf             10111210132---0067763012--4412404---33-32024-678765576
Q gi|255764473|r  100 VDAIVMRTTNH---SRLLELTEYA--TVPVINA---LT-DNTHP-CQIIADIMT  143 (306)
Q Consensus       100 ~D~iviR~~~~---~~~~~~~~~~--~vpvINa---~~-~~~HP-tQaL~D~~T  143 (306)
                      .|++|.-.|.+   ....++..+.  +++.|+.   .. +..+| -|.+.++.+
T Consensus       106 ADilvf~vPhQf~~~ic~~l~g~vk~~~~aISL~KG~e~~~~g~~i~liS~iI~  159 (372)
T KOG2711         106 ADILVFVVPHQFIPRICEQLKGYVKPGATAISLIKGVEVGEEGPGIRLISQIIH  159 (372)
T ss_pred             CCEEEEECCHHHHHHHHHHHHCCCCCCCEEEEEECCEECCCCCCCEEEHHHHHH
T ss_conf             888999487154799999985425799807885404141688884463699999


No 176
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This group includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); its ligand specificity has not been determined experimentally.
Probab=48.66  E-value=21  Score=16.39  Aligned_cols=72  Identities=18%  Similarity=0.262  Sum_probs=37.3

Q ss_pred             CCCC-HHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECCCCHHHHHHCCCCCCEEC
Q ss_conf             8883-5789999898634754---333321000012321079999975-300101112101320067763012441240
Q gi|255764473|r   53 KPST-RTRVSFEVAMKHLGGD---TIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTNHSRLLELTEYATVPVIN  126 (306)
Q Consensus        53 e~St-RTR~SFe~A~~~LG~~---~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~~~~~~~~~~~~~vpvIN  126 (306)
                      .||. -.|-.|.-+.+++|..   -+.++...-+ +-.+.+.-.++-| +.-+|+|+.=..... ......-.++||+=
T Consensus        10 h~~ld~~~~Gf~~~L~~~G~~~g~nv~~~~~na~-gd~~~l~~ia~~l~~~~~DlIva~gTpaa-qa~~~~~~~iPIVF   86 (281)
T cd06325          10 HPALDAARKGFKDGLKEAGYKEGKNVKIDYQNAQ-GDQSNLPTIARKFVADKPDLIVAIATPAA-QAAANATKDIPIVF   86 (281)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECC-CCHHHHHHHHHHHHHCCCCEEEECCHHHH-HHHHHCCCCCCEEE
T ss_conf             6747999999999999649767983799996079-99999999999998549999998770999-99996279999899


No 177
>TIGR02685 pter_reduc_Leis pteridine reductase; InterPro: IPR014058   Pteridine reductase is an enzyme used by trypanosomatids (including Trypanosoma cruzi and Leishmania major) to obtain reduced pteridines by salvage rather than biosynthetic pathways. Enzymes in T. cruzi described as pteridine reductase 1 (PTR1) and pteridine reductase 2 (PTR2) have different activity profiles. PTR1 is more active with fully oxidized biopterin and folate than with reduced forms, while PTR2 reduces dihydrobiopterin and dihydrofolate but not oxidized pteridines. T. cruzi PTR1 and PTR2 are more similar to each other in sequence than either is to the pteridine reductase of Leishmania major, and all are included in this family..
Probab=48.29  E-value=12  Score=17.95  Aligned_cols=130  Identities=13%  Similarity=0.112  Sum_probs=82.9

Q ss_pred             CCCCCCCCCHH-HHHHHHHHC--CCEEEEEECCCCHHHHHHC--CCCCCEECCCCC-CCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             00012321079-999975300--1011121013200677630--124412404333-20246787655766420013367
Q gi|255764473|r   80 EMQLGRAETIG-DTAKVLSRY--VDAIVMRTTNHSRLLELTE--YATVPVINALTD-NTHPCQIIADIMTFEEHRGSVKG  153 (306)
Q Consensus        80 ~ss~~kgEsl~-Dt~~~ls~~--~D~iviR~~~~~~~~~~~~--~~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~  153 (306)
                      .||.+.+|+++ ..+..++..  .-.+-+|-+-+-.-.+-.+  ..+..|+|..|- ..-|+-+-. +|||-+|  -|+|
T Consensus       122 Gss~~~~k~~e~~vAeLfGsNAiAP~fLi~aFAqR~~gt~~~~rs~nlSiVNl~DAMtdqPl~gf~-~YtMaK~--AL~G  198 (283)
T TIGR02685       122 GSSVADKKSVEVQVAELFGSNAIAPYFLIKAFAQRQKGTRAEQRSTNLSIVNLCDAMTDQPLLGFT-LYTMAKH--ALEG  198 (283)
T ss_pred             CCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEHHHHHHCCCHHHHH-HHHHHHH--HHHH
T ss_conf             733345650888878651523577899999887410578756555544212120341046613566-8776789--8666


Q ss_pred             CCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHH-CCCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             7304610455554310100123312576520000132100002432-013322213664663068733222
Q gi|255764473|r  154 KLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWAR-NQGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       154 ~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~-~~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                      |+           +|=..-++-++.+|+-++|---..|+...+..+ ++--|+.....--.|-+=+|+|+=
T Consensus       199 LT-----------rsAALELAp~~IRVNgVaPGlSlLP~aMp~e~qe~yRRKVPLgqreaSAe~iaDvviF  258 (283)
T TIGR02685       199 LT-----------RSAALELAPLQIRVNGVAPGLSLLPDAMPEEVQEDYRRKVPLGQREASAEQIADVVIF  258 (283)
T ss_pred             HH-----------HHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHEEEE
T ss_conf             67-----------9999861425515632468750078778864221244668777762335646108866


No 178
>KOG0068 consensus
Probab=48.22  E-value=21  Score=16.35  Aligned_cols=151  Identities=15%  Similarity=0.142  Sum_probs=72.3

Q ss_pred             CCEEEEEECCCCHH-HHHHCCCCCCEECCCCC-----CCHHHHHHHHHHH--------HHH-------HCC-CCCCCCEE
Q ss_conf             10111210132006-77630124412404333-----2024678765576--------642-------001-33677304
Q gi|255764473|r  100 VDAIVMRTTNHSRL-LELTEYATVPVINALTD-----NTHPCQIIADIMT--------FEE-------HRG-SVKGKLFS  157 (306)
Q Consensus       100 ~D~iviR~~~~~~~-~~~~~~~~vpvINa~~~-----~~HPtQaL~D~~T--------i~e-------~~g-~l~~~~i~  157 (306)
                      .-++..|+..-..+ ...|.--.+-|+|.-..     .+|-|--|+-+.-        +++       ..| .+.|++++
T Consensus        71 lkvVgrag~G~dNVDL~AAte~gi~Vvn~P~~Ns~saAEltigli~SLaR~i~~A~~s~k~g~wnr~~~~G~el~GKTLg  150 (406)
T KOG0068          71 LKVVGRAGIGVDNVDLKAATENGILVVNTPTANSRSAAELTIGLILSLARQIGQASASMKEGKWNRVKYLGWELRGKTLG  150 (406)
T ss_pred             EEEEEECCCCCCCCCHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCHHHEEEECCCEEECCEEEEEEECCEEE
T ss_conf             48998513575654725577578389958988717799999999999751203100154358411012014677566788


Q ss_pred             EECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHH
Q ss_conf             61045555431010012331257652000013210000243201332221366466306873322210000002201333
Q gi|255764473|r  158 WSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKARE  237 (306)
Q Consensus       158 ~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~  237 (306)
                      ++|- +++..-....+..+|+.+....|..  |.    +.++..|..+   -+++|.+..||+|..-+      +..+.-
T Consensus       151 vlG~-GrIGseVA~r~k~~gm~vI~~dpi~--~~----~~~~a~gvq~---vsl~Eil~~ADFitlH~------PLtP~T  214 (406)
T KOG0068         151 VLGL-GRIGSEVAVRAKAMGMHVIGYDPIT--PM----ALAEAFGVQL---VSLEEILPKADFITLHV------PLTPST  214 (406)
T ss_pred             EEEC-CCCHHHHHHHHHHCCCEEEEECCCC--CH----HHHHHCCCEE---EEHHHHHHHCCEEEECC------CCCCCH
T ss_conf             8504-6211899999986585488606878--46----7787516545---40988775568899816------788214


Q ss_pred             HHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCH
Q ss_conf             1001112336889962898729925999874873576
Q gi|255764473|r  238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVIN  274 (306)
Q Consensus       238 ~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~  274 (306)
                      +     -.+|.+.++++|+.+.+--+-   ||--|+.
T Consensus       215 ~-----~lin~~tfA~mKkGVriIN~a---RGGvVDe  243 (406)
T KOG0068         215 E-----KLLNDETFAKMKKGVRIINVA---RGGVVDE  243 (406)
T ss_pred             H-----HCCCHHHHHHHHCCCEEEEEC---CCCEECH
T ss_conf             3-----113878999860785899824---7752063


No 179
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional
Probab=47.98  E-value=21  Score=16.32  Aligned_cols=37  Identities=38%  Similarity=0.510  Sum_probs=28.0

Q ss_pred             HHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCH
Q ss_conf             53001011121013200677630124412404333202
Q gi|255764473|r   96 LSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTH  133 (306)
Q Consensus        96 ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~H  133 (306)
                      ...|+|+++.|+. ........+.+.+|||-.++|..|
T Consensus       193 ~~~~vdliiprGg-~~li~~v~~~a~vPvi~~~~G~~h  229 (416)
T PRK00197        193 LDGYVDVLIPRGG-AGLIKRVVEEATVPVIETGVGNCH  229 (416)
T ss_pred             CCCCCCEEEECCC-HHHHHHHHHHCCCCEEEECCCCCE
T ss_conf             4787338993686-578899986377878961588532


No 180
>PRK07417 arogenate dehydrogenase; Reviewed
Probab=47.68  E-value=9.7  Score=18.54  Aligned_cols=18  Identities=11%  Similarity=0.025  Sum_probs=11.5

Q ss_pred             CCEEEEEECCCCHHHHHH
Q ss_conf             101112101320067763
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELT  117 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~  117 (306)
                      +|++|+=+|-+.....+.
T Consensus        59 aDliila~Pv~~~~~~~~   76 (280)
T PRK07417         59 CDLVILALPIGLLLPPSE   76 (280)
T ss_pred             CCEEEECCCHHHHHHHHH
T ss_conf             998998797477899999


No 181
>TIGR01283 nifE nitrogenase MoFe cofactor biosynthesis protein NifE; InterPro: IPR005973    The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges. All known Mo-nitrogenases consist of two components, component I (also called dinitrogenase, or Fe-Mo protein), an alpha2beta2 tetramer encoded by the nifD and nifK genes, and component II (dinitrogenase reductase, or Fe protein) a homodimer encoded by the nifH gene. Two operons, nifDK and nifEN, encode a tetrameric (alpha2beta2 and N2E2) enzymatic complex. Nitrogenase contains two unusual rare metal clusters; one of them is the iron molybdenum cofactor (FeMo-co), which is considered to be the site of dinitrogen reduction and whose biosynthesis requires the products of nifNE and of some other nif genes. It has been proposed that NifNE might serve as a scaffold upon which FeMo-co is built and then inserted into component I. ; GO: 0005515 protein binding, 0006461 protein complex assembly, 0009399 nitrogen fixation.
Probab=47.64  E-value=22  Score=16.29  Aligned_cols=112  Identities=13%  Similarity=0.160  Sum_probs=66.7

Q ss_pred             CHHHHHHCCCCCCEECCC-CCCCHHHHHHHHHHHHH-------------------------HHCCCCCCCCEE-EECC-C
Q ss_conf             006776301244124043-33202467876557664-------------------------200133677304-6104-5
Q gi|255764473|r  111 SRLLELTEYATVPVINAL-TDNTHPCQIIADIMTFE-------------------------EHRGSVKGKLFS-WSGD-G  162 (306)
Q Consensus       111 ~~~~~~~~~~~vpvINa~-~~~~HPtQaL~D~~Ti~-------------------------e~~g~l~~~~i~-~vGd-~  162 (306)
                      ....++.+.=.+|.||+- =|.+==+|+|.++.-+.                         +++..|+|+|++ |+|- .
T Consensus       269 nlA~~m~~~YGIPyf~~SFyGi~Dt~~aLr~~A~~fgd~~l~~RtE~li~~E~~~~~~~l~~yR~~L~GKkaaiY~GGa~  348 (470)
T TIGR01283       269 NLARKMEEKYGIPYFEVSFYGIEDTSKALRDIAELFGDEELLKRTEELIAEEEAKIRPELEPYRERLKGKKAAIYTGGAV  348 (470)
T ss_pred             HHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             89999996468975872141088899999999976398879999999999999999999999899734988998658647


Q ss_pred             CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHC-CCCCCCCCC--CHHHH-----CCCCCCCCCCCE
Q ss_conf             55543101001233125765200001321000024320-133222136--64663-----068733222100
Q gi|255764473|r  163 NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARN-QGASVALFH--DAVQA-----VKGAHCVFTDTW  226 (306)
Q Consensus       163 ~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~-~g~~i~~~~--d~~ea-----l~~aD~V~~~~~  226 (306)
                        =.-|+|.++.-||++|...+-..--+.+ + +.++. .+......+  ++.+.     =..||+++....
T Consensus       349 --KswSlv~Al~dLGMeVV~~GTqkg~~ED-y-~~I~e~~~~~~~m~Dd~~p~~L~~~~~~~~ADlliaGgk  416 (470)
T TIGR01283       349 --KSWSLVSALQDLGMEVVATGTQKGTEED-Y-ERIRELMGEGTVMLDDANPRELLKLLLEYKADLLIAGGK  416 (470)
T ss_pred             --HHHHHHHHHHHCCCEEEEEEECCCCHHH-H-HHHHHHHCCCCEEEECCCHHHHHHHHHHHCCCEEEECCH
T ss_conf             --8999998884579179998300798889-9-999997079967862588789999998728988985731


No 182
>KOG2431 consensus
Probab=47.59  E-value=5.3  Score=20.30  Aligned_cols=37  Identities=19%  Similarity=0.275  Sum_probs=22.6

Q ss_pred             HHHCCCCCC--EECCCCCCCHHHHH-----HHHHHHHHHHCCCC
Q ss_conf             763012441--24043332024678-----76557664200133
Q gi|255764473|r  115 ELTEYATVP--VINALTDNTHPCQI-----IADIMTFEEHRGSV  151 (306)
Q Consensus       115 ~~~~~~~vp--vINa~~~~~HPtQa-----L~D~~Ti~e~~g~l  151 (306)
                      .+...+.||  =||.+++.+||-+.     ++.+.|++-.|..+
T Consensus       210 AF~sps~IPysdVnL~~~~A~~p~~~~~SStaEvttiQlEfr~L  253 (546)
T KOG2431         210 AFSSPSPIPYSDVNLGTGTAHPPRWTGDSSTAEVTTIQLEFRYL  253 (546)
T ss_pred             HHCCCCCCCCCEEECCCCCCCCCCCCCCCCHHHHEEEEEEHHHH
T ss_conf             64589999840014577763699988763223300000007888


No 183
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine
Probab=47.43  E-value=22  Score=16.27  Aligned_cols=22  Identities=18%  Similarity=0.163  Sum_probs=9.0

Q ss_pred             CCCCHHHHHHCCCCCC---EECCCC
Q ss_conf             1320067763012441---240433
Q gi|255764473|r  108 TNHSRLLELTEYATVP---VINALT  129 (306)
Q Consensus       108 ~~~~~~~~~~~~~~vp---vINa~~  129 (306)
                      |-+-..+.+.+.+..|   ||..|+
T Consensus       119 PvDvmt~~~~k~sg~p~~rViG~gT  143 (306)
T cd05291         119 PVDVITYVVQKLSGLPKNRVIGTGT  143 (306)
T ss_pred             CHHHHHHHHHHHCCCCHHHEECCCC
T ss_conf             1678999999850998666115454


No 184
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=47.25  E-value=12  Score=17.90  Aligned_cols=30  Identities=20%  Similarity=0.197  Sum_probs=14.8

Q ss_pred             HHHHHHHHC--CCEEEEEECCCCHHHHHHCCC
Q ss_conf             999975300--101112101320067763012
Q gi|255764473|r   91 DTAKVLSRY--VDAIVMRTTNHSRLLELTEYA  120 (306)
Q Consensus        91 Dt~~~ls~~--~D~iviR~~~~~~~~~~~~~~  120 (306)
                      +..+-++.+  .|+|+.=..+.-.+.++++..
T Consensus        99 ~vf~~le~~~~~~~IlaSnTSsl~is~la~~~  130 (282)
T PRK05808         99 KIFAQLDEIAKPEAILATNTSSLSITELAAAT  130 (282)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHC
T ss_conf             99999995579984899758877669999772


No 185
>TIGR02992 ectoine_eutC ectoine utilization protein EutC; InterPro: IPR014334   Members of this entry are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, Pseudomonas putida and Sinorhizobium meliloti 1021, where it is known to be induced by ectoine). Members belong to the ornithine cyclodeaminase/mu-crystallin family..
Probab=47.17  E-value=9.7  Score=18.54  Aligned_cols=30  Identities=27%  Similarity=0.336  Sum_probs=25.0

Q ss_pred             HHHHCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             243201332221366466306873322210
Q gi|255764473|r  196 NWARNQGASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       196 ~~~~~~g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      +..+..|..++..+|+.+|+..||+|.|..
T Consensus       173 ~L~~~~G~~v~a~td~~~A~~~ADI~vTtT  202 (326)
T TIGR02992       173 QLSSELGIDVTAATDVRAALSGADIIVTTT  202 (326)
T ss_pred             HHHHHCCEEEEECCCHHHHCCCCCEEEECC
T ss_conf             988746906875047686236688798748


No 186
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators. This group includes the ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding
Probab=47.03  E-value=20  Score=16.51  Aligned_cols=101  Identities=15%  Similarity=0.209  Sum_probs=56.8

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEE--CCCCHHHHHHCCCCCCEECCCCC--
Q ss_conf             35789999898634754333321000012321079999975-30010111210--13200677630124412404333--
Q gi|255764473|r   56 TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRT--TNHSRLLELTEYATVPVINALTD--  130 (306)
Q Consensus        56 tRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~--~~~~~~~~~~~~~~vpvINa~~~--  130 (306)
                      .+---+.|.++++.|-+++..+.....    |.-.+.++.| +..+|++++=.  ..+....+......+||+-....  
T Consensus        15 ~~~~~gie~~~~~~Gy~~~i~~t~~~~----~~e~~~i~~l~~~~vdGiIi~~~~~~~~~~~~~l~~~~iPvV~~~~~~~   90 (266)
T cd06282          15 AECVQGIQEEARAAGYSLLLATTDYDA----EREADAVETLLRQRVDGLILTVADAATSPALDLLDAERVPYVLAYNDPQ   90 (266)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCH----HHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCC
T ss_conf             999999999999879989999799997----9999999999965998799963787755999999855997899950478


Q ss_pred             CCHHHHHHHHHHH----HHHHCCCCCCCCEEEECC
Q ss_conf             2024678765576----642001336773046104
Q gi|255764473|r  131 NTHPCQIIADIMT----FEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus       131 ~~HPtQaL~D~~T----i~e~~g~l~~~~i~~vGd  161 (306)
                      ..+|| +-.|-+.    +-++.-..-..+|++++.
T Consensus        91 ~~~~~-V~~Dn~~~~~~~~~~L~~~G~~~i~~i~~  124 (266)
T cd06282          91 PGRPS-VSVDNRAAARDVAQALAALGHRRIAMLAG  124 (266)
T ss_pred             CCCCE-EEECHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             99998-99887999999999999739956999977


No 187
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. This group represents the ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of GntR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding, 
Probab=46.80  E-value=22  Score=16.20  Aligned_cols=101  Identities=13%  Similarity=0.139  Sum_probs=56.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHH-HHHCCCEEEEEECC-CCHHHHHHCCCCCCEECCCCCCCHHH
Q ss_conf             78999989863475433332100001232107999997-53001011121013-20067763012441240433320246
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKV-LSRYVDAIVMRTTN-HSRLLELTEYATVPVINALTDNTHPC  135 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~-ls~~~D~iviR~~~-~~~~~~~~~~~~vpvINa~~~~~HPt  135 (306)
                      ---+.|.++.+.|-+++..+... +..+.   ++.+.. ++..+|++++-... ........+..++||+-.++...+|.
T Consensus        17 l~~gi~~~~~~~gy~~~i~~s~~-d~~~e---~~~i~~l~~~~vDGiIi~~~~~~~~~~~~l~~~~iPvV~~~~~~~~~~   92 (268)
T cd01575          17 VLQGISDVLEAAGYQLLLGNTGY-SPERE---EELLRTLLSRRPAGLILTGLEHTERTRQLLRAAGIPVVEIMDLPPDPI   92 (268)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCC-CHHHH---HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             99999999998699999997899-98999---999999995699999994377998999999977996998488688888


Q ss_pred             H--HHHHHHH----HHHHCCCCCCCCEEEECCC
Q ss_conf             7--8765576----6420013367730461045
Q gi|255764473|r  136 Q--IIADIMT----FEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus       136 Q--aL~D~~T----i~e~~g~l~~~~i~~vGd~  162 (306)
                      .  .-.|-+.    .-++.-..--.+|++++..
T Consensus        93 ~~~V~~Dn~~~~~~a~~~L~~~G~~~i~~i~~~  125 (268)
T cd01575          93 DMAVGFSHAEAGRAMARHLLARGYRRIGFLGAR  125 (268)
T ss_pred             CCEEECCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             858973889999999999997499769998489


No 188
>PRK08618 ornithine cyclodeaminase; Validated
Probab=46.54  E-value=11  Score=18.15  Aligned_cols=72  Identities=13%  Similarity=0.121  Sum_probs=37.5

Q ss_pred             CCCCEEEECCCCCCCCCHHHCCCC-CCE-EEEEECHHCCCCCCCCHHHH-HCCCCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             677304610455554310100123-312-57652000013210000243-201332221366466306873322210
Q gi|255764473|r  152 KGKLFSWSGDGNNILHSLIEGAAR-FNY-LLNIATPIGSEPRNEYLNWA-RNQGASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       152 ~~~~i~~vGd~~~v~hS~i~~~~~-~g~-~v~~~~P~~~~~~~~~~~~~-~~~g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      +..+++++|-+. .++..++++.. .+. ++.+..+..- -...+.+.. ...|..+....+++++++++|+|.+-.
T Consensus       126 ~a~~l~iiGaG~-QA~~~~~a~~~v~~i~~v~v~~r~~~-~~~~f~~~~~~~~g~~v~~~~~~~~av~~aDiV~taT  200 (325)
T PRK08618        126 DAKTLCLIGTGG-QAKGQLEAVLAVRDIEKVRVYSRTFE-KAYAFAQEIQSKFNTEIYVVESADEAIEEADIIVTVT  200 (325)
T ss_pred             CCCEEEEECCHH-HHHHHHHHHHHCCCCCEEEEEECCHH-HHHHHHHHHHHHCCCCEEEECCHHHHHHHCCEEEEEC
T ss_conf             985699975607-99999999986089668999947999-9999999998750996699589999984398899925


No 189
>PRK08341 amidophosphoribosyltransferase; Provisional
Probab=46.48  E-value=21  Score=16.39  Aligned_cols=114  Identities=15%  Similarity=0.248  Sum_probs=63.8

Q ss_pred             CCCCCCCCCCCCCCCHHHHHH----HHHH--CCCE-EEEEECCCCHH--HHHHCCCCCCEECCCC-----C-C-CHHHHH
Q ss_conf             333210000123210799999----7530--0101-11210132006--7763012441240433-----3-2-024678
Q gi|255764473|r   74 IFLSGSEMQLGRAETIGDTAK----VLSR--YVDA-IVMRTTNHSRL--LELTEYATVPVINALT-----D-N-THPCQI  137 (306)
Q Consensus        74 ~~~~~~~ss~~kgEsl~Dt~~----~ls~--~~D~-iviR~~~~~~~--~~~~~~~~vpvINa~~-----~-~-~HPtQa  137 (306)
                      +||.-.+| .-.|.++.+.=+    .|+.  -+|+ +|+=.|+.+..  .-+++.+.+|.-.+.-     + . =-|+| 
T Consensus       239 IYFarpdS-~~~g~~Vy~~R~~~G~~LA~e~~~~~DvVi~VPdSg~~aa~Gya~~~gip~~~glikn~y~gRtFI~P~q-  316 (442)
T PRK08341        239 IYFARPDS-TINGVSVYHARYRMGVELARESPAEGDVVIAVPDSGRTAALGFAHESGIPYMEGLIKNRYIGRTFIMPSG-  316 (442)
T ss_pred             EECCCCCC-CCCCEEHHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHCCCCHHHHEEECCCCCCCCCCCCC-
T ss_conf             40147863-0788689999999999986128987898996289749999999986299524300000121554438873-


Q ss_pred             HHHHHHHHHH----CCCCCCCCEEEECCC---CCCCCCHHHCCCCCCEE---EEEECHHCCCCC
Q ss_conf             7655766420----013367730461045---55543101001233125---765200001321
Q gi|255764473|r  138 IADIMTFEEH----RGSVKGKLFSWSGDG---NNILHSLIEGAARFNYL---LNIATPIGSEPR  191 (306)
Q Consensus       138 L~D~~Ti~e~----~g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~~---v~~~~P~~~~~~  191 (306)
                       -+.- .+-+    +..++|++|.+|=|.   +++....+..+...|++   +.+++|+--.|.
T Consensus       317 -R~~~-v~~Kl~~~~~~i~gK~vvlvDDSIVRGtT~k~iv~~Lr~aGAkeVh~ri~sPpi~~pC  378 (442)
T PRK08341        317 -RELK-VKLKLSPVREVINGKRVVLVDDSIVRGTTMKRIVKMLRDAGAREVHVRIASPPIRYPC  378 (442)
T ss_pred             -HHHC-EEEEEEEEEEEECCCCEEEEECCEEECCCHHHHHHHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             -0021-0446501000127981499614341054299999999976998899996899857777


No 190
>PRK06608 threonine dehydratase; Provisional
Probab=46.31  E-value=17  Score=17.00  Aligned_cols=38  Identities=13%  Similarity=0.059  Sum_probs=26.0

Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             94288835789999898634754333321000012321
Q gi|255764473|r   50 IFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAE   87 (306)
Q Consensus        50 lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgE   87 (306)
                      +.+-+|-=+=.|...|++.+|..++.+=+.+.+..|-+
T Consensus        76 vv~aSsGNhG~alA~aa~~~G~~~~I~mP~~~~~~Ki~  113 (330)
T PRK06608         76 IVAYSTGNHGIAVAYASKLFGIKTRIYLPLNTSKVKQQ  113 (330)
T ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCHHHHH
T ss_conf             79867886699999999854986389845658899999


No 191
>PRK07660 consensus
Probab=46.10  E-value=15  Score=17.28  Aligned_cols=13  Identities=8%  Similarity=0.227  Sum_probs=5.1

Q ss_pred             HHHCCHHHHHHHH
Q ss_conf             4458999999999
Q gi|255764473|r   11 LSNISSSNLSCII   23 (306)
Q Consensus        11 ~~dl~~~~i~~ll   23 (306)
                      +.|.+.+.+..-.
T Consensus        31 l~D~~~~~l~~~~   43 (283)
T PRK07660         31 VQDLKQEQLDRGL   43 (283)
T ss_pred             EEECCHHHHHHHH
T ss_conf             9979889999999


No 192
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=45.05  E-value=19  Score=16.63  Aligned_cols=131  Identities=19%  Similarity=0.289  Sum_probs=79.9

Q ss_pred             ECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHH----HHHH--CCCE-EEEEECCCCH--HHHHHCCCC
Q ss_conf             42888357899998986347543333210000123210799999----7530--0101-1121013200--677630124
Q gi|255764473|r   51 FEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAK----VLSR--YVDA-IVMRTTNHSR--LLELTEYAT  121 (306)
Q Consensus        51 F~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~----~ls~--~~D~-iviR~~~~~~--~~~~~~~~~  121 (306)
                      |.++..|+-++||-         +||.-.+|.+. |.++.+.=.    .|+.  ..++ +|+-.|+.+.  ...+++.+.
T Consensus       237 ~~~~~~~~~C~fEy---------VYFARPDS~Id-g~sVy~~R~~mG~~La~e~~~eaDvVipVPDSg~~aAig~A~~sG  306 (470)
T COG0034         237 VAEPPRRAPCSFEY---------VYFARPDSVID-GISVYEARKRMGEKLAEEIPVEADVVIPVPDSGRPAAIGYARASG  306 (470)
T ss_pred             CCCCCCCCCCEEEE---------EEEECCCCCCC-CEEHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHC
T ss_conf             14788886444889---------98506742248-856999999999999875873365798349887689999999839


Q ss_pred             CCEECCC-----CC-C-CHHHHHHHHHHH---HHHHCCCCCCCCEEEECCC---CCCCCCHHHCCCCCCE---EEEEECH
Q ss_conf             4124043-----33-2-024678765576---6420013367730461045---5554310100123312---5765200
Q gi|255764473|r  122 VPVINAL-----TD-N-THPCQIIADIMT---FEEHRGSVKGKLFSWSGDG---NNILHSLIEGAARFNY---LLNIATP  185 (306)
Q Consensus       122 vpvINa~-----~~-~-~HPtQaL~D~~T---i~e~~g~l~~~~i~~vGd~---~~v~hS~i~~~~~~g~---~v~~~~P  185 (306)
                      +|.--++     -+ . =-|||.|=-.--   +--.+.-++|++|+.|-|.   +.+-+-.+..+..-|+   .+.+++|
T Consensus       307 iPy~~GliKNrYvgRTFI~P~q~~R~~~Vr~KLnpvr~~v~GKrVvlVDDSIVRGTTsr~IV~mlReAGAkEVHvriasP  386 (470)
T COG0034         307 IPYEEGLIKNRYVGRTFIMPTQELREKGVRLKLNPVREVVKGKRVVLVDDSIVRGTTSRRIVQMLREAGAKEVHVRIASP  386 (470)
T ss_pred             CCHHHCCCCCCCCCEEEECCCHHHHHHHHHHHCCCHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             96555521023243466688678877503030370178858976999726514576699999999971887889984289


Q ss_pred             HCCCCC
Q ss_conf             001321
Q gi|255764473|r  186 IGSEPR  191 (306)
Q Consensus       186 ~~~~~~  191 (306)
                      +-..|.
T Consensus       387 ~i~~Pc  392 (470)
T COG0034         387 PIRYPC  392 (470)
T ss_pred             CCCCCC
T ss_conf             756778


No 193
>pfam02639 DUF188 Uncharacterized BCR, YaiI/YqxD family COG1671.
Probab=43.12  E-value=21  Score=16.33  Aligned_cols=21  Identities=10%  Similarity=0.061  Sum_probs=11.2

Q ss_pred             HCCCCCCEEEEEECHHCCCCC
Q ss_conf             001233125765200001321
Q gi|255764473|r  171 EGAARFNYLLNIATPIGSEPR  191 (306)
Q Consensus       171 ~~~~~~g~~v~~~~P~~~~~~  191 (306)
                      .++.+++.++.+++-....++
T Consensus         4 r~A~r~~i~v~~Van~~~~~p   24 (130)
T pfam02639         4 RAAERHGIPVTLVANQPHRLP   24 (130)
T ss_pred             EHHHHHCCEEEEEECCCCCCC
T ss_conf             011343977999958980489


No 194
>pfam00532 Peripla_BP_1 family. This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators. The periplasmic binding proteins are the primary receptors for chemotaxis and transport of many sugar based solutes. The LacI family of proteins consist of transcriptional regulators related to the lac repressor. In this case, generally the sugar binding domain binds a sugar which changes the DNA binding activity of the repressor domain (pfam00356).
Probab=43.05  E-value=25  Score=15.83  Aligned_cols=69  Identities=22%  Similarity=0.245  Sum_probs=43.2

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECC--CCHHHHHHCCCCCCEECCCC
Q ss_conf             5789999898634754333321000012321079999975-3001011121013--20067763012441240433
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTN--HSRLLELTEYATVPVINALT  129 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~--~~~~~~~~~~~~vpvINa~~  129 (306)
                      +---..|.++++.|-+++..+.....    |.-+...+.+ +..+|++++-...  ...+..+.+...+||+-.+.
T Consensus        18 ~i~~gie~~a~~~Gy~~ll~~t~~~~----~~e~~~l~~l~~~~vDGiIi~~~~~~~~~~~~~~~~~~iPvV~~~~   89 (281)
T pfam00532        18 DLVKGITKAAKDHGFDVFLLAVGDGE----DTLTNAIDLLLASGADGIIITTPAPSGDDITAKAEGYGIPVIAADD   89 (281)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCH----HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEC
T ss_conf             99999999999839989999799998----9999999999965999899936889849999999857997899924


No 195
>KOG0953 consensus
Probab=42.81  E-value=14  Score=17.59  Aligned_cols=12  Identities=17%  Similarity=0.196  Sum_probs=4.3

Q ss_pred             CCCCHHHHHHHH
Q ss_conf             888357899998
Q gi|255764473|r   53 KPSTRTRVSFEV   64 (306)
Q Consensus        53 e~StRTR~SFe~   64 (306)
                      ..+.++-.||-.
T Consensus       108 ~~~~~~~~sf~~  119 (700)
T KOG0953         108 PLFPAAFISFRI  119 (700)
T ss_pred             CCCHHHHHHHHH
T ss_conf             110556678998


No 196
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro: IPR005992    This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase. Most species with a member of this family belong to the high GC Gram-positive bacteria..
Probab=42.80  E-value=25  Score=15.81  Aligned_cols=120  Identities=21%  Similarity=0.297  Sum_probs=64.2

Q ss_pred             HHHHH-HHHHCCCEEEEEEC----------CC--CHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCE
Q ss_conf             99999-75300101112101----------32--0067763012441240433320246787655766420013367730
Q gi|255764473|r   90 GDTAK-VLSRYVDAIVMRTT----------NH--SRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLF  156 (306)
Q Consensus        90 ~Dt~~-~ls~~~D~iviR~~----------~~--~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i  156 (306)
                      ...+. ++...+|++|||..          ++  -.|.+|..-.+||||-+|+..+  +-+| .   |.+. | =-+.-|
T Consensus       146 ~~~a~~vv~AG~DLLvIqgT~vSaehv~~e~~E~LnLk~fi~eLDvPVv~Ggv~~Y--~~AL-h---LMRt-G-AagvlV  217 (376)
T TIGR01304       146 SKLAPVVVEAGADLLVIQGTVVSAEHVSSESGEPLNLKKFIQELDVPVVAGGVVTY--TTAL-H---LMRT-G-AAGVLV  217 (376)
T ss_pred             HHHHHHHHHHCCCEEEEHHHHHHHEEECCCCCCCHHHHHHHHHCCCCEEECCCCCH--HHHH-H---HHHH-C-CEEEEE
T ss_conf             78889999717300420012320100468888721488897548988788385308--8999-9---8630-1-137886


Q ss_pred             EEECCCCCCCCCHHHCCCCCCEEEEEECH--HCCCCCCCCHHHHHCCCC---------CCCCCCCHHHHC-CCCCCCCCC
Q ss_conf             46104555543101001233125765200--001321000024320133---------222136646630-687332221
Q gi|255764473|r  157 SWSGDGNNILHSLIEGAARFNYLLNIATP--IGSEPRNEYLNWARNQGA---------SVALFHDAVQAV-KGAHCVFTD  224 (306)
Q Consensus       157 ~~vGd~~~v~hS~i~~~~~~g~~v~~~~P--~~~~~~~~~~~~~~~~g~---------~i~~~~d~~eal-~~aD~V~~~  224 (306)
                      .|.|.....-.+.+     ||+.|--.+=  ...--+.+|+   ++.|.         .|..+=|+.+++ =+||.|+.-
T Consensus       218 GfgG~ga~~T~~~v-----LG~~VpmATAiAD~AAARrDYL---dEtGGRYVHviADG~i~~sGd~~KAIACGADAV~lG  289 (376)
T TIGR01304       218 GFGGPGAATTTREV-----LGIEVPMATAIADVAAARRDYL---DETGGRYVHVIADGGIETSGDLAKAIACGADAVVLG  289 (376)
T ss_pred             CCCCCCCCCCCCCC-----CEECCCCHHHHHHHHHHHHHHH---HCCCCCEEEEEEECCCCCCCCHHHHEECCCCHHHHC
T ss_conf             45788734246653-----4210672678999997301133---306893377886287055463001001377602007


Q ss_pred             C
Q ss_conf             0
Q gi|255764473|r  225 T  225 (306)
Q Consensus       225 ~  225 (306)
                      .
T Consensus       290 S  290 (376)
T TIGR01304       290 S  290 (376)
T ss_pred             C
T ss_conf             8


No 197
>pfam02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain. This family also includes lambda crystallin.
Probab=42.61  E-value=15  Score=17.34  Aligned_cols=67  Identities=12%  Similarity=0.018  Sum_probs=38.7

Q ss_pred             CEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCC--CC----HHHHHC-----------CCCCCCCCCCHHHHCCC
Q ss_conf             30461045555431010012331257652000013210--00----024320-----------13322213664663068
Q gi|255764473|r  155 LFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRN--EY----LNWARN-----------QGASVALFHDAVQAVKG  217 (306)
Q Consensus       155 ~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~--~~----~~~~~~-----------~g~~i~~~~d~~eal~~  217 (306)
                      ||+++|- +.+..++...++.-|++|.+..+..-....  ..    ++....           .-..++...|+.+ +.+
T Consensus         1 kV~ViGa-G~mG~~iA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~~l~~-~~~   78 (180)
T pfam02737         1 KVAVIGA-GTMGAGIAQVFARAGLEVVLVDISEEALEKARARIEKSLARLVEKGRLTEEDVDAVLARISFTTDLAD-AVD   78 (180)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHH-HCC
T ss_conf             9899997-88999999999967993999979989999999999998999997256756769999852410588999-758


Q ss_pred             CCCCCC
Q ss_conf             733222
Q gi|255764473|r  218 AHCVFT  223 (306)
Q Consensus       218 aD~V~~  223 (306)
                      +|+|.-
T Consensus        79 adlViE   84 (180)
T pfam02737        79 ADLVIE   84 (180)
T ss_pred             CCEEEE
T ss_conf             999999


No 198
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19. Gamma-glutamyl phosphate reductase (GPR), a L-proline biosynthetic pathway (PBP) enzyme that catalyzes the NADPH dependent reduction of L-gamma-glutamyl  5-phosphate into L-glutamate 5-semialdehyde and phosphate. The glutamate route of the PBP involves two enzymatic steps catalyzed by gamma-glutamyl kinase (GK, EC 2.7.2.11) and GPR (EC 1.2.1.41). These enzymes are fused into the bifunctional enzyme, ProA or delta(1)-pyrroline-5-carboxylate synthetase (P5CS) in plants and animals, whereas they are separate enzymes in bacteria and yeast. In humans, the P5CS (ALDH18A1), an inner mitochondrial membrane enzyme, is essential to the de novo synthesis of the amino acids proline and arginine. Tomato (Lycopersicon esculentum) has both the prokaryotic-like polycistronic operons encoding GK and GPR (PRO1, ALDH19) and the full-length, bifunctional P5CS (PRO2, ALDH18B1).
Probab=42.25  E-value=26  Score=15.75  Aligned_cols=114  Identities=23%  Similarity=0.379  Sum_probs=58.4

Q ss_pred             HCCHHHHHHHHHHHHHHHHHHHCC---C-------------CCCCCCCCEEEEEECCCCCHHHHHHHHHHHH-CCCCCCC
Q ss_conf             589999999999999999665236---6-------------6544379879999428883578999989863-4754333
Q gi|255764473|r   13 NISSSNLSCIIEVAKKIKNSSENI---F-------------ENKPLSGKVLAMIFEKPSTRTRVSFEVAMKH-LGGDTIF   75 (306)
Q Consensus        13 dl~~~~i~~ll~~A~~~k~~~~~~---~-------------~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~-LG~~~~~   75 (306)
                      -|+++.+..+.+-.+.+...+...   .             ...|+  -+|+.+|+-   |--+.-..|+.- -.|+++.
T Consensus        65 ~L~~~ri~~~~~~l~~ia~l~DPvG~v~~~~~~~~Gl~i~~~~vPl--GVIgiIyEs---rPnvtv~~aalalksGNavI  139 (406)
T cd07079          65 LLTPERIEAMAEGLRQVAALPDPVGEVLRGWTLPNGLQIEKVRVPL--GVIGIIYES---RPNVTVDAAALCLKSGNAVI  139 (406)
T ss_pred             HCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEECC--EEEEEEECC---CCCHHHHHHHHHHHHCCEEE
T ss_conf             0899999999999999981899666403330047884478987551--899998279---97326888899998478699


Q ss_pred             CCCCC--------------------------CCCCCCCCHHHHHHHH--HHCCCEEEEEECCCCHHHHHHCCCCCCEECC
Q ss_conf             32100--------------------------0012321079999975--3001011121013200677630124412404
Q gi|255764473|r   76 LSGSE--------------------------MQLGRAETIGDTAKVL--SRYVDAIVMRTTNHSRLLELTEYATVPVINA  127 (306)
Q Consensus        76 ~~~~~--------------------------ss~~kgEsl~Dt~~~l--s~~~D~iviR~~~~~~~~~~~~~~~vpvINa  127 (306)
                      +.++.                          .++-.+.+-+.+...+  ..++|+++.|+. ........+.+.+|||-.
T Consensus       140 Lk~g~ea~~s~~~l~~~i~~al~~~glP~~~v~~v~~~~~~~v~~ll~~~~~IdliiprG~-~~lv~~v~~~a~vPvl~~  218 (406)
T cd07079         140 LRGGSEALHSNRALVEIIQEALEEAGLPEDAVQLIPDTDREAVQELLKLDDYIDLIIPRGG-AGLIRFVVENATIPVIKH  218 (406)
T ss_pred             EECCHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEECCCCHHHHHHHHHCCCCCCEEEECCC-HHHHHHHHHHCCCCEEEC
T ss_conf             8065566558999999999999873969789798268973467888704776316861586-689999998666978944


Q ss_pred             CCCCC
Q ss_conf             33320
Q gi|255764473|r  128 LTDNT  132 (306)
Q Consensus       128 ~~~~~  132 (306)
                      |.|..
T Consensus       219 ~~G~~  223 (406)
T cd07079         219 GDGNC  223 (406)
T ss_pred             CCCCC
T ss_conf             89975


No 199
>TIGR00169 leuB 3-isopropylmalate dehydrogenase; InterPro: IPR004429   Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the dimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs. These enzymes dehydrogenate their substates at a H-C-OH site adjacent to a H-C-COOH site; the latter carbon, now adjacent to a carbonyl group, readily decarboxylates. Among these decarboxylating dehydrogenases of hydroxyacids, overall sequence homology indicates evolutionary history rather than actual substrate or cofactor specifity, which may be toggled experimentally by replacement of just a few amino acids. 3-isopropylmalate dehydrogenase is an NAD-dependent enzyme and should have a sequence resembling HGSAPDI around residue 340. The subtrate binding loop should include a sequence resembling E[KQR]X(0,1)LLXXR around residue 115.; GO: 0003862 3-isopropylmalate dehydrogenase activity, 0009098 leucine biosynthetic process, 0005737 cytoplasm.
Probab=41.89  E-value=21  Score=16.41  Aligned_cols=45  Identities=27%  Similarity=0.299  Sum_probs=30.9

Q ss_pred             HHHHHHHHHHHCC-CCCCCCCCC----CCCCCCCCCHHHHHHHHHHCCCEEEE
Q ss_conf             7899998986347-543333210----00012321079999975300101112
Q gi|255764473|r   58 TRVSFEVAMKHLG-GDTIFLSGS----EMQLGRAETIGDTAKVLSRYVDAIVM  105 (306)
Q Consensus        58 TR~SFe~A~~~LG-~~~~~~~~~----~ss~~kgEsl~Dt~~~ls~~~D~ivi  105 (306)
                      +|..||+|.+|=+ .++.-+|..    .|.++ .|+++++++  +.|.|+=.-
T Consensus       174 aR~AFe~A~kr~~P~~vTSvDKANVL~sS~LW-R~~V~e~~~--~eYPdv~L~  223 (370)
T TIGR00169       174 ARVAFEMARKRRKPLKVTSVDKANVLESSRLW-RKTVEEIAK--EEYPDVELE  223 (370)
T ss_pred             HHHHHHHHHHCCCCCCEEEECHHHHHHHHHHH-HHHHHHHHH--CCCCCEEEC
T ss_conf             99999999854889853210012045543789-999999984--688805730


No 200
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=41.80  E-value=11  Score=18.10  Aligned_cols=20  Identities=20%  Similarity=0.152  Sum_probs=11.0

Q ss_pred             CCHHHCCCCCCEEEEEECHH
Q ss_conf             31010012331257652000
Q gi|255764473|r  167 HSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       167 hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +|+..-+...|..++.++|-
T Consensus       169 ~~la~e~~~~gIrvN~I~PG  188 (250)
T PRK12825        169 KALARELAERGIRVNAVAPG  188 (250)
T ss_pred             HHHHHHHHHHCEEEEEEEEC
T ss_conf             99999860429299999728


No 201
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional
Probab=41.74  E-value=20  Score=16.46  Aligned_cols=166  Identities=10%  Similarity=0.144  Sum_probs=69.2

Q ss_pred             HHCCHHHHHHHHHHHHH--HHHHHHCCCCC-CCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             45899999999999999--99665236665-4437987999942888357899998986347543333210000123210
Q gi|255764473|r   12 SNISSSNLSCIIEVAKK--IKNSSENIFEN-KPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAET   88 (306)
Q Consensus        12 ~dl~~~~i~~ll~~A~~--~k~~~~~~~~~-~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEs   88 (306)
                      .+++++-++.++.+--.  +.+....+.+. .+-. +.|+.+  -..-+---=|.--...-|-.|..++.++     -.+
T Consensus        64 ~gv~pdliEdilRrimreSy~~e~~~~~~~~~~~~-~~i~II--GG~G~mG~~F~~~f~~sGy~V~ild~~d-----w~~  135 (374)
T PRK11199         64 LGVPPDLIEDVLRRVMRESYSSENDKGFKTLNPDL-RPVVIV--GGKGQLGRLFAKMLTLSGYQVRILEKDD-----WDR  135 (374)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CEEEEE--ECCCCHHHHHHHHHHHCCCEEEEECCCC-----CCC
T ss_conf             49886899999999999999888875022028998-717998--0798277999999996798799616444-----534


Q ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCC---EECCCCC-CCHHHHHHHHHHH-----HHHHCC----CCCCCC
Q ss_conf             79999975300101112101320067763012441---2404333-2024678765576-----642001----336773
Q gi|255764473|r   89 IGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVP---VINALTD-NTHPCQIIADIMT-----FEEHRG----SVKGKL  155 (306)
Q Consensus        89 l~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vp---vINa~~~-~~HPtQaL~D~~T-----i~e~~g----~l~~~~  155 (306)
                      ..+    +-.-.|++++=.|=+.+..-+.+-...|   ++==.+. ..-|.++++....     ++--||    .+.|..
T Consensus       136 ~~~----~~~~advViVsVPI~~T~~VI~~l~~l~~~~lL~DiTSvK~~Pl~aMl~~h~gpV~GlHPMFGP~v~sl~~Qv  211 (374)
T PRK11199        136 ADD----ILADAGMVIVSVPIHLTEEVIEKLPPLPEDCILVDLTSVKNGPLQAMLAAHSGPVLGLHPMFGPDVGSLAKQV  211 (374)
T ss_pred             HHH----HHHCCCEEEEEECHHHHHHHHHHCCCCCCCCEEEECHHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             898----8717998999814588999998577899986898610042789999998568985022778799964447876


Q ss_pred             EEEECCCCCCCCCHH-HCCCCCCEEEEEECHHCCC
Q ss_conf             046104555543101-0012331257652000013
Q gi|255764473|r  156 FSWSGDGNNILHSLI-EGAARFNYLLNIATPIGSE  189 (306)
Q Consensus       156 i~~vGd~~~v~hS~i-~~~~~~g~~v~~~~P~~~~  189 (306)
                      |.+|...+.-...|+ +.+...|+.+..+.|....
T Consensus       212 VV~c~gr~~e~~~wl~~~~~~~Ga~l~~~~~~eHD  246 (374)
T PRK11199        212 VVVCDGRQPEAYQWLLEQIQIWGARLHRISAVEHD  246 (374)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHCCEEEECCHHHHH
T ss_conf             99889998377899999999848789986888888


No 202
>PRK06407 ornithine cyclodeaminase; Provisional
Probab=41.63  E-value=12  Score=18.05  Aligned_cols=72  Identities=17%  Similarity=0.215  Sum_probs=40.2

Q ss_pred             CCCEEEECCCCCCCCCHHHCCCC-CCE-EEEEECHHCCCCCCCCHHH-HHCCCCCCCCCCCHHHHCCCCCCCCCCCE
Q ss_conf             77304610455554310100123-312-5765200001321000024-32013322213664663068733222100
Q gi|255764473|r  153 GKLFSWSGDGNNILHSLIEGAAR-FNY-LLNIATPIGSEPRNEYLNW-ARNQGASVALFHDAVQAVKGAHCVFTDTW  226 (306)
Q Consensus       153 ~~~i~~vGd~~~v~hS~i~~~~~-~g~-~v~~~~P~~~~~~~~~~~~-~~~~g~~i~~~~d~~eal~~aD~V~~~~~  226 (306)
                      ...++++|-+. -++..++++.. ++. ++.+..+.. .-...+.+. .+..|..+....+.+++++++|+|.+-..
T Consensus       118 ~~~l~iiG~G~-QA~~~~~a~~~v~~i~~v~v~~r~~-~~a~~f~~~~~~~~~~~v~~~~~~e~av~~aDiI~taT~  192 (302)
T PRK06407        118 VENFTIIGSGF-QAETQLEGMASVYNPKRIRVYSRNF-DHARAFAERFSKEFGVDIRPVDNAEAALRDADTITSITN  192 (302)
T ss_pred             CCEEEEEEEHH-HHHHHHHHHHHHCCCCEEEEEECCH-HHHHHHHHHHHHHCCCCEEEECCHHHHHHHCCEEEEECC
T ss_conf             87899996659-9999999999740773899980888-999999999864409957994899999834999999418


No 203
>TIGR00337 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism. The enzyme catalyzes the reaction L-glutamine + H2O + UTP + ATP = CTP + phosphate + ADP + L-glutamate. The enzyme exists as a dimer of identical chains that aggregates as a tetramer. This gene has been found circa 500 bp 5 upstream of enolase in both beta (Nitrosomonas europaea) and gamma (Escherichia coli) subdivisions of Proteobacterium .; GO: 0003883 CTP synthase activity, 0006221 pyrimidine nucleotide biosynthetic process.
Probab=41.38  E-value=23  Score=16.07  Aligned_cols=95  Identities=20%  Similarity=0.284  Sum_probs=60.3

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECC---CCHHHHHHCCCCCC---EECCCCC--C-CHHH----HHHHHHHHHH----HH-
Q ss_conf             210799999753001011121013---20067763012441---2404333--2-0246----7876557664----20-
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMRTTN---HSRLLELTEYATVP---VINALTD--N-THPC----QIIADIMTFE----EH-  147 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR~~~---~~~~~~~~~~~~vp---vINa~~~--~-~HPt----QaL~D~~Ti~----e~-  147 (306)
                      --|+++ .|-++-..|+||.|+..   ...-..+|-+++||   |||+-|-  . +=|-    |.|.|..+=+    .. 
T Consensus       201 QhSVKe-LRs~Gi~PD~i~cRs~~~l~~~~k~KiAlFCdV~~~aVI~~~Da~sIY~vPl~L~~egl~~~~~~rl~L~~~~  279 (571)
T TIGR00337       201 QHSVKE-LRSLGIQPDIIICRSSEPLDKSLKKKIALFCDVEEEAVINAEDASSIYEVPLLLKKEGLDDYLCRRLNLNEKP  279 (571)
T ss_pred             HHHHHH-HHHCCCCCCEEEECCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCEECCCCHHHHHHHHHCCCCCC
T ss_conf             278999-9860988868998188768977764521005889732578655524011352100043357999984378777


Q ss_pred             -------CC----------------CCCCCCEEEECCCCC-------CCCCHHHCCCCCCEEEE
Q ss_conf             -------01----------------336773046104555-------54310100123312576
Q gi|255764473|r  148 -------RG----------------SVKGKLFSWSGDGNN-------ILHSLIEGAARFNYLLN  181 (306)
Q Consensus       148 -------~g----------------~l~~~~i~~vGd~~~-------v~hS~i~~~~~~g~~v~  181 (306)
                             +|                ..+..+|++||.+-+       |.-||.-++..+...|.
T Consensus       280 ~~ee~k~rG~~~Ls~W~~~v~~~~~~~~~v~Ig~VGKY~eL~DaY~Sv~EAL~Hag~~~d~~v~  343 (571)
T TIGR00337       280 LIEEEKERGEADLSEWEELVEKLINPKEEVTIGLVGKYVELKDAYLSVIEALKHAGAKLDTKVN  343 (571)
T ss_pred             CCHHHHHCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             4201221375548999999986305525167989740025135678899999876776374256


No 204
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species. Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species. GGBP is a member of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. Moreover, the periplasmic GGBP is homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR.
Probab=41.22  E-value=27  Score=15.65  Aligned_cols=67  Identities=18%  Similarity=0.257  Sum_probs=41.4

Q ss_pred             HHHHHHHHHHCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECC
Q ss_conf             8999989863475433332-10000123210799999753001011121013200---677630124412404
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLS-GSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSR---LLELTEYATVPVINA  127 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~-~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa  127 (306)
                      +-..+.+++.+|.++...- ..+.+..+--  .+.-..++..+|+|++-.-+...   ..+.++-..||||.-
T Consensus        18 ~~g~e~~a~e~g~~v~~~~~da~~D~~~Q~--~~Ie~~I~qgvD~Iii~p~d~~~~~~~i~~A~~agIPVI~~   88 (303)
T cd01539          18 RKNLEDIQKENGGKVEFTFYDAKNNQSTQN--EQIDTALAKGVDLLAVNLVDPTAAQTVINKAKQKNIPVIFF   88 (303)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCHHHHH--HHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             999999999859957999707878999999--99999997599999994687334899999999669849998


No 205
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional
Probab=41.08  E-value=26  Score=15.78  Aligned_cols=187  Identities=17%  Similarity=0.096  Sum_probs=95.0

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC------------CCCCCCHHHHHHHH-HHCCCEEE-EEE
Q ss_conf             37987999942888357899998986347543333210000------------12321079999975-30010111-210
Q gi|255764473|r   42 LSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQ------------LGRAETIGDTAKVL-SRYVDAIV-MRT  107 (306)
Q Consensus        42 l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss------------~~kgEsl~Dt~~~l-s~~~D~iv-iR~  107 (306)
                      -.++.|+.+=-=|+   =+|..---.++|-.|..|.+.+--            +- .|-+..-+..+ +..+.... ...
T Consensus       304 ~~~~kVAVIGsGPA---GLs~A~~Lar~Gy~VTVFEalh~~GGvL~YGIPeFRLP-K~IV~~EI~~l~~lGV~f~~n~~V  379 (944)
T PRK12779        304 AVKPPIAVVGSGPS---GLINAYLLAVEGFPVTIFEAFHDLGGVLRYGIPEFRLP-NQLIDDVVEKIKLLGGRFVKNFVV  379 (944)
T ss_pred             CCCCCEEEECCCHH---HHHHHHHHHHCCCCEEEEECCCCCCCEEEECCCCCCCC-HHHHHHHHHHHHHCCEEEEECCEE
T ss_conf             67986799885768---99999999977993399944787885589558766687-899999999999678399978564


Q ss_pred             CCCCHHHHHH-C-CCCCCEEC-CCCC--CCHHHHHHH------HHHH----HHHH---C----CCCCCCCEEEECCCCCC
Q ss_conf             1320067763-0-12441240-4333--202467876------5576----6420---0----13367730461045555
Q gi|255764473|r  108 TNHSRLLELT-E-YATVPVIN-ALTD--NTHPCQIIA------DIMT----FEEH---R----GSVKGKLFSWSGDGNNI  165 (306)
Q Consensus       108 ~~~~~~~~~~-~-~~~vpvIN-a~~~--~~HPtQaL~------D~~T----i~e~---~----g~l~~~~i~~vGd~~~v  165 (306)
                      ..+..+.++. + |..|.|=. |+-.  ..=|-.-|.      |++|    ++-.   +    ....|++|+.+| ++||
T Consensus       380 Gk~~tl~eL~~eGydAVfIg~GAg~p~~l~IpGE~L~GV~sA~EfLtrvNlm~a~~~~~~tP~~~~~GK~VvVIG-GGNt  458 (944)
T PRK12779        380 GKTATLEDLKAEGFWKIFVGTGAGLPTFMNVPGEHLLGVMSANEFLTRVNLMRGLDDRYETPLPEVKGKNVFVIG-GGNT  458 (944)
T ss_pred             CCCCCHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCEEEHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEC-CCHH
T ss_conf             776889999768999899974788875689888777682568999998643123566456864267898799989-9566


Q ss_pred             CCCHHHCCCCCCEEEEEECHHC--CCCC-CCCHHHHHCCCCCCCCCCCHHHHCCCCC--CCCCCCEEEC--CCCC
Q ss_conf             4310100123312576520000--1321-0000243201332221366466306873--3222100000--0220
Q gi|255764473|r  166 LHSLIEGAARFNYLLNIATPIG--SEPR-NEYLNWARNQGASVALFHDAVQAVKGAH--CVFTDTWISM--NQEF  233 (306)
Q Consensus       166 ~hS~i~~~~~~g~~v~~~~P~~--~~~~-~~~~~~~~~~g~~i~~~~d~~eal~~aD--~V~~~~~~~~--~~~~  233 (306)
                      +---+..+.|+|.+++++.-..  ..|. .+-+..++..|..+..-.++.+.+-+..  +|-..+.+.|  ++++
T Consensus       459 AMDaARTA~RlGA~VtiVYRRt~~EMPAr~EEi~hA~EEGV~F~~L~~P~e~iGde~g~~v~~~~~~~MeLGEPD  533 (944)
T PRK12779        459 AMDAARTAKRLGGNVTIVYRRTKSEMPARVEELHHALEEGINLAVLRAPREFIGDDHTHFVTHALLDVNELGEPD  533 (944)
T ss_pred             HHHHHHHHHHCCCEEEEEEECCHHHCCCCHHHHHHHHHCCCEEEEECCCHHHEECCCCCEEEEEEEEEEECCCCC
T ss_conf             999999988529878999845876589889999889857928998149665524468977889999985358988


No 206
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor, a member of the glutamate-receptor ion channels (iGluRs). AMPA receptors are the major mediators of excitatory synaptic transmission in the central nervous system.  While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR.  AMPA receptors consist of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important roles in mediating the rapid excita
Probab=40.96  E-value=27  Score=15.63  Aligned_cols=128  Identities=13%  Similarity=0.214  Sum_probs=60.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCCCC-----CCCCCCCCCCCCCHHHHHHHH-HHC-CCEEEEEECCC----CHHHH
Q ss_conf             99994288835789999898634754333-----321000012321079999975-300-10111210132----00677
Q gi|255764473|r   47 LAMIFEKPSTRTRVSFEVAMKHLGGDTIF-----LSGSEMQLGRAETIGDTAKVL-SRY-VDAIVMRTTNH----SRLLE  115 (306)
Q Consensus        47 i~~lF~e~StRTR~SFe~A~~~LG~~~~~-----~~~~~ss~~kgEsl~Dt~~~l-s~~-~D~iviR~~~~----~~~~~  115 (306)
                      |+.+|.+.+.--...|..|+.+.--..-.     +.+..-.+....++ .+.+.+ ..+ -++..|=+|.+    ..+..
T Consensus         2 IG~iF~~~~~~~~~AF~~Av~~vN~~~~~~~~~~L~~~~~~v~~~dsf-~~~~~~C~~l~~gV~AI~Gp~s~~~~~~v~s   80 (382)
T cd06380           2 IGGLFDVDEDQEYSAFRFAISQHNTNPNSTAPFKLLPHVDNLDTSDSF-ALTNAICSQLSRGVFAIFGSYDKSSVNTLTS   80 (382)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCHH-HHHHHHHHHHHCCCEEEECCCCHHHHHHHHH
T ss_conf             466606998789999999999972687656771688898854778879-9999999998649589997785647999999


Q ss_pred             HHCCCCCCEEC--C-CCC---------CCHHH--HHHHHHHHHHHHCCCCCCCCEEEECCCC-CCCCCHHHCCCCCCEE
Q ss_conf             63012441240--4-333---------20246--7876557664200133677304610455-5543101001233125
Q gi|255764473|r  116 LTEYATVPVIN--A-LTD---------NTHPC--QIIADIMTFEEHRGSVKGKLFSWSGDGN-NILHSLIEGAARFNYL  179 (306)
Q Consensus       116 ~~~~~~vpvIN--a-~~~---------~~HPt--QaL~D~~Ti~e~~g~l~~~~i~~vGd~~-~v~hS~i~~~~~~g~~  179 (306)
                      ++...+||.|.  + .+.         .-||+  ||++|+..-..+    +...+.|-.|.+ +....+..++...+..
T Consensus        81 i~~~l~IP~I~~~~~~~~~~~~~~~~~~~~P~~~~Ai~dlV~~~~W----~~v~~iYd~d~gl~~lq~l~~~l~~~~~~  155 (382)
T cd06380          81 YSDALHVPFITPSFPTNDLDDGNQFVLQMRPSLIQALVDLIEHYGW----RKVVYLYDSDRGLLRLQQLLDYLREKDNK  155 (382)
T ss_pred             HHHCCCCCEEEEECCCCCCCCCCCEEEEECCCHHHHHHHHHHHCCC----CEEEEEEECCHHHHHHHHHHHHHHHCCCC
T ss_conf             9734689768601588976666622699278779999999997799----48999995807788999999998644995


No 207
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=40.96  E-value=17  Score=16.90  Aligned_cols=30  Identities=17%  Similarity=0.148  Sum_probs=13.4

Q ss_pred             HHHHHHHHC--CCEEEEEECCCCHHHHHHCCC
Q ss_conf             999975300--101112101320067763012
Q gi|255764473|r   91 DTAKVLSRY--VDAIVMRTTNHSRLLELTEYA  120 (306)
Q Consensus        91 Dt~~~ls~~--~D~iviR~~~~~~~~~~~~~~  120 (306)
                      +..+-++.+  .++|+.=..+.-.+.++++..
T Consensus       100 ~lf~~l~~~~~~~~IlaSNTSsl~is~la~~~  131 (292)
T PRK07530        100 KIFAQLCPVLKPEAILASNTSSISITRLASST  131 (292)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCCHHHHHHC
T ss_conf             89999986269884898758887505666643


No 208
>PRK09354 recA recombinase A; Provisional
Probab=40.92  E-value=27  Score=15.62  Aligned_cols=64  Identities=23%  Similarity=0.364  Sum_probs=44.1

Q ss_pred             CCCEEEEEECCCCCHHHHHHH--HHHHHCCCCCCCCCCCC-------------------CCCCCCCCHHHHHHHH--HHC
Q ss_conf             798799994288835789999--89863475433332100-------------------0012321079999975--300
Q gi|255764473|r   43 SGKVLAMIFEKPSTRTRVSFE--VAMKHLGGDTIFLSGSE-------------------MQLGRAETIGDTAKVL--SRY   99 (306)
Q Consensus        43 ~gk~i~~lF~e~StRTR~SFe--~A~~~LG~~~~~~~~~~-------------------ss~~kgEsl~Dt~~~l--s~~   99 (306)
                      +||.+-..=.|.|--|-++..  ..+++.|+.+.++|..+                   ++...+|-.-+++..|  +.-
T Consensus        59 ~GRivEi~G~esSGKTtlal~~iaeaQk~Gg~~a~iDaE~ald~~~a~~lGVd~d~llv~qpd~~Eqal~i~e~Lvrsg~  138 (350)
T PRK09354         59 KGRIVEIYGPESSGKTTLALHAIAEAQKAGGTAAFIDAEHALDPVYAKKLGVDIDNLLVSQPDTGEQALEIADALVRSGA  138 (350)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHCCCCHHHEEEECCCHHHHHHHHHHHHHHCCC
T ss_conf             87089998898777999999999999975994799960002798899984977157178568679999999999985488


Q ss_pred             CCEEEEE
Q ss_conf             1011121
Q gi|255764473|r  100 VDAIVMR  106 (306)
Q Consensus       100 ~D~iviR  106 (306)
                      +|+||+-
T Consensus       139 vd~IVvD  145 (350)
T PRK09354        139 VDLIVVD  145 (350)
T ss_pred             CCEEEEE
T ss_conf             4189982


No 209
>PRK09545 znuA high-affinity zinc transporter periplasmic component; Reviewed
Probab=40.81  E-value=27  Score=15.61  Aligned_cols=11  Identities=0%  Similarity=-0.239  Sum_probs=4.7

Q ss_pred             HHHCCCCCCEE
Q ss_conf             01001233125
Q gi|255764473|r  169 LIEGAARFNYL  179 (306)
Q Consensus       169 ~i~~~~~~g~~  179 (306)
                      +-..+.+||.+
T Consensus       210 f~Yfa~~ygL~  220 (308)
T PRK09545        210 YGYFEKHYGLT  220 (308)
T ss_pred             HHHHHHHCCCE
T ss_conf             79999986993


No 210
>PRK10423 transcriptional repressor RbsR; Provisional
Probab=40.34  E-value=28  Score=15.56  Aligned_cols=146  Identities=10%  Similarity=0.088  Sum_probs=74.8

Q ss_pred             HCCHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCEEEEEECCCCC----HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             589999999999999999665236665-44379879999428883----5789999898634754333321000012321
Q gi|255764473|r   13 NISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPST----RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAE   87 (306)
Q Consensus        13 dl~~~~i~~ll~~A~~~k~~~~~~~~~-~~l~gk~i~~lF~e~St----RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgE   87 (306)
                      ..+++.-..+++.|+++.-.+...... ..-+.++|++++...+.    +.-...+.++.+.|.+++......    ..|
T Consensus        24 ~Vs~~tr~rV~~aa~elgY~pn~~Ar~L~~~~s~~Igviv~~~~~~f~~~i~~~i~~~~~~~gy~~~l~~~~~----~~~   99 (327)
T PRK10423         24 FVSEAITAKVEAAIKELNYAPSALARSLKLNQTRTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEG----DEQ   99 (327)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC----CHH
T ss_conf             9999999999999998299868888877537876799997366551267889999999998599899982689----879


Q ss_pred             CHHHHHHHH-HHCCCEEEEEECC-C-CHHHHHHCCCCCCEECCCCC-CCHHHHHHH-HH----HHHHHHCCCCCCCCEEE
Q ss_conf             079999975-3001011121013-2-00677630124412404333-202467876-55----76642001336773046
Q gi|255764473|r   88 TIGDTAKVL-SRYVDAIVMRTTN-H-SRLLELTEYATVPVINALTD-NTHPCQIIA-DI----MTFEEHRGSVKGKLFSW  158 (306)
Q Consensus        88 sl~Dt~~~l-s~~~D~iviR~~~-~-~~~~~~~~~~~vpvINa~~~-~~HPtQaL~-D~----~Ti~e~~g~l~~~~i~~  158 (306)
                      ........+ +..+|++++=... + .....+.++..+|++-.... ...++.... |-    ...-++.-..--.+|++
T Consensus       100 ~~~~~l~~l~~~~vdGiIi~~~~~~~~~~~~~~~~~~iP~V~~d~~~~~~~~~~v~~d~~~~~~~a~~~L~~~Ghr~I~~  179 (327)
T PRK10423        100 RMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPSVPTVMMDWAPFDGDSDLIQDNSLLGGDLATQYLIDKGHTRIAC  179 (327)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEECCCCCCCCCCEEEECHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99999999995598769997477776289999727998689963777778888898778999999999999759974999


Q ss_pred             ECCC
Q ss_conf             1045
Q gi|255764473|r  159 SGDG  162 (306)
Q Consensus       159 vGd~  162 (306)
                      +|..
T Consensus       180 i~~~  183 (327)
T PRK10423        180 ITGP  183 (327)
T ss_pred             ECCC
T ss_conf             6688


No 211
>PRK12549 shikimate 5-dehydrogenase; Reviewed
Probab=40.24  E-value=28  Score=15.55  Aligned_cols=167  Identities=11%  Similarity=0.032  Sum_probs=85.9

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCCCCC-CCCCHHHHHHHHHH-CCCEEEEEECCCCHHHHH-------HCC---CCC
Q ss_conf             835789999898634754333321000012-32107999997530-010111210132006776-------301---244
Q gi|255764473|r   55 STRTRVSFEVAMKHLGGDTIFLSGSEMQLG-RAETIGDTAKVLSR-YVDAIVMRTTNHSRLLEL-------TEY---ATV  122 (306)
Q Consensus        55 StRTR~SFe~A~~~LG~~~~~~~~~~ss~~-kgEsl~Dt~~~ls~-~~D~iviR~~~~~~~~~~-------~~~---~~v  122 (306)
                      -.+.-.=++.+.+.||.+..|......... ..|.+.+....+.. .+.++-+=.|--..+..+       ++.   .+.
T Consensus        17 hSlSP~iHn~~~~~lgl~~~Y~~~d~~~~~~~~~~l~~~~~~~~~~~~~G~nVTiP~K~~~~~~~d~l~~~A~~igAvNT   96 (284)
T PRK12549         17 ASLTPAMHEAEGDAQGLRYVYRLIDLDALGLSADALPELLDAAERMGFNGLNITHPCKQAVIPLLDELSDDARALGAVNT   96 (284)
T ss_pred             CCCCHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCEEE
T ss_conf             03259999999998799809997532121399789999999987689988998117499999997052378998565214


Q ss_pred             CEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCCHHHHHC-
Q ss_conf             12404333202467876557664200133677304610455554310100123312-5765200001321000024320-
Q gi|255764473|r  123 PVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY-LLNIATPIGSEPRNEYLNWARN-  200 (306)
Q Consensus       123 pvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~~~~~~~-  200 (306)
                      -++.-|.-..|-|-...=...+.+....+++.++.++|-++ .+++.+.++...|+ ++.++.-..-.. ..+.+.... 
T Consensus        97 i~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~~~vlilGaGG-aa~ai~~al~~~g~~~i~I~nR~~~r~-~~l~~~l~~~  174 (284)
T PRK12549         97 VVFRDGRRIGHNTDWSGFAEGFRRGLPDASLERVVQLGAGG-AGAAVAHALLTLGVERLTLFDVDPARA-QALADELNAR  174 (284)
T ss_pred             EEEECCEEEEEECCHHHHHHHHHHHCCCCCCCEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCHHHH-HHHHHHHHHH
T ss_conf             89759989998066688999999746453557189965661-689999999976999899997988999-9999999865


Q ss_pred             -CCCCCCCCCCHHHHCCCCCCCCC
Q ss_conf             -13322213664663068733222
Q gi|255764473|r  201 -QGASVALFHDAVQAVKGAHCVFT  223 (306)
Q Consensus       201 -~g~~i~~~~d~~eal~~aD~V~~  223 (306)
                       ....+....++.+.+.++|+|+-
T Consensus       175 ~~~~~~~~~~~~~~~~~~~d~iIN  198 (284)
T PRK12549        175 FPAARVTAGSDLAAALAAADGLVH  198 (284)
T ss_pred             CCCCEEEECHHHHHHHHHCCEEEE
T ss_conf             798637641676765421382665


No 212
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=40.23  E-value=28  Score=15.55  Aligned_cols=89  Identities=19%  Similarity=0.288  Sum_probs=52.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC-------CCHHHHHHHHHHCCCEEEEEECCC---------
Q ss_conf             9999428883578999989863475433332100001232-------107999997530010111210132---------
Q gi|255764473|r   47 LAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRA-------ETIGDTAKVLSRYVDAIVMRTTNH---------  110 (306)
Q Consensus        47 i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kg-------Esl~Dt~~~ls~~~D~iviR~~~~---------  110 (306)
                      ++++=--.|--|-+|.+. |+++||.++..|  ++++.+|       =|.++...+-=   -.+=+|.+.+         
T Consensus         6 i~I~GPTAsGKT~lai~L-Ak~~~~eIIs~D--SmQvYr~mdIGTAKps~~e~~~vpH---hliDi~~p~e~ysa~~f~~   79 (308)
T COG0324           6 IVIAGPTASGKTALAIAL-AKRLGGEIISLD--SMQVYRGLDIGTAKPSLEELAGVPH---HLIDIRDPTESYSAAEFQR   79 (308)
T ss_pred             EEEECCCCCCHHHHHHHH-HHHCCCCEEECC--HHHHCCCCCCCCCCCCHHHHCCCCE---EEECCCCCCCCCCHHHHHH
T ss_conf             999898875778999999-998299289302--3553188863079999999858997---8754568322554999999


Q ss_pred             ---CHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHH
Q ss_conf             ---006776301244124043332024678765576
Q gi|255764473|r  111 ---SRLLELTEYATVPVINALTDNTHPCQIIADIMT  143 (306)
Q Consensus       111 ---~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~T  143 (306)
                         ..+.++...-.+|||=+|++.+  .|+|++=+.
T Consensus        80 ~a~~~i~~i~~rgk~pIlVGGTglY--~~aL~~g~~  113 (308)
T COG0324          80 DALAAIDDILARGKLPILVGGTGLY--LKALLEGLS  113 (308)
T ss_pred             HHHHHHHHHHHCCCCCEEECCHHHH--HHHHHCCCC
T ss_conf             9999999999689987997667999--999973876


No 213
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis. Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis. The members of this group are belonging to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily.  Like other periplasmic receptors of the ABC-type transport systems, the allose-binding protein consists of two alpha/beta domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding.
Probab=40.08  E-value=28  Score=15.54  Aligned_cols=70  Identities=16%  Similarity=0.259  Sum_probs=41.7

Q ss_pred             HHHHHHHHHHCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHH---HHHHCCCCCCEECCCCC
Q ss_conf             899998986347543333210-0001232107999997530010111210132006---77630124412404333
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGS-EMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRL---LELTEYATVPVINALTD  130 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~-~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~---~~~~~~~~vpvINa~~~  130 (306)
                      .-.+|.+++++|.++..+... .....+--+.-+  ..++..+|+|++-..+...+   .+-+....+|||.-.++
T Consensus        18 ~~g~e~~a~~~G~~v~v~~~~~~~d~~~q~~~i~--~~i~~~vdgii~~p~~~~~~~~~~~~a~~~gIpvv~~d~~   91 (275)
T cd06320          18 KEGYENEAKKLGVSVDIQAAPSEGDQQGQLSIAE--NMINKGYKGLLFSPISDVNLVPAVERAKKKGIPVVNVNDK   91 (275)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHH--HHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             9999999997499899996899758999999999--9997499879876788065699999998679909992688


No 214
>PRK10116 universal stress protein UspC; Provisional
Probab=39.55  E-value=29  Score=15.49  Aligned_cols=113  Identities=16%  Similarity=0.244  Sum_probs=57.8

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             98887717844589999999999999999665236665443798799994288835789999898634754333321000
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM   81 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s   81 (306)
                      |+| ||+|=--|++++ -..+++.|..+.+.....     +   ++.-+=.+|..-+         .++      +    
T Consensus         1 M~Y-khILVAvDlS~~-S~~~i~kA~~lA~~~~Ak-----l---slihV~~~~~~y~---------~~~------~----   51 (142)
T PRK10116          1 MSY-SNILVAVAVTPE-SQQLLAKAVSIARPVNGK-----I---SLITLASDPEMYN---------QFA------A----   51 (142)
T ss_pred             CCC-CEEEEEECCCHH-HHHHHHHHHHHHHHCCCE-----E---EEEEEECCHHHHH---------HCC------C----
T ss_conf             998-689999418850-699999999999981998-----9---9999935766652---------102------2----


Q ss_pred             CCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             01232107999997530010111210132006776301244124043332024678765576642001336773046104
Q gi|255764473|r   82 QLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus        82 s~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd  161 (306)
                           .-+.|....+         +-.....+.+++...++|+-+-.-....|.+.+.+.  ..|..-+     +.+||.
T Consensus        52 -----~~~~d~~~~~---------~e~a~~~L~~l~~~~~~pi~~~~v~~G~~~~~I~~~--a~e~~~D-----LIV~G~  110 (142)
T PRK10116         52 -----PMLEDLRSVM---------QEETQSFLDELIQKADYPIEKTFIAYGELSEHILEV--CRKHHFD-----LVICGN  110 (142)
T ss_pred             -----HHHHHHHHHH---------HHHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHH--HHHHCCC-----EEEEEC
T ss_conf             -----1378899999---------999999999999874998158999965889999999--9996999-----999905


Q ss_pred             CCC
Q ss_conf             555
Q gi|255764473|r  162 GNN  164 (306)
Q Consensus       162 ~~~  164 (306)
                      +++
T Consensus       111 Hg~  113 (142)
T PRK10116        111 HNH  113 (142)
T ss_pred             CCC
T ss_conf             985


No 215
>TIGR00633 xth exodeoxyribonuclease III (xth); InterPro: IPR004808 All proteins in this family for which functions are known are 5' AP endonucleases that function in base excision repair and the repair of abasic sites in DNA.; GO: 0004518 nuclease activity, 0006281 DNA repair.
Probab=39.48  E-value=16  Score=17.05  Aligned_cols=51  Identities=20%  Similarity=0.280  Sum_probs=30.3

Q ss_pred             HCCCCCCEECCCC---C-CCHHH------HHHHHHHHHHHHCCCC-C--CCCEEEECCCCCCCCCHH
Q ss_conf             3012441240433---3-20246------7876557664200133-6--773046104555543101
Q gi|255764473|r  117 TEYATVPVINALT---D-NTHPC------QIIADIMTFEEHRGSV-K--GKLFSWSGDGNNILHSLI  170 (306)
Q Consensus       117 ~~~~~vpvINa~~---~-~~HPt------QaL~D~~Ti~e~~g~l-~--~~~i~~vGd~~~v~hS~i  170 (306)
                      +++.++-|||+=-   + ..|||      |-+.+++--.+  +.+ .  ++.|.||||.| |+|.=+
T Consensus       106 a~f~~f~v~n~YvPNg~~~~~~~rl~Yk~~~w~~~~~~~~--~~l~~~~~~pv~~cGD~N-vAh~ei  169 (279)
T TIGR00633       106 AEFDGFYVVNVYVPNGGARGLETRLEYKLDFWEALLQYYL--KELDASDGKPVIICGDLN-VAHTEI  169 (279)
T ss_pred             EECCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHH--HHHHHCCCCCEEEECCCC-CCCCCC
T ss_conf             0105479998776686113654462788899999999999--998617999799984778-897711


No 216
>PRK09982 universal stress protein UspD; Provisional
Probab=39.43  E-value=29  Score=15.47  Aligned_cols=29  Identities=17%  Similarity=0.302  Sum_probs=24.5

Q ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             9888771784458999999999999999966
Q gi|255764473|r    2 MTYPKHFADLSNISSSNLSCIIEVAKKIKNS   32 (306)
Q Consensus         2 m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~   32 (306)
                      |+| ||+|=--|+|++- ..|++.|..+.+.
T Consensus         1 M~Y-kHILVAVdLs~eS-~~Li~KAv~lAk~   29 (142)
T PRK09982          1 MAY-KHIGVAISGNEED-ALLVNKALELARH   29 (142)
T ss_pred             CCC-CEEEEEEECCHHH-HHHHHHHHHHHHH
T ss_conf             985-1799998558416-9999999999876


No 217
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Probab=38.78  E-value=25  Score=15.82  Aligned_cols=67  Identities=16%  Similarity=0.120  Sum_probs=35.4

Q ss_pred             CCEEEECCCCCCCCCHHHCCCCC-CEEEEEEC-HHCC-CCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCC
Q ss_conf             73046104555543101001233-12576520-0001-3210000243201332221366466306873322
Q gi|255764473|r  154 KLFSWSGDGNNILHSLIEGAARF-NYLLNIAT-PIGS-EPRNEYLNWARNQGASVALFHDAVQAVKGAHCVF  222 (306)
Q Consensus       154 ~~i~~vGd~~~v~hS~i~~~~~~-g~~v~~~~-P~~~-~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~  222 (306)
                      .||+++|-.+|+.+..+.+.... ++++.-.. .... ....+.-.....  ..+.+..+..+....+|+|+
T Consensus         1 ikV~i~Ga~GrMG~~i~~~i~~~~~~~lv~~~~~~~~~~~~~d~~~~~~~--~~~~~~~~~~~~~~~~DVvI   70 (122)
T pfam01113         1 IKVAVVGASGRMGRELIKAILEAPDFELVAAVDRPGSSLLGSDAGELAGP--LGVPVTDDLEEVLADADVLI   70 (122)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCC--CCCEECCCHHHHCCCCCEEE
T ss_conf             98999889887899999999858996899999438961225431001467--87111244777515788899


No 218
>KOG1370 consensus
Probab=38.52  E-value=30  Score=15.38  Aligned_cols=242  Identities=16%  Similarity=0.134  Sum_probs=124.9

Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCC------C--
Q ss_conf             78445899999999999999996652366654437987999942888357899998986347543333210------0--
Q gi|255764473|r    9 ADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGS------E--   80 (306)
Q Consensus         9 l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~------~--   80 (306)
                      ++..+|.+.+|+--=..---+-..+++...++||+|..|+--. .--..|-.-.|+ --.||+.+..-+..      +  
T Consensus        13 i~~aafGRkeieiAE~eMPglma~r~r~~~skPlkgArI~GCl-H~tvqTAVLIET-Lv~LGAev~WssCNIfSTQdhaA   90 (434)
T KOG1370          13 ISQAAFGRKEIEIAENEMPGLMALRKRYGPSKPLKGARIAGCL-HMTVQTAVLIET-LVALGAEVRWSSCNIFSTQDHAA   90 (434)
T ss_pred             CHHHHHCHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCEEEEEE-EEEHHHHHHHHH-HHHHCCEEEEEECCCCCCHHHHH
T ss_conf             2465634256555542072477888873667888888642125-431237899999-99747615776401002405889


Q ss_pred             ---------CCCCCCCCHHHHHHHHHHC-------CCEE--------------------EEEECCC------CHHHHHHC
Q ss_conf             ---------0012321079999975300-------1011--------------------1210132------00677630
Q gi|255764473|r   81 ---------MQLGRAETIGDTAKVLSRY-------VDAI--------------------VMRTTNH------SRLLELTE  118 (306)
Q Consensus        81 ---------ss~~kgEsl~Dt~~~ls~~-------~D~i--------------------viR~~~~------~~~~~~~~  118 (306)
                               .-..|||+.++.-..+.+-       .+.|                    -+|..++      +.++.+.+
T Consensus        91 AAiA~~gvpvfawkget~ee~~wcie~~~~~~g~~~nmIlDdggd~t~l~h~kyp~~~~~i~GiseEttTGVH~Lykm~k  170 (434)
T KOG1370          91 AAIAEAGVPVFAWKGETEEEYWWCIERCLNKDGWQPNMILDDGGDLTHLVHEKYPQMFKKIRGISEETTTGVHNLYKMSK  170 (434)
T ss_pred             HHHHHCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             98875388612213665065564444321467898746655886423666655187875522623322154899999976


Q ss_pred             C--CCCCEECCCCCCCHHHHHHHHHHHHHHHCC--------C-CCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHC
Q ss_conf             1--244124043332024678765576642001--------3-3677304610455554310100123312576520000
Q gi|255764473|r  119 Y--ATVPVINALTDNTHPCQIIADIMTFEEHRG--------S-VKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIG  187 (306)
Q Consensus       119 ~--~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g--------~-l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~  187 (306)
                      .  ..+|-||--|.-.  -+-.-.+|..+|..-        - +-|+.++++| ++.|..+-..++.-+|..+.+.--. 
T Consensus       171 ~G~L~VPAiNVNDSVT--KsKFDnLygcreSl~DgikraTDVM~aGKv~Vv~G-YGdVGKgCaqaLkg~ga~VivTEiD-  246 (434)
T KOG1370         171 NGKLKVPAINVNDSVT--KSKFDNLYGCRESLLDGIKRATDVMIAGKVAVVCG-YGDVGKGCAQALKGFGARVIVTEID-  246 (434)
T ss_pred             CCCEECCEEECCCHHH--HHHCCCCCCCHHHCHHHHHHHHHHEECCCEEEEEC-CCCCCHHHHHHHHCCCCEEEEECCC-
T ss_conf             7913054552253133--33223210221100036655445145251799963-5764566899975068689996058-


Q ss_pred             CCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCCCCC
Q ss_conf             13210000243201332221366466306873322210000002201333100111233688996289872992599987
Q gi|255764473|r  188 SEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCLPAH  267 (306)
Q Consensus       188 ~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~  267 (306)
                        |  -..-.+.-.|..+   ..++|+.+.+|++.|..    +-.           =.++.+.++.+|.|+++-.-|-  
T Consensus       247 --P--I~ALQAaMeG~~V---~tm~ea~~e~difVTtT----Gc~-----------dii~~~H~~~mk~d~IvCN~Gh--  302 (434)
T KOG1370         247 --P--ICALQAAMEGYEV---TTLEEAIREVDIFVTTT----GCK-----------DIITGEHFDQMKNDAIVCNIGH--  302 (434)
T ss_pred             --C--HHHHHHHHHCCEE---EEHHHHHHCCCEEEECC----CCC-----------CHHHHHHHHHCCCCCEEECCCC--
T ss_conf             --0--6899987525375---46887641277899756----873-----------1233999974767737852565--


Q ss_pred             CCCCCCHHHHCCC
Q ss_conf             4873576796799
Q gi|255764473|r  268 RGEEVINEVLDGP  280 (306)
Q Consensus       268 rg~EI~~~v~d~~  280 (306)
                      -+.||+-.-+..|
T Consensus       303 fd~EiDv~~L~~~  315 (434)
T KOG1370         303 FDTEIDVKWLNTP  315 (434)
T ss_pred             CCCEEEHHHHCCC
T ss_conf             4301104330477


No 219
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli. Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli. This dimeric PurR belongs to the LacI-GalR family of transcription regulators and is activated to bind to DNA operator sites by initially binding either of high affinity corepressors, hypoxanthine or guanine. PurR is composed of two functional domains: aan N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the purine transcription repressor undergoes a 
Probab=38.37  E-value=30  Score=15.37  Aligned_cols=100  Identities=13%  Similarity=0.116  Sum_probs=54.5

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEE-EC-CCCHHHHHHCCCCCCEECCCCC--CCH
Q ss_conf             89999898634754333321000012321079999975-3001011121-01-3200677630124412404333--202
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMR-TT-NHSRLLELTEYATVPVINALTD--NTH  133 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR-~~-~~~~~~~~~~~~~vpvINa~~~--~~H  133 (306)
                      -...+.++.+-|-+++..+...    ..|.-.+.++.| +..+|++++= .. +......+.++.++|++..+..  ...
T Consensus        18 ~~gi~~~~~~~gy~l~i~~s~~----~~~~e~~~i~~l~~~~vDGiIi~~~~~~~~~~~~~~~~~~iPvV~id~~~~~~~   93 (269)
T cd06275          18 VRGVEQYCYRQGYNLILCNTEG----DPERQRSYLRMLAQKRVDGLLVMCSEYDQPLLAMLERYRHIPMVVMDWGPEDDF   93 (269)
T ss_pred             HHHHHHHHHHCCCEEEEEECCC----CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             9999999998699899996899----989999999999956999999936889837899999828998899846788899


Q ss_pred             HHHHHHHHHH----HHHHCCCCCCCCEEEECCC
Q ss_conf             4678765576----6420013367730461045
Q gi|255764473|r  134 PCQIIADIMT----FEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus       134 PtQaL~D~~T----i~e~~g~l~~~~i~~vGd~  162 (306)
                      ...+-.|-+.    +-++.-.....++++++..
T Consensus        94 ~~~V~~D~~~~~~~a~~~Li~~G~~~i~~i~~~  126 (269)
T cd06275          94 ADKIQDNSEEGGYLATRHLIELGHRRIGCITGP  126 (269)
T ss_pred             CCEEEECHHHHHHHHHHHHHHHCCCEEEECCCC
T ss_conf             989997899999999999998299717755699


No 220
>TIGR00185 rRNA_methyl_2 RNA methyltransferase, TrmH family, group 2; InterPro: IPR004440 The RNA methyltransferase, TrmH family, group 2 are part of the trmH (spoU) family of rRNA methylases that are involved in tRNA and rRNA base modification.; GO: 0008173 RNA methyltransferase activity, 0009451 RNA modification.
Probab=38.10  E-value=19  Score=16.59  Aligned_cols=42  Identities=19%  Similarity=0.257  Sum_probs=29.9

Q ss_pred             EEEECC-CCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHH
Q ss_conf             046104-5555431010012331257652000013210000243
Q gi|255764473|r  156 FSWSGD-GNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA  198 (306)
Q Consensus       156 i~~vGd-~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~  198 (306)
                      |.|.+. ++|+.| .+..++.+|++++++.|-||..++..+..|
T Consensus         5 VLy~PeIP~NTGN-I~R~Caat~~~LHLi~PlGF~~~DK~L~RA   47 (161)
T TIGR00185         5 VLYEPEIPPNTGN-IVRTCAATGTRLHLIKPLGFELDDKRLKRA   47 (161)
T ss_pred             EEECCCCCCCCCH-HHHHHHCCCCEEEEECCCCCCCCCCEEEEC
T ss_conf             7407889788411-201011158624566057862078142314


No 221
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=37.94  E-value=11  Score=18.09  Aligned_cols=29  Identities=21%  Similarity=0.157  Sum_probs=11.8

Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEE
Q ss_conf             63475433332100001232107999997530010111
Q gi|255764473|r   67 KHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIV  104 (306)
Q Consensus        67 ~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iv  104 (306)
                      ..+|.+++..|..     ..|++....+    .+|+++
T Consensus        41 ~~~gve~v~gD~~-----d~~sl~~al~----gvd~v~   69 (232)
T pfam05368        41 KAAGVELVEGDLD-----DHESLVEALK----GVDVVF   69 (232)
T ss_pred             HHCCCEEEEECCC-----CHHHHHHHHC----CCCEEE
T ss_conf             4179889990688-----8789999967----998899


No 222
>PRK11070 ssDNA exonuclease RecJ; Provisional
Probab=37.58  E-value=17  Score=17.01  Aligned_cols=11  Identities=27%  Similarity=0.144  Sum_probs=5.1

Q ss_pred             HHCCCEEEEEE
Q ss_conf             30010111210
Q gi|255764473|r   97 SRYVDAIVMRT  107 (306)
Q Consensus        97 s~~~D~iviR~  107 (306)
                      +...|+||.=|
T Consensus       148 ~~GidvIVtDH  158 (574)
T PRK11070        148 SLGIPVIVTDH  158 (574)
T ss_pred             HCCCCEEEECC
T ss_conf             77999999789


No 223
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains
Probab=37.40  E-value=19  Score=16.63  Aligned_cols=40  Identities=20%  Similarity=0.264  Sum_probs=15.2

Q ss_pred             HHHHHHHHHC-CCEEEEE--ECCCCHHHHHHCCCCCC---EECCCC
Q ss_conf             9999975300-1011121--01320067763012441---240433
Q gi|255764473|r   90 GDTAKVLSRY-VDAIVMR--TTNHSRLLELTEYATVP---VINALT  129 (306)
Q Consensus        90 ~Dt~~~ls~~-~D~iviR--~~~~~~~~~~~~~~~vp---vINa~~  129 (306)
                      +|.++.+..+ .|++++=  .|-+-..+.+.+++..|   ||..|+
T Consensus       100 ~~i~~~i~~~~p~a~iivvtNPvdv~t~~~~~~sg~p~~~viG~gt  145 (263)
T cd00650         100 KEIGDNIEKYSPDAWIIVVSNPVDIITYLVWRYSGLPKEKVIGLGT  145 (263)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHCCCCCCCEEEEEC
T ss_conf             9998888732998369973894899999999835998302898632


No 224
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed
Probab=37.38  E-value=31  Score=15.27  Aligned_cols=165  Identities=12%  Similarity=0.095  Sum_probs=88.9

Q ss_pred             EECCC--CCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-CCCEEEEEECCCCHHHHH-------HCC
Q ss_conf             94288--83578999989863475433332100001232107999997530-010111210132006776-------301
Q gi|255764473|r   50 IFEKP--STRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSR-YVDAIVMRTTNHSRLLEL-------TEY  119 (306)
Q Consensus        50 lF~e~--StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~-~~D~iviR~~~~~~~~~~-------~~~  119 (306)
                      +|=.|  ..+.-.=+..+.+.+|.+..+....   .. .|.+++....+.. .+.++-+=.|--..+..+       ++.
T Consensus        10 liG~pi~hS~SP~ihn~~f~~~gl~~~Y~~~~---v~-~~~l~~~i~~l~~~~~~G~nVT~P~K~~v~~~ld~l~~~A~~   85 (275)
T PRK00258         10 VIGNPIAHSKSPFIHNAAAKQLGLDGEYLAFL---VP-LDDLEDAVRGFFALGGKGANVTVPFKEAAFALADELSERARL   85 (275)
T ss_pred             EECCCCCCCCCHHHHHHHHHHCCCCCEEEEEE---CC-HHHHHHHHHHHHHCCCCEEEECHHHHHHHHHCCCHHHHHHHH
T ss_conf             98888241307999999999869993899887---88-889999999777669877996689899998624602177887


Q ss_pred             ---CCCCEECCCCC-CCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCE-EEEEECHHCCCCCCCC
Q ss_conf             ---24412404333-202467876557664200133677304610455554310100123312-5765200001321000
Q gi|255764473|r  120 ---ATVPVINALTD-NTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNY-LLNIATPIGSEPRNEY  194 (306)
Q Consensus       120 ---~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~-~v~~~~P~~~~~~~~~  194 (306)
                         .+. |++-.+. ..|-|-...=+.++.+.....+++++.++|-++ +++|-+.++..+|. ++.++....-    ..
T Consensus        86 igavNT-i~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~k~vlIlGaGG-aarai~~al~~~g~~~i~i~nR~~~----~a  159 (275)
T PRK00258         86 AGAVNT-LVLEDGRLIGDNTDGIGFVRDLERLGLDLKGKRILLLGAGG-AARAVILPLLELGVAEITIVNRTVE----RA  159 (275)
T ss_pred             HCCEEE-EEEECCEEEEEECCHHHHHHHHHHHCCCCCCCEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCHH----HH
T ss_conf             455458-99559989998367789999999848785687599988871-0799999999769998999958999----99


Q ss_pred             HHHHHCCCC--CCCCCCCHHHHCCCCCCCCCC
Q ss_conf             024320133--222136646630687332221
Q gi|255764473|r  195 LNWARNQGA--SVALFHDAVQAVKGAHCVFTD  224 (306)
Q Consensus       195 ~~~~~~~g~--~i~~~~d~~eal~~aD~V~~~  224 (306)
                      ...++..+.  ......+......++|+|+-.
T Consensus       160 ~~l~~~~~~~~~~~~~~~~~~~~~~~diiIna  191 (275)
T PRK00258        160 EELAELFGEGVQALGLDELAGELADFDLIINT  191 (275)
T ss_pred             HHHHHHHCCCCCEEEHHHHHHCCCCCCEEEEC
T ss_conf             99999835676275378754304457779965


No 225
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=37.23  E-value=24  Score=15.98  Aligned_cols=35  Identities=17%  Similarity=0.022  Sum_probs=20.8

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             37987999942888357899998986347543333210
Q gi|255764473|r   42 LSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGS   79 (306)
Q Consensus        42 l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~   79 (306)
                      ++||.|..+=.   -+|=.|-.....+.|.+|...|..
T Consensus         4 ~~~k~v~V~Gl---G~sG~s~~~~L~~~G~~v~~~D~~   38 (438)
T PRK03806          4 YQGKNVVIIGL---GLTGLSCVDFFLARGVTPRVMDTR   38 (438)
T ss_pred             CCCCEEEEEEE---CHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             78998999945---788899999999789969999899


No 226
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IPR011548   3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway.    In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators .    3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterised 3-hydroxyisobutyrate dehydrogenase from rat liver  with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31).    This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate . HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase. ; GO: 0008442 3-hydroxyisobutyrate dehydrogenase activity, 0051287 NAD binding.
Probab=36.53  E-value=21  Score=16.36  Aligned_cols=149  Identities=13%  Similarity=0.175  Sum_probs=77.0

Q ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCC----CCCCCCCCC
Q ss_conf             7717844589999999999999999665236665443798799994288835789999898634754----333321000
Q gi|255764473|r    6 KHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGD----TIFLSGSEM   81 (306)
Q Consensus         6 k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~----~~~~~~~~s   81 (306)
                      -|=+++-||.++-++.+.+--......+..-..   -.+..|.||   |+-.-=.|.-.+...+=.+    +..+|.+++
T Consensus        19 GH~v~~FDL~p~av~~~v~aG~~~A~S~~~a~~---~Ad~vITML---PAg~HV~sVY~gd~gIL~~~~K~~LlIDcSTI   92 (290)
T TIGR01692        19 GHAVRVFDLSPKAVEELVEAGAQAAASAAEAAE---GADVVITML---PAGKHVISVYSGDDGILAKVAKGSLLIDCSTI   92 (290)
T ss_pred             CCEEEEEECCHHHHHHHHHCCHHCCCCHHHHHC---CCCEEEECC---CCCHHHHHHHHCCHHHHCCCCCCCCEEECCCC
T ss_conf             872577517889999999600220545798845---588686348---86034899983313341136788963324567


Q ss_pred             CCCCCCCHHHHHHHHHHCCCEEEEEE---CCC-CHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEE
Q ss_conf             01232107999997530010111210---132-00677630124412404333202467876557664200133677304
Q gi|255764473|r   82 QLGRAETIGDTAKVLSRYVDAIVMRT---TNH-SRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFS  157 (306)
Q Consensus        82 s~~kgEsl~Dt~~~ls~~~D~iviR~---~~~-~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~  157 (306)
                      .   .    |++|.+..-+..-..+-   |-+ +  .--++.-+.-++=+|....        +---++..... +.+|.
T Consensus        93 D---p----dsAr~~A~~Aa~~G~~f~DAPVSGG--~GgA~AGTLtFmVGG~a~~--------F~~~~p~L~~M-g~~~~  154 (290)
T TIGR01692        93 D---P----DSARKVAELAAAHGLVFVDAPVSGG--VGGARAGTLTFMVGGEAEE--------FARARPVLEPM-GRNIV  154 (290)
T ss_pred             C---H----HHHHHHHHHHHHCCCCEECCCCCCC--HHHHHHCCCEEEECCCHHH--------HHHHHHHHHCC-CCCEE
T ss_conf             8---6----7899999999981872103677753--5652012230564376535--------78899998536-66568


Q ss_pred             EECCCC-----CCCCCHHHCCCCCCE
Q ss_conf             610455-----554310100123312
Q gi|255764473|r  158 WSGDGN-----NILHSLIEGAARFNY  178 (306)
Q Consensus       158 ~vGd~~-----~v~hS~i~~~~~~g~  178 (306)
                      +|||++     -|+|=.+.+.+..|.
T Consensus       155 HcG~~GAGQ~AKICNNmlLGIsM~Gt  180 (290)
T TIGR01692       155 HCGDHGAGQAAKICNNMLLGISMIGT  180 (290)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             66888875157899889999989999


No 227
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed
Probab=36.07  E-value=16  Score=17.08  Aligned_cols=76  Identities=20%  Similarity=0.139  Sum_probs=39.4

Q ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC---CC----H--HHHHHHHHHCCCEEEEEE--CC
Q ss_conf             4379879999428883578999989863475433332100001232---10----7--999997530010111210--13
Q gi|255764473|r   41 PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRA---ET----I--GDTAKVLSRYVDAIVMRT--TN  109 (306)
Q Consensus        41 ~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kg---Es----l--~Dt~~~ls~~~D~iviR~--~~  109 (306)
                      ...|++|+.+=-  .---| =+-.|+++||.++..+++..-+....   +.    +  .|..+-|..-+|++.+=.  -+
T Consensus         4 ~~p~~tIGIlGg--GQLgr-Mla~aA~~lG~~v~vldp~~~~PA~~va~~~~~~~~~D~~al~~fa~~~DviT~E~EnI~   80 (377)
T PRK06019          4 ILPGKTIGIIGG--GQLGR-MLALAAAPLGYKVIVLDPDADCPAAQVADRVIVADYDDVAALRELAEQCDVITYEFENVP   80 (377)
T ss_pred             CCCCCEEEEECC--CHHHH-HHHHHHHHCCCEEEEECCCCCCCHHHHCCEEEECCCCCHHHHHHHHHCCCEEEECCCCCC
T ss_conf             899999999878--68999-999999978998999848984984783784898688989999999845999997817689


Q ss_pred             CCHHHHHHCC
Q ss_conf             2006776301
Q gi|255764473|r  110 HSRLLELTEY  119 (306)
Q Consensus       110 ~~~~~~~~~~  119 (306)
                      ...+..+.+.
T Consensus        81 ~~~L~~le~~   90 (377)
T PRK06019         81 AEALDLLAAR   90 (377)
T ss_pred             HHHHHHHHHC
T ss_conf             9999999708


No 228
>cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins are accessory proteins localized at synapses that interacts with the endocytic proteins, dynamin and synaptojanin. They are essential for synaptic vesicle formation from the plasma membrane. They interact with voltage-gated calcium channels, thus linking vesicle endocytosis to calcium regulation. They also play roles in virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Endophilin-A proteins are enriched in the brain and play multiple roles in receptor-mediated e
Probab=35.93  E-value=5.1  Score=20.39  Aligned_cols=136  Identities=11%  Similarity=0.158  Sum_probs=75.1

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999999999999665236665443798799994288835789999898634754333321000012321079999975
Q gi|255764473|r   17 SNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL   96 (306)
Q Consensus        17 ~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l   96 (306)
                      +++..|...+..-+....+      +..++.+.|=-+|.+|.+.+|..+..++-|..-.-.-..-..--|++.-+...-|
T Consensus         7 ~dF~~le~~~d~t~~~~e~------i~~~t~~~LqPNP~~R~~~~~~~~~~k~~g~~k~~~yp~~e~~Lg~~M~~~G~~l   80 (223)
T cd07615           7 DDFQEMERKIDVTNKVVAE------LLSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLRYGREL   80 (223)
T ss_pred             HHHHHHHHHHHHHHHHHHH------HHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             8999999999999999999------9998899948993034899999889887145578888861548999999986517


Q ss_pred             H---HCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHH--HHHHHHHHCCCCCCCCEEEECC
Q ss_conf             3---001011121013200677630124412404333202467876--5576642001336773046104
Q gi|255764473|r   97 S---RYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIA--DIMTFEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus        97 s---~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~--D~~Ti~e~~g~l~~~~i~~vGd  161 (306)
                      +   .|..+++-=+   .+...++..-.--+.++..+.-.|.+-+.  |+-||..+++.+++.++.|=..
T Consensus        81 g~~S~yG~aL~~~G---ea~~~la~~~~~~~~~~~~~fL~PL~~~~e~d~Kei~~~RKkLe~rRLD~D~k  147 (223)
T cd07615          81 GEESTFGNALLDVG---ESMKQMAEVKDSLDINVKQNFIDPLQLLQDKDLKEIGHHLKKLEGRRLDFDYK  147 (223)
T ss_pred             CCCCHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99973899999999---99999999999999999999988999988877999999999986041358998


No 229
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed
Probab=35.71  E-value=22  Score=16.21  Aligned_cols=60  Identities=10%  Similarity=0.113  Sum_probs=29.8

Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCC---HHHHHHCC--CCCCEECCCC
Q ss_conf             835789999898634754333321000012321079999975300101112101320---06776301--2441240433
Q gi|255764473|r   55 STRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHS---RLLELTEY--ATVPVINALT  129 (306)
Q Consensus        55 StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~---~~~~~~~~--~~vpvINa~~  129 (306)
                      |.|+.-..+.+..+.|..+.. +           ..+.    ..-.|++++=..++.   .+.++..+  .+..||+-.-
T Consensus        35 ~~~~~~~~~~~~~~~~~~~~~-~-----------~~e~----~~~~Dii~LaVKP~~~~~vl~~l~~~~~~~~lviSi~A   98 (272)
T PRK12491         35 SDLNVSNLKNASDKYGITITT-N-----------NNEV----ANSADILILSIKPDLYSSVINQIKDQIKNDVIVVTIAA   98 (272)
T ss_pred             ECCCHHHHHHHHHHCCCEEEC-C-----------HHHH----HHHCCEEEEEECHHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             697999999999971978866-8-----------7999----73199999995778999999998655269918999848


Q ss_pred             C
Q ss_conf             3
Q gi|255764473|r  130 D  130 (306)
Q Consensus       130 ~  130 (306)
                      |
T Consensus        99 G   99 (272)
T PRK12491         99 G   99 (272)
T ss_pred             C
T ss_conf             9


No 230
>COG4087 Soluble P-type ATPase [General function prediction only]
Probab=35.60  E-value=33  Score=15.09  Aligned_cols=72  Identities=21%  Similarity=0.361  Sum_probs=49.9

Q ss_pred             CCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCC
Q ss_conf             107999997530010111210132006776301244124043332024678765576642001336773046104555
Q gi|255764473|r   87 ETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNN  164 (306)
Q Consensus        87 Esl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~  164 (306)
                      +++..|++-|-.++|+.+.-...-+.+.++++...+|+=+-.. .+||-- =++  -++|.++  .+.++..||++.|
T Consensus        33 ~ev~e~iqeL~d~V~i~IASgDr~gsl~~lae~~gi~~~rv~a-~a~~e~-K~~--ii~eLkk--~~~k~vmVGnGaN  104 (152)
T COG4087          33 SEVSETIQELHDMVDIYIASGDRKGSLVQLAEFVGIPVERVFA-GADPEM-KAK--IIRELKK--RYEKVVMVGNGAN  104 (152)
T ss_pred             HHHHHHHHHHHHHHEEEEECCCCCHHHHHHHHHCCCCEEEEEC-CCCHHH-HHH--HHHHHCC--CCCEEEEECCCCC
T ss_conf             7557899999876137884287323799999873996051103-467878-999--9998447--7717999647752


No 231
>pfam05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases.
Probab=35.56  E-value=33  Score=15.08  Aligned_cols=103  Identities=14%  Similarity=0.134  Sum_probs=52.1

Q ss_pred             CCEEEECCCCCCCCCHHHCCCCCCEEEEEECHH---CCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECC
Q ss_conf             730461045555431010012331257652000---01321000024320133222136646630687332221000000
Q gi|255764473|r  154 KLFSWSGDGNNILHSLIEGAARFNYLLNIATPI---GSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMN  230 (306)
Q Consensus       154 ~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~---~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~  230 (306)
                      .+|+++++   ++..+    .++|++|.+=.-.   ...++.+|.    +.|.++  ..+..+.+.++|+|..-.-.+..
T Consensus        11 ~RValtP~---~vkkl----~~~G~~V~iE~gaG~~s~f~D~~Y~----~aGa~i--~~~~~e~~~~adiIl~v~~p~~~   77 (135)
T pfam05222        11 RRVALTPA---GVKKL----VKLGHEVLVESGAGLGAGFSDEAYE----AAGAEI--VDSAAEVWAQADLILKVKEPSPE   77 (135)
T ss_pred             CCCCCCHH---HHHHH----HHCCCEEEEECCCCCCCCCCHHHHH----HCCCCE--ECCCHHHHHHCCEEEEECCCCHH
T ss_conf             07165999---99999----9789989997498851772679998----646621--10110233324468875799999


Q ss_pred             CCCHHHH----HHCCCCCCCCHHHHHC---CCCCCEEECCCCCCCCC
Q ss_conf             2201333----1001112336889962---89872992599987487
Q gi|255764473|r  231 QEFKARE----EHVFQPFQVNLSLMSM---AHPDALFMHCLPAHRGE  270 (306)
Q Consensus       231 ~~~~~~~----~~~~~~y~i~~~~l~~---a~~~~~vmHplP~~rg~  270 (306)
                      +-.....    -.++.+|+ |.++++.   .+-.++=|..+|.-|+.
T Consensus        78 e~~~lk~~~~li~~l~p~~-n~~~~~~l~~~~it~~s~E~ipr~raQ  123 (135)
T pfam05222        78 ELALLRPGQTLITFLHPAA-NPELLEALAAKGVTAIAYETVPRIRAQ  123 (135)
T ss_pred             HHHHCCCCCEEEEECCCCC-CHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             9985369989999737345-999999999869959981246147776


No 232
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of LacI is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA b
Probab=35.51  E-value=33  Score=15.08  Aligned_cols=99  Identities=15%  Similarity=0.128  Sum_probs=52.9

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECCC-CHHHHHHCCCCCCEECCCCC--CCHH
Q ss_conf             89999898634754333321000012321079999975-30010111210132-00677630124412404333--2024
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTNH-SRLLELTEYATVPVINALTD--NTHP  134 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~~-~~~~~~~~~~~vpvINa~~~--~~HP  134 (306)
                      =-.-|.++++.|-+++..+....   ..+..++.++.| +..+|++++-.... ..........++|||--+..  ...|
T Consensus        18 ~~gie~~~~~~Gy~~~l~~~~~~---~~~~~~~~i~~l~~~~vdGiI~~~~~~~~~~~~~~~~~~iPvV~i~~~~~~~~~   94 (264)
T cd01574          18 LAAIESAAREAGYAVTLSMLAEA---DEEALRAAVRRLLAQRVDGVIVNAPLDDADAALAAAPADVPVVFVDGSPSPRVS   94 (264)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCC---CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             99999999984997999979999---899999999999964999999916889969999998589968998667999998


Q ss_pred             HHHHHHHHH-HH---HHCCCCCCCCEEEECC
Q ss_conf             678765576-64---2001336773046104
Q gi|255764473|r  135 CQIIADIMT-FE---EHRGSVKGKLFSWSGD  161 (306)
Q Consensus       135 tQaL~D~~T-i~---e~~g~l~~~~i~~vGd  161 (306)
                      + +..|-+- ..   ++.-..--.+++++|.
T Consensus        95 ~-V~~Dn~~~~~~a~~~L~~~G~~~i~~i~~  124 (264)
T cd01574          95 T-VSVDQEGGARLATEHLLELGHRTIAHVAG  124 (264)
T ss_pred             E-EEECHHHHHHHHHHHHHHCCCCCEEECCC
T ss_conf             8-99788999999999999849982732589


No 233
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=35.51  E-value=32  Score=15.17  Aligned_cols=12  Identities=8%  Similarity=0.304  Sum_probs=4.9

Q ss_pred             HHHCCCCCCCCC
Q ss_conf             863475433332
Q gi|255764473|r   66 MKHLGGDTIFLS   77 (306)
Q Consensus        66 ~~~LG~~~~~~~   77 (306)
                      ..++|..+...|
T Consensus        31 L~~~G~~v~~~D   42 (487)
T PRK03369         31 LTRFGARPTVCD   42 (487)
T ss_pred             HHHCCCEEEEEE
T ss_conf             997869799998


No 234
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=35.15  E-value=33  Score=15.04  Aligned_cols=91  Identities=22%  Similarity=0.286  Sum_probs=49.4

Q ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCH---HHHHHHHHHC-CCEEEEEECCC---------
Q ss_conf             9879999428883578999989863475433332100001232107---9999975300-10111210132---------
Q gi|255764473|r   44 GKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETI---GDTAKVLSRY-VDAIVMRTTNH---------  110 (306)
Q Consensus        44 gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl---~Dt~~~ls~~-~D~iviR~~~~---------  110 (306)
                      .|.|+.+=--.|--|++|+++| ++++|.+++.|  ++|+.||=.+   +-+..-.... ..++-+..+.+         
T Consensus         4 ~~ii~i~GpTasGKs~la~~la-~~~~~eIIsaD--S~QvYk~l~IgTakps~~e~~~i~Hhli~~~~~~e~~sv~~f~~   80 (304)
T PRK00091          4 PKLIVLVGPTASGKTALAIELA-KRLNGEIISVD--SMQVYRGMDIGTAKPTAEELAGVPHHLIDILDPTESYSAADFQR   80 (304)
T ss_pred             CCEEEEECCCCCCHHHHHHHHH-HHCCCEEEEEC--HHHHHCCCCEEECCCCHHHHCCCCCEEEEEECCCCCEEHHHHHH
T ss_conf             9779998988658999999999-98799899412--68874999868899999998189812434565887544999999


Q ss_pred             ---CHHHHHHCCCCCCEECCCCCCCHHHHHHH
Q ss_conf             ---00677630124412404333202467876
Q gi|255764473|r  111 ---SRLLELTEYATVPVINALTDNTHPCQIIA  139 (306)
Q Consensus       111 ---~~~~~~~~~~~vpvINa~~~~~HPtQaL~  139 (306)
                         ..+.++.+.-.+|||=||+|.+  -++|+
T Consensus        81 ~a~~~i~~i~~~~kiPIiVGGTglY--l~aLl  110 (304)
T PRK00091         81 DALAAIEDITARGKLPILVGGTGLY--FKALL  110 (304)
T ss_pred             HHHHHHHHHHHCCCCCEEECCCHHH--HHHHH
T ss_conf             9999999999769987898083899--99997


No 235
>pfam12264 Peptidase_C03 Spherical virus-type peptidase. This protein is found in viruses. Proteins in this family are typically between 206 to 703 amino acids in length. Picornaviruses translate a large polyprotein and require protease activity to cleave this into individual peptides. This family is the protease utilized by this virus for this purpose. It is found on the C terminal of the viral RNA polymerase.
Probab=35.15  E-value=33  Score=15.04  Aligned_cols=43  Identities=14%  Similarity=0.232  Sum_probs=19.1

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             4437987999942888357899998986347543333210000
Q gi|255764473|r   40 KPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQ   82 (306)
Q Consensus        40 ~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss   82 (306)
                      .|+.|.++++...--|+|||--..+..+--|.--+.+++.+||
T Consensus        84 ip~hgGtL~~AwDal~~aTrqgi~t~vqlt~LP~~~i~a~~sS  126 (197)
T pfam12264        84 IPMHGGTLLAAWDALGCATRQGIATMVQLTGLPSMTIEAHSSS  126 (197)
T ss_pred             EECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             6224745998760125367765566551047883699832671


No 236
>pfam07302 AroM AroM protein. This family consists of several bacterial and archaeal AroM proteins. In Escherichia coli the aroM gene is cotranscribed with aroL. The function of this family is unknown.
Probab=35.06  E-value=22  Score=16.17  Aligned_cols=27  Identities=19%  Similarity=0.325  Sum_probs=17.4

Q ss_pred             CCCCCCHHHCCCCCCEEEEEECHHCCCC
Q ss_conf             5554310100123312576520000132
Q gi|255764473|r  163 NNILHSLIEGAARFNYLLNIATPIGSEP  190 (306)
Q Consensus       163 ~~v~hS~i~~~~~~g~~v~~~~P~~~~~  190 (306)
                      .|+.++++.++.. |..+.++.|..-+.
T Consensus       112 ~ril~~lV~a~~~-~~~lGVvvP~~eQ~  138 (221)
T pfam07302       112 QRILPPLVASIVD-GHQLGVIVPLPEQI  138 (221)
T ss_pred             HHHHHHHHHHHCC-CCEEEEEECCHHHH
T ss_conf             8867899998678-98599995579999


No 237
>PRK03094 hypothetical protein; Provisional
Probab=34.93  E-value=20  Score=16.54  Aligned_cols=60  Identities=20%  Similarity=0.193  Sum_probs=31.2

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCC-CHHHHH
Q ss_conf             989863475433332100001232107999997530010111210132006776301244124043332-024678
Q gi|255764473|r   63 EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDN-THPCQI  137 (306)
Q Consensus        63 e~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~-~HPtQa  137 (306)
                      .-+-++-|-.|+.++..          .|     ...+|++|+-..+....-.---....|||||-+-. +-=||.
T Consensus        14 ~~~L~~~GY~Vv~l~~~----------~~-----a~~~Da~ViTG~d~N~mGiqd~~t~~pVI~A~GlTaeEI~~~   74 (80)
T PRK03094         14 QQALKQKGYEVVTLNSE----------QD-----AQGCDCCVVTGQDSNVMGIADTSTKGSVITASGLTADEICQQ   74 (80)
T ss_pred             HHHHHHCCCEEEECCCC----------CC-----CCCCCEEEEECCCCCCCCCCCCCCCCCEEECCCCCHHHHHHH
T ss_conf             99999779878966871----------43-----356788999589765226441345687486789999999999


No 238
>pfam03698 UPF0180 Uncharacterized protein family (UPF0180). The members of this family are small uncharacterized proteins.
Probab=34.92  E-value=20  Score=16.47  Aligned_cols=61  Identities=25%  Similarity=0.263  Sum_probs=33.8

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCC-CHHHHHH
Q ss_conf             989863475433332100001232107999997530010111210132006776301244124043332-0246787
Q gi|255764473|r   63 EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDN-THPCQII  138 (306)
Q Consensus        63 e~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~-~HPtQaL  138 (306)
                      .-+-+.-|.+|+.++..          .|     ...+|++|+-..+...+-.---....|||||-+-. +-=||.+
T Consensus        14 ~e~L~~~Gy~Vv~l~~~----------~~-----~~~~da~VitG~d~N~mGi~d~~t~~pVI~A~G~TaeEI~~~v   75 (80)
T pfam03698        14 EEALKEKGYEVVRLKNE----------QD-----AQGCDACVVTGLDSNMMGIEDTVTKAPVIDASGLTAEEICQEV   75 (80)
T ss_pred             HHHHHHCCCEEEECCCC----------CC-----CCCCCEEEEECCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHH
T ss_conf             99999779878867870----------32-----5665889995898652144133456874866899999999999


No 239
>PRK10200 putative racemase; Provisional
Probab=34.62  E-value=33  Score=15.10  Aligned_cols=84  Identities=14%  Similarity=0.155  Sum_probs=49.6

Q ss_pred             CCCHHHHHHHHH-HCCCEEEEEEC-CCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCC
Q ss_conf             210799999753-00101112101-3200677630124412404333202467876557664200133677304610455
Q gi|255764473|r   86 AETIGDTAKVLS-RYVDAIVMRTT-NHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGN  163 (306)
Q Consensus        86 gEsl~Dt~~~ls-~~~D~iviR~~-~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~  163 (306)
                      ++-+.+.++-|. ..+|++++=+. .|....++.+.+++|+||..+...   +++.      +.    .-.+|++.|-..
T Consensus        61 ~~~L~~~a~~Le~aGAd~i~i~cNTaH~~~d~i~~~~~iP~l~i~~~t~---~~i~------~~----g~~~VglLgT~~  127 (230)
T PRK10200         61 GDILAEAALGLQRAGAEGIVLCTNTMHKVADAIESRCSLPFLHIADATG---RAIA------GA----GMTRVALLGTRY  127 (230)
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHCCCCEEEHHHHHH---HHHH------HC----CCCEEEEECCHH
T ss_conf             9999999999998499999964747899999999756998731899999---9999------75----998589851456


Q ss_pred             CCCCCHHH--C-CCCCCEEEEEECH
Q ss_conf             55431010--0-1233125765200
Q gi|255764473|r  164 NILHSLIE--G-AARFNYLLNIATP  185 (306)
Q Consensus       164 ~v~hS~i~--~-~~~~g~~v~~~~P  185 (306)
                       +..|-+.  . ..++|.++  +.|
T Consensus       128 -Tm~~~~Y~~~l~~~~gi~~--v~P  149 (230)
T PRK10200        128 -TMEQDFYRGRLTEQFSINC--LIP  149 (230)
T ss_pred             -HHHHHHHHHHHHHHCCCEE--ECC
T ss_conf             -6661688999998579858--679


No 240
>pfam04918 DltD_M DltD central region. DltD is and integral membrane protein involved in the biosynthesis of D-alanyl-lipoteichoic acid. This is important in controlling the net ionic charge in lipoteichoic acid (LTA). This family is found in bacteria of the Bacillus/Clostridium group. DltD binds Dcp and ligates it with D-alanine. DltD does not ligate acyl carrier protein (ACP) with D-alanine. It also has thioesterase activity for mischarged D-alanyl-acyl carrier protein (ACP). DltD is thought to be responsible for discriminating between Dcp involved in the D-alanylation of LTA, and ACP involved in fatty acid biosynthesis. This family consists of the central region of DltD.
Probab=34.43  E-value=24  Score=16.01  Aligned_cols=26  Identities=12%  Similarity=0.189  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEEC
Q ss_conf             67876557664200133677304610
Q gi|255764473|r  135 CQIIADIMTFEEHRGSVKGKLFSWSG  160 (306)
Q Consensus       135 tQaL~D~~Ti~e~~g~l~~~~i~~vG  160 (306)
                      ||.|..++.|....+.++|+|+++|=
T Consensus         6 sqsL~h~~~~~~~~~~lk~kK~vfii   31 (163)
T pfam04918         6 STSLSHYFGMQQQYDQLKGKKAVFVI   31 (163)
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             21499999999888772488489887


No 241
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors. This group includes the ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=34.30  E-value=34  Score=14.95  Aligned_cols=113  Identities=11%  Similarity=0.183  Sum_probs=58.1

Q ss_pred             EEEEEECCCCC---------HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHH-HCCCEEEEE-ECCCCHHH
Q ss_conf             79999428883---------57899998986347543333210000123210799999753-001011121-01320067
Q gi|255764473|r   46 VLAMIFEKPST---------RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLS-RYVDAIVMR-TTNHSRLL  114 (306)
Q Consensus        46 ~i~~lF~e~St---------RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls-~~~D~iviR-~~~~~~~~  114 (306)
                      ||+.++-..|.         +--.+.|.++++.|-+++..+..+    ..|..+...+++. ..+|++++= ...+....
T Consensus         1 TIGvivP~~~~~~i~Npff~~l~~gie~~~~~~Gy~lli~~~~~----~~~~~~~~~~~l~~~~vDGiIi~~~~~~~~~~   76 (270)
T cd06294           1 TIGVVLPPSADEAFQNPFFIEVLRGISAVANENGYDISLATGKN----EEELLEEVKKMIQQKRVDGFILLYSREDDPII   76 (270)
T ss_pred             CEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC----CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH
T ss_conf             98999857866665698999999999999998599899991899----69999999999982799889995798984999


Q ss_pred             HHHCCCCCCEECCCCCCCH--HH-HHHHH----HHHHHHHCCCCCCCCEEEECCC
Q ss_conf             7630124412404333202--46-78765----5766420013367730461045
Q gi|255764473|r  115 ELTEYATVPVINALTDNTH--PC-QIIAD----IMTFEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus       115 ~~~~~~~vpvINa~~~~~H--Pt-QaL~D----~~Ti~e~~g~l~~~~i~~vGd~  162 (306)
                      +..+..++|+|--+....+  ++ .+-.|    .+..-++.-..--.+|+++|..
T Consensus        77 ~~l~~~~iP~V~i~r~~~~~~~~~~V~~Dn~~~~~~a~~~L~~~Ghr~I~~i~~~  131 (270)
T cd06294          77 DYLKEEKFPFVVIGKPEDDKENITYVDNDNIQAGYDATEYLIKLGHKKIAFVGGD  131 (270)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9999769999998775688899849937779999999999997699569998189


No 242
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]
Probab=34.29  E-value=23  Score=16.08  Aligned_cols=19  Identities=16%  Similarity=0.106  Sum_probs=8.8

Q ss_pred             ECCCCCHHHHHHHHHHHHCCCC
Q ss_conf             4288835789999898634754
Q gi|255764473|r   51 FEKPSTRTRVSFEVAMKHLGGD   72 (306)
Q Consensus        51 F~e~StRTR~SFe~A~~~LG~~   72 (306)
                      -.+++...|.   .-+.++|..
T Consensus        33 v~~~~~e~~~---~l~~~~g~~   51 (266)
T COG0345          33 VTNRSEEKRA---ALAAEYGVV   51 (266)
T ss_pred             EECCCHHHHH---HHHHHCCCC
T ss_conf             8379999999---999984985


No 243
>PRK08507 prephenate dehydrogenase; Validated
Probab=34.27  E-value=25  Score=15.87  Aligned_cols=20  Identities=15%  Similarity=0.169  Sum_probs=12.6

Q ss_pred             CCEEEEEECCCCHHHHHHCC
Q ss_conf             10111210132006776301
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELTEY  119 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~~~  119 (306)
                      +|++++=+|-......+.+.
T Consensus        59 aDlVila~Pv~~~~~~l~~l   78 (275)
T PRK08507         59 CDVIFLAIPVDAIIEILQKL   78 (275)
T ss_pred             CCEEEEECCHHHHHHHHHHH
T ss_conf             79899917699999999998


No 244
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional
Probab=34.09  E-value=35  Score=14.93  Aligned_cols=258  Identities=14%  Similarity=0.128  Sum_probs=116.9

Q ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC-----------CCCCHHHHHH-HHHHCCCEEEEEE
Q ss_conf             443798799994288835789999898634754333321000012-----------3210799999-7530010111210
Q gi|255764473|r   40 KPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG-----------RAETIGDTAK-VLSRYVDAIVMRT  107 (306)
Q Consensus        40 ~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~-----------kgEsl~Dt~~-~ls~~~D~iviR~  107 (306)
                      .+-+||.|+.+=-=|+   =+|-..--.++|-.|..|....--.+           -.|.+..-+. +.+..   +-+|.
T Consensus       133 ~~~tgkkVAVIGaGPA---GLsaA~~La~~G~~VtVfE~~~~~GGml~~GIP~yRLP~~vl~~ei~~i~~~G---V~~~~  206 (560)
T PRK12771        133 APDTGKRVAVIGGGPA---GLSAAYQLRRLGHAVTIFEAGPKLGGMMRYGIPGYRLPRDVLDAEIQRILDLG---VEVKL  206 (560)
T ss_pred             CCCCCCEEEEECCCHH---HHHHHHHHHHCCCEEEEECCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHCC---CEEEE
T ss_conf             7778998999897789---99999999976985899676788898883568754475899999999999649---67983


Q ss_pred             ----CCCCHHHHHHCCCCCCEECCCCCC--------CHHHHHH--HHHHHHHHHC-CCCCCCCEEEECCCCCCCCCHHHC
Q ss_conf             ----132006776301244124043332--------0246787--6557664200-133677304610455554310100
Q gi|255764473|r  108 ----TNHSRLLELTEYATVPVINALTDN--------THPCQII--ADIMTFEEHR-GSVKGKLFSWSGDGNNILHSLIEG  172 (306)
Q Consensus       108 ----~~~~~~~~~~~~~~vpvINa~~~~--------~HPtQaL--~D~~Ti~e~~-g~l~~~~i~~vGd~~~v~hS~i~~  172 (306)
                          ..+-.+.++.+--+.=+|--|...        ++...+.  +|++.-.... ....|++|+++|.+| |+---+..
T Consensus       207 n~~vg~dit~~~L~~~yDAV~la~Ga~~~r~l~i~G~d~~gV~~al~fL~~~~~g~~~~~Gk~VvVIGGGn-tAmD~art  285 (560)
T PRK12771        207 GVRVGEDITLEQLEGDYDAVFVAIGAQLGKRLPIPGEDAANVLDAVSFLRAVEEGEPPKLGKRVVVIGGGN-TAMDAART  285 (560)
T ss_pred             CCEECCCCCHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHCCCCCCCCCEEEEECCCC-HHHHHHHH
T ss_conf             87844656799971778889991687877608978877655240599999975689755688689989982-28999999


Q ss_pred             CCCCCE-EEEEECHHC--CCCC-CCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEEC--CCCCHH--HHHH-----
Q ss_conf             123312-576520000--1321-00002432013322213664663068733222100000--022013--3310-----
Q gi|255764473|r  173 AARFNY-LLNIATPIG--SEPR-NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEFKA--REEH-----  239 (306)
Q Consensus       173 ~~~~g~-~v~~~~P~~--~~~~-~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~--~~~~~~--~~~~-----  239 (306)
                      +.|+|. +++++....  ..|. +.-++.+...|..+.....+.+.+.+.+-|---....|  ++....  ....     
T Consensus       286 A~RlGa~~V~ivyrr~~~~MpA~~~Ei~~A~eEGV~~~~~~~p~~i~~~~g~v~gl~~~~~~~~e~g~~~~~g~~~~i~a  365 (560)
T PRK12771        286 ARRLGAEEVVIVYRRTREEMPAHAFEIDDALREGVEINWLRTPVEVEKDEDGVTGLRVEKMELDEKGEPGPTGEFFTLEA  365 (560)
T ss_pred             HHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCEEEECCCCEEEECCCCEEEEEEEEEEEECCCCCCCCCCCCEEEEC
T ss_conf             99738976999831442028999899987874795689634647998069859899999999889988788997267546


Q ss_pred             --CCC--CCCCCHHHHHC-----CCCCCEEECCC---CCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             --011--12336889962-----89872992599---98748735767967997106868775599999999996255
Q gi|255764473|r  240 --VFQ--PFQVNLSLMSM-----AHPDALFMHCL---PAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGI  305 (306)
Q Consensus       240 --~~~--~y~i~~~~l~~-----a~~~~~vmHpl---P~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~  305 (306)
                        ...  .-..+...++.     .+.+.+.--+-   .-.-|+=...|+..+|..++ +-+..|--+..+|-.|+.|-
T Consensus       366 D~VI~AiGq~~d~~~l~~~~~~~~~~g~i~~~~~~~~Ts~~gVFa~GD~v~Gp~~vv-~AI~~Gr~AA~~Id~yL~G~  442 (560)
T PRK12771        366 DMVVLAIGQDTDSEFLEGLPGVRNGRGGLVVDRNFRMTGRPGVFAGGDMVPGERTVT-TAVGHGKKAARHIDAFLRGE  442 (560)
T ss_pred             CEEEECCCCCCCCCHHCCCCCEEECCCCEEECCCCCCCCCCCEEECCCCCCCCHHHH-HHHHHHHHHHHHHHHHHCCC
T ss_conf             899992257887300023655471799888478766579988674365466841899-99999999999999996689


No 245
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase; InterPro: IPR005982    Reactive oxygen species (ROS) are known mediators of intracellular signaling cascades. Excessive production of ROS may, however, lead to oxidative stress, loss of cell function, and ultimately apoptosis or necrosis. A balance between oxidant and antioxidant intracellular systems is hence vital for cell function, regulation, and adaptation to diverse growth conditions. Thioredoxin reductase in conjunction with thioredoxin is a ubiquitous oxidoreductase system with antioxidant and redox regulatory roles. Thioredoxin reductase (1.8.1.9 from EC) reduces oxidised thioredoxin in the presence of NADPH. Reduced thioredoxin serves as an electron donor for thioredoxin peroxidase which consequently reduces H_2O_2 to H_2O. In mammals, extracellular forms of Trx also have cytokine-like effects. Mammalian TrxR has a highly reactive active site selenocysteine residue resulting in a profound reductive capacity, reducing several substrates in addition to Trx .; GO: 0004791 thioredoxin-disulfide reductase activity, 0019430 removal of superoxide radicals, 0005737 cytoplasm.
Probab=33.48  E-value=21  Score=16.39  Aligned_cols=67  Identities=10%  Similarity=0.033  Sum_probs=41.8

Q ss_pred             CCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECH-HCCCCCCCCHHHHHCC---CCCCCCCCCHHHHCCCCC
Q ss_conf             36773046104555543101001233125765200-0013210000243201---332221366466306873
Q gi|255764473|r  151 VKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP-IGSEPRNEYLNWARNQ---GASVALFHDAVQAVKGAH  219 (306)
Q Consensus       151 l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P-~~~~~~~~~~~~~~~~---g~~i~~~~d~~eal~~aD  219 (306)
                      ++|++|+.||..+ .+=.=..-|++++.+|+++++ ..|.-++-+++.++++   +..+..-+.++ .+.+..
T Consensus       149 fk~K~V~VvGGGd-sA~eEA~yL~~~a~kV~lvHRRd~fRA~k~~~~r~~~~~eG~I~~l~n~~v~-Ei~G~~  219 (321)
T TIGR01292       149 FKNKEVAVVGGGD-SALEEALYLTRIAKKVTLVHRRDKFRAEKILLDRLKKNPEGKIEFLWNSTVE-EIVGDN  219 (321)
T ss_pred             HCCCEEEEECCCC-HHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHCCCCCEEEECCCEEE-EEECCC
T ss_conf             0598899987982-4888889998538767999779863632899989983789878996486899-996178


No 246
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria. This group includes the ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria. This group belongs to the the LacI-GalR family repressors and are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding.
Probab=33.38  E-value=36  Score=14.86  Aligned_cols=100  Identities=12%  Similarity=0.070  Sum_probs=51.9

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCC---H
Q ss_conf             789999898634754333321000012321079999975-300101112101320067763012441240433320---2
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNT---H  133 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~---H  133 (306)
                      .--..+.++++.|-+++..+... +..+.   .+..+.+ +..+|++++=...............+|||-.+....   .
T Consensus        17 ~~~gi~~~~~~~gy~~~i~~s~~-~~~~e---~~~i~~l~~~~vdGiIi~~~~~~~~~~~~~~~~~PvV~i~~~~~~~~~   92 (267)
T cd06284          17 ILKGIEDEAREAGYGVLLGDTRS-DPERE---QEYLDLLRRKQADGIILLDGSLPPTALTALAKLPPIVQACEYIPGLAV   92 (267)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCC-CHHHH---HHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             99999999998699899997899-98999---999999984799859982788999999998479999998677888999


Q ss_pred             HHHHHHHHH----HHHHHCCCCCCCCEEEECCC
Q ss_conf             467876557----66420013367730461045
Q gi|255764473|r  134 PCQIIADIM----TFEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus       134 PtQaL~D~~----Ti~e~~g~l~~~~i~~vGd~  162 (306)
                      |+ +-.|-+    .+-++.-.....++++++..
T Consensus        93 ~~-V~~Dn~~a~~~~~~~L~~~G~~~i~~i~~~  124 (267)
T cd06284          93 PS-VSIDNVAAARLAVDHLISLGHRRIALITGP  124 (267)
T ss_pred             CE-EEECHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             88-996789999999999997099769996288


No 247
>PRK13906 murB UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional
Probab=33.33  E-value=36  Score=14.85  Aligned_cols=50  Identities=14%  Similarity=0.167  Sum_probs=29.9

Q ss_pred             EEEEECCCCCHHHHHHHHH-HHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEEC
Q ss_conf             9999428883578999989-8634754333321000012321079999975-300101112101
Q gi|255764473|r   47 LAMIFEKPSTRTRVSFEVA-MKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTT  108 (306)
Q Consensus        47 i~~lF~e~StRTR~SFe~A-~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~  108 (306)
                      -|-+|.+|.+-.-+.--.. +++-+..+..+..+ |++           .+ ..+++++|+|..
T Consensus        36 ~A~~~~~p~~~~~l~~~~~~~~~~~ip~~vlG~G-SNl-----------Lv~D~g~~GiVI~l~   87 (307)
T PRK13906         36 NADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNG-SNI-----------IIREGGIRGIVISLL   87 (307)
T ss_pred             EEEEEEEECCHHHHHHHHHHHHHCCCCEEEECCC-EEE-----------EEECCCCCEEEEEEC
T ss_conf             9789996499999999999898769978998270-699-----------896698032899955


No 248
>pfam02601 Exonuc_VII_L Exonuclease VII, large subunit. This family consist of exonuclease VII, large subunit EC:3.1.11.6 This enzyme catalyses exonucleolytic cleavage in either 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. This exonuclease VII enzyme is composed of one large subunit and 4 small ones.
Probab=32.90  E-value=36  Score=14.81  Aligned_cols=94  Identities=20%  Similarity=0.251  Sum_probs=43.4

Q ss_pred             CEEEEEECCCCCHHHHHH-HHHHHHCCC-CCCCCCCCCCCCCC-CCCHHHHHHHHHHC-----CCE-EEEEECC------
Q ss_conf             879999428883578999-989863475-43333210000123-21079999975300-----101-1121013------
Q gi|255764473|r   45 KVLAMIFEKPSTRTRVSF-EVAMKHLGG-DTIFLSGSEMQLGR-AETIGDTAKVLSRY-----VDA-IVMRTTN------  109 (306)
Q Consensus        45 k~i~~lF~e~StRTR~SF-e~A~~~LG~-~~~~~~~~~ss~~k-gEsl~Dt~~~ls~~-----~D~-iviR~~~------  109 (306)
                      +.||.+=-..+- ---=| ...-++-.+ ++..+ +...|... .+++...++.+..+     +|+ +++|+..      
T Consensus        15 ~~IgvITS~~gA-a~~Di~~~~~~r~p~~~i~l~-p~~VQG~~a~~~I~~ai~~~~~~~~~~~~Dviii~RGGGS~eDL~   92 (295)
T pfam02601        15 KRIAVITSATGA-AYQDFLRTARRRGPLVEIEIY-PTLVQGDGAAESIVSALERANERETALDYDVIVIIRGGGSKEDLW   92 (295)
T ss_pred             CEEEEEECCCCH-HHHHHHHHHHHHCCCCEEEEE-CCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHH
T ss_conf             989998489408-999999999981999679994-735765048999999999998468989983899957868889874


Q ss_pred             ---CCHHHHHHCCCCCCEECCCCCCCHHH-HHHHHHHH
Q ss_conf             ---20067763012441240433320246-78765576
Q gi|255764473|r  110 ---HSRLLELTEYATVPVINALTDNTHPC-QIIADIMT  143 (306)
Q Consensus       110 ---~~~~~~~~~~~~vpvINa~~~~~HPt-QaL~D~~T  143 (306)
                         +..+-.....+.+|||.|=+   |=| -.|+|+-.
T Consensus        93 ~FN~e~laraI~~~~iPvisaIG---HEtD~Tl~D~VA  127 (295)
T pfam02601        93 VFNDEELARAIANSPIPVITGIG---HETDTTIADLVA  127 (295)
T ss_pred             HCCHHHHHHHHHHCCCCEEECCC---CCCCCCHHHHHH
T ss_conf             55889999999838998780678---899961888887


No 249
>PRK06199 ornithine cyclodeaminase; Validated
Probab=32.51  E-value=23  Score=16.15  Aligned_cols=76  Identities=16%  Similarity=0.226  Sum_probs=39.3

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCC-CCC-CEE-EEEECHHCCCCCCCCHHHHHC---CCCCCCCCCCHHHHCCCCCCC
Q ss_conf             01336773046104555543101001-233-125-765200001321000024320---133222136646630687332
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGA-ARF-NYL-LNIATPIGSEPRNEYLNWARN---QGASVALFHDAVQAVKGAHCV  221 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~-~~~-g~~-v~~~~P~~~~~~~~~~~~~~~---~g~~i~~~~d~~eal~~aD~V  221 (306)
                      ...-+..+++++|-+. .++..++++ ... +.+ +.+..+.. .-.+.+..+.+.   .+..+....+.+++++++|+|
T Consensus       150 LAr~da~~lgiIG~G~-qAr~~l~Al~~vrp~i~~V~V~~r~~-~~a~~fa~~~~~~~~~~~~v~~~~s~eeav~~aDIV  227 (379)
T PRK06199        150 LARKDAKVVGLVGPGV-MGKTIVAAFMAVCPGIDTIKIKGRSQ-KSLDAFATWVAETYPQITEVVVVDSEEEVVRGSDIV  227 (379)
T ss_pred             HCCCCCCEEEEECCHH-HHHHHHHHHHHHCCCCCEEEEECCCH-HHHHHHHHHHHHHCCCCCEEEEECCHHHHHHCCCEE
T ss_conf             5558997899989639-99999999998617888899988999-999999999997668885089829999997379999


Q ss_pred             CCCC
Q ss_conf             2210
Q gi|255764473|r  222 FTDT  225 (306)
Q Consensus       222 ~~~~  225 (306)
                      .+-.
T Consensus       228 vtaT  231 (379)
T PRK06199        228 TYCT  231 (379)
T ss_pred             EECC
T ss_conf             9777


No 250
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.; GO: 0003677 DNA binding, 0005524 ATP binding, 0009378 Holliday junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=32.39  E-value=23  Score=16.13  Aligned_cols=39  Identities=26%  Similarity=0.425  Sum_probs=23.8

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC--CCEEEEE
Q ss_conf             9898634754333321000012321079999975300--1011121
Q gi|255764473|r   63 EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY--VDAIVMR  106 (306)
Q Consensus        63 e~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~--~D~iviR  106 (306)
                      .+=|+.||-+.-..++..  +   |--.|-+..|++.  -|++-|=
T Consensus        48 ~IiA~Emg~~l~iTsGP~--L---~kPgDlaaiLt~L~~gDVLFID   88 (305)
T TIGR00635        48 HIIANEMGVNLKITSGPA--L---EKPGDLAAILTNLEEGDVLFID   88 (305)
T ss_pred             HHHHHHHCCCCEEEECCC--C---CCHHHHHHHHHHCCCCCEEECC
T ss_conf             999998389326740675--5---4757899999705689631012


No 251
>TIGR00421 ubiX_pad polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases; InterPro: IPR004507   This family contains flavoproteins, which are aromatic acid decarboxylases. An example is the Saccharomyces cerevisiae gene, PAD1 that encodes phenylacrylic acid decarboxylase. Mutations of this gene are viable and confer resistance to cinnamic acid. ; GO: 0016831 carboxy-lyase activity.
Probab=32.37  E-value=26  Score=15.74  Aligned_cols=24  Identities=17%  Similarity=0.431  Sum_probs=18.8

Q ss_pred             CCCHH-HHHCCCCCCEEECCCCCCC
Q ss_conf             33688-9962898729925999874
Q gi|255764473|r  245 QVNLS-LMSMAHPDALFMHCLPAHR  268 (306)
Q Consensus       245 ~i~~~-~l~~a~~~~~vmHplP~~r  268 (306)
                      ++..| +|+.++..++||.|+|++=
T Consensus       126 SiHLENmL~L~~~G~IIlPP~PaFY  150 (181)
T TIGR00421       126 SIHLENMLRLSRMGAIILPPVPAFY  150 (181)
T ss_pred             HHHHHHHHHHHHCCCEEECCCCCCC
T ss_conf             1548999999827925327955444


No 252
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of AraR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which i
Probab=31.93  E-value=38  Score=14.70  Aligned_cols=66  Identities=15%  Similarity=0.181  Sum_probs=39.7

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEEC----CC---CHHHHHHCCCCCCEECCCC
Q ss_conf             89999898634754333321000012321079999975-300101112101----32---0067763012441240433
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTT----NH---SRLLELTEYATVPVINALT  129 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~----~~---~~~~~~~~~~~vpvINa~~  129 (306)
                      --+.+.++++.|-+++..+...+.    |.-++..+.| +..+|++++-..    .+   ..+..+. ..++||+..+.
T Consensus        18 ~~gi~~~~~~~gy~~li~~s~~~~----~~e~~~l~~l~~~~vdGiIl~~~~~~~~~~~~~~~~~l~-~~~iPvV~i~~   91 (273)
T cd01541          18 IRGIESVLSEKGYSLLLASTNNDP----ERERKCLENMLSQGIDGLIIEPTKSALPNPNIDLYLKLE-KLGIPYVFINA   91 (273)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCH----HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHH-HCCCCEEEEEC
T ss_conf             999999999869989999789998----999999999996599989992531035787779999999-76998999956


No 253
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=31.82  E-value=38  Score=14.69  Aligned_cols=86  Identities=10%  Similarity=0.044  Sum_probs=51.1

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHH-----HCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCC
Q ss_conf             4678765576642001336773046104555543101-----00123312576520000132100002432013322213
Q gi|255764473|r  134 PCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLI-----EGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALF  208 (306)
Q Consensus       134 PtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i-----~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~  208 (306)
                      |-.++.++.++.+.+.  .+..+.+.|+++ |.-|++     ..+.+.|..+.++.-+.+      ....+..-..-...
T Consensus        88 ~~~~l~~~~~~~~~~~--~~~nl~l~G~~G-~GKthLa~Ai~~~l~~~g~sv~f~~~~el------~~~Lk~~~~~~~~~  158 (254)
T COG1484          88 DKKALEDLASLVEFFE--RGENLVLLGPPG-VGKTHLAIAIGNELLKAGISVLFITAPDL------LSKLKAAFDEGRLE  158 (254)
T ss_pred             HHHHHHHHHHHHHHHC--CCCCEEEECCCC-CCHHHHHHHHHHHHHHCCCEEEEEEHHHH------HHHHHHHHHCCCHH
T ss_conf             6999999999998732--588289989999-87999999999999983984999885999------99999987455268


Q ss_pred             CCHHHHCCCCCCCCCCCEEE
Q ss_conf             66466306873322210000
Q gi|255764473|r  209 HDAVQAVKGAHCVFTDTWIS  228 (306)
Q Consensus       209 ~d~~eal~~aD~V~~~~~~~  228 (306)
                      ..+...+..+|+++.|-+..
T Consensus       159 ~~l~~~l~~~dlLIiDDlG~  178 (254)
T COG1484         159 EKLLRELKKVDLLIIDDIGY  178 (254)
T ss_pred             HHHHHHHHHCCEEEEECCCC
T ss_conf             99998875289899823677


No 254
>COG1160 Predicted GTPases [General function prediction only]
Probab=31.75  E-value=33  Score=15.08  Aligned_cols=142  Identities=19%  Similarity=0.267  Sum_probs=62.5

Q ss_pred             CCCCCCEEEEEECCCC-CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHH--HHH-H-CCCEEEEEE-------
Q ss_conf             4437987999942888-357899998986347543333210000123210799999--753-0-010111210-------
Q gi|255764473|r   40 KPLSGKVLAMIFEKPS-TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAK--VLS-R-YVDAIVMRT-------  107 (306)
Q Consensus        40 ~~l~gk~i~~lF~e~S-tRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~--~ls-~-~~D~iviR~-------  107 (306)
                      +.|.|+.++++=..|. ||-|.-  ..+..+|-.+..+|-+..-....+.+..-.+  ++. . -.|++..=.       
T Consensus        21 NRL~g~r~AIV~D~pGvTRDr~y--~~~~~~~~~f~lIDTgGl~~~~~~~l~~~i~~Qa~~Ai~eADvilfvVD~~~Git   98 (444)
T COG1160          21 NRLTGRRIAIVSDTPGVTRDRIY--GDAEWLGREFILIDTGGLDDGDEDELQELIREQALIAIEEADVILFVVDGREGIT   98 (444)
T ss_pred             HHHHCCEEEEEECCCCCCCCCCC--CEEEECCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCC
T ss_conf             88757702676069997557754--5069838607999789977688128999999999999976799999984887899


Q ss_pred             CCCCHHHHHHCCCCCC---EECCCCCCC----------------HH-----HHHHHHHHH-HHHHC------CCC---CC
Q ss_conf             1320067763012441---240433320----------------24-----678765576-64200------133---67
Q gi|255764473|r  108 TNHSRLLELTEYATVP---VINALTDNT----------------HP-----CQIIADIMT-FEEHR------GSV---KG  153 (306)
Q Consensus       108 ~~~~~~~~~~~~~~vp---vINa~~~~~----------------HP-----tQaL~D~~T-i~e~~------g~l---~~  153 (306)
                      +.+..+..+-.....|   |+|=-++..                +|     .+.+.|++- +.+..      ...   +.
T Consensus        99 ~~D~~ia~~Lr~~~kpviLvvNK~D~~~~e~~~~efyslG~g~~~~ISA~Hg~Gi~dLld~v~~~l~~~e~~~~~~~~~~  178 (444)
T COG1160          99 PADEEIAKILRRSKKPVILVVNKIDNLKAEELAYEFYSLGFGEPVPISAEHGRGIGDLLDAVLELLPPDEEEEEEEETDP  178 (444)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEHHHCCCHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             78999999998539988999976667304564899986478982684255356989999999975677433444356775


Q ss_pred             CCEEEECCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             73046104555543101001233125765200
Q gi|255764473|r  154 KLFSWSGDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       154 ~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      .+|+++|-+|-=.-|++.++  +|-+-.+++|
T Consensus       179 ikiaiiGrPNvGKSsLiN~i--lgeeR~Iv~~  208 (444)
T COG1160         179 IKIAIIGRPNVGKSSLINAI--LGEERVIVSD  208 (444)
T ss_pred             EEEEEEECCCCCCHHHHHHH--CCCCEEEECC
T ss_conf             08999927878705888775--0682598459


No 255
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed
Probab=31.31  E-value=38  Score=14.64  Aligned_cols=106  Identities=16%  Similarity=0.196  Sum_probs=57.1

Q ss_pred             CCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCH-------HHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             17844589999999999999999665236665443798799994288835-------78999989863475433332100
Q gi|255764473|r    8 FADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTR-------TRVSFEVAMKHLGGDTIFLSGSE   80 (306)
Q Consensus         8 ~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StR-------TR~SFe~A~~~LG~~~~~~~~~~   80 (306)
                      |....+|+..-+..|++      +            +-.+..++-+|.-|       +-..+..-|.+.|..+...  . 
T Consensus         5 f~Gt~~fs~~~L~~L~~------~------------~~~i~~Vvt~pdk~~gR~~k~~~~~v~~~a~~~~i~~~~p--~-   63 (309)
T PRK00005          5 FMGTPEFAVPSLKALLE------S------------GHEVVAVVTQPDRPAGRGKKLTPSPVKQLALEHGIPVLQP--E-   63 (309)
T ss_pred             EECCCHHHHHHHHHHHH------C------------CCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCEEEC--C-
T ss_conf             98898899999999997------8------------9947999929998668999798998999999869938835--7-


Q ss_pred             CCCCCCCCHHHHHHHHH-HCCCEEEEEECCCCHHHHHHCCCCCCEECCC-C-----CCCHHHH-HHH
Q ss_conf             00123210799999753-0010111210132006776301244124043-3-----3202467-876
Q gi|255764473|r   81 MQLGRAETIGDTAKVLS-RYVDAIVMRTTNHSRLLELTEYATVPVINAL-T-----DNTHPCQ-IIA  139 (306)
Q Consensus        81 ss~~kgEsl~Dt~~~ls-~~~D~iviR~~~~~~~~~~~~~~~vpvINa~-~-----~~~HPtQ-aL~  139 (306)
                       +++ .+   |....+. .-.|++|+=....-...++-+....-.||-= +     ...+|-| ||+
T Consensus        64 -~~~-~~---~~~~~l~~~~~Dl~vv~~~g~iip~~~l~~~~~g~iN~H~SlLP~yRG~aPi~~ail  125 (309)
T PRK00005         64 -SLR-DP---EFLAELAALNADVIVVVAYGQILPKAVLDIPRLGCINLHASLLPRWRGAAPIQRAII  125 (309)
T ss_pred             -CCC-CH---HHHHHHHHCCCCEEEEEEHHHHCCHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHH
T ss_conf             -799-99---999999841999999975234334999827887859831544756567575789987


No 256
>PRK09564 coenzyme A disulfide reductase; Reviewed
Probab=31.28  E-value=32  Score=15.14  Aligned_cols=64  Identities=17%  Similarity=0.190  Sum_probs=44.7

Q ss_pred             CCEECCCC-CCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHH
Q ss_conf             41240433-320246787655766420013367730461045555431010012331257652000
Q gi|255764473|r  122 VPVINALT-DNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       122 vpvINa~~-~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +|=|.+.+ ..-|.+..+.|...+++....-+.++++++|-+. +.--+...++++|.+++++...
T Consensus       117 ~p~i~g~~~~~v~~~~~~~d~~~l~~~~~~~~~k~vvViGgG~-ig~E~A~~l~~~G~~Vtiv~~~  181 (443)
T PRK09564        117 IPPIKNINLENVYTLRSMEDGLALKKLLKKKEIKRIVIIGAGF-IGLEVVEAAKKLGKNVRIIQLE  181 (443)
T ss_pred             CCCCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCEEEEECCHH-HHHHHHHHHHHCCCEEEEEEEC
T ss_conf             6998875666656765789999999976512796599999709-9999999998669889999957


No 257
>KOG3892 consensus
Probab=31.20  E-value=39  Score=14.62  Aligned_cols=41  Identities=20%  Similarity=0.156  Sum_probs=30.7

Q ss_pred             CCCCCEECCCCCCCHHHHHHH----H-HHHHHHHCCCCCCCCEEEE
Q ss_conf             124412404333202467876----5-5766420013367730461
Q gi|255764473|r  119 YATVPVINALTDNTHPCQIIA----D-IMTFEEHRGSVKGKLFSWS  159 (306)
Q Consensus       119 ~~~vpvINa~~~~~HPtQaL~----D-~~Ti~e~~g~l~~~~i~~v  159 (306)
                      +..=|+||+.-...||-|-+.    | +-++.+.+|.+++.+|.-.
T Consensus       142 HlEGPFIs~~KrG~HPE~~i~s~~~~~~~~l~~tYGsleni~IvTl  187 (407)
T KOG3892         142 HLEGPFISREKRGAHPEAHIRSFEADAFQDLLATYGSLENIRIVTL  187 (407)
T ss_pred             ECCCCCCCHHHCCCCHHHHHHCCCCCHHHHHHHHHCCCCCEEEEEE
T ss_conf             3137844743147997998730586578889987186343589994


No 258
>PRK06198 short chain dehydrogenase; Provisional
Probab=31.09  E-value=20  Score=16.46  Aligned_cols=20  Identities=10%  Similarity=-0.160  Sum_probs=12.7

Q ss_pred             CCHHHCCCCCCEEEEEECHH
Q ss_conf             31010012331257652000
Q gi|255764473|r  167 HSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       167 hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +|+...+...|.+++-++|-
T Consensus       169 kslA~e~a~~gIrVNaI~PG  188 (268)
T PRK06198        169 RNVAYALLRNRIRVNGLNIG  188 (268)
T ss_pred             HHHHHHHHHCCEEEEEEEEC
T ss_conf             99999970569499988757


No 259
>cd01966 Nitrogenase_NifN_1 Nitrogenase_nifN1: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE.  NifN and nifE are structurally homologous to nitrogenase MoFe protein beta and alpha subunits respectively.  NifEN participates in the synthesis of the iron-molybdenum cofactor (FeMoco) of the MoFe protein.  NifB-co (an iron and sulfur containing precursor of the FeMoco) from NifB is transferred to the NifEN complex where it is further processed to FeMoco. The nifEN bound precursor of FeMoco has been identified as a molybdenum-free, iron- and sulfur- containing analog of FeMoco. It has been suggested that this nifEN bound precursor also acts as a cofactor precursor in nitrogenase systems which require a cofactor other than FeMoco: i.e. iron-vanadium cofactor (FeVco) or iron only cofactor (FeFeco).
Probab=30.96  E-value=39  Score=14.60  Aligned_cols=32  Identities=16%  Similarity=0.031  Sum_probs=19.0

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEE
Q ss_conf             336773046104555543101001233125765
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNI  182 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~  182 (306)
                      .+.|+++++.||+.- +.|+...+.-+|+++..
T Consensus       297 ~l~gkrvai~gd~d~-~~~l~~fL~ElG~~~~~  328 (417)
T cd01966         297 YLGGKRVAIALEPDL-LAALSSFLAEMGAEIVA  328 (417)
T ss_pred             HHCCCEEEEECCCHH-HHHHHHHHHHCCCEEEE
T ss_conf             856977999877169-99999999978998889


No 260
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated
Probab=30.86  E-value=33  Score=15.04  Aligned_cols=69  Identities=14%  Similarity=0.129  Sum_probs=37.6

Q ss_pred             CCCCCCCEEEECCCC----------------CCCCCHHHCCCCCCEEEEEE-CHHCCCCCCCCHHHHHCCCCCCCCCCCH
Q ss_conf             133677304610455----------------55431010012331257652-0000132100002432013322213664
Q gi|255764473|r  149 GSVKGKLFSWSGDGN----------------NILHSLIEGAARFNYLLNIA-TPIGSEPRNEYLNWARNQGASVALFHDA  211 (306)
Q Consensus       149 g~l~~~~i~~vGd~~----------------~v~hS~i~~~~~~g~~v~~~-~P~~~~~~~~~~~~~~~~g~~i~~~~d~  211 (306)
                      .+++|++|.+.+-+.                .....+.+.+.+.|++|+++ +|....+|. .++..     .+....++
T Consensus       182 ~~l~gkkvLITaG~T~E~IDpVR~IsN~SSGkmG~aiA~~a~~~GA~VtlI~g~~~~~~p~-~v~~i-----~v~ta~eM  255 (392)
T PRK05579        182 KDLAGKRVLITAGPTREPIDPVRYITNRSSGKMGYALARAAARRGADVTLVSGPVNLPTPA-GVKRI-----DVESAQEM  255 (392)
T ss_pred             CCCCCCEEEEECCCCEEEECCEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCC-CCEEE-----EECCHHHH
T ss_conf             7767887999747724776762476657865899999999996799799996478778999-96799-----96759999


Q ss_pred             HH----HCCCCCCCCC
Q ss_conf             66----3068733222
Q gi|255764473|r  212 VQ----AVKGAHCVFT  223 (306)
Q Consensus       212 ~e----al~~aD~V~~  223 (306)
                      .+    .++++|++++
T Consensus       256 ~~~v~~~~~~~D~~I~  271 (392)
T PRK05579        256 LDAVLAAAQKADIFIM  271 (392)
T ss_pred             HHHHHHHCCCCCEEEE
T ss_conf             9999973544789999


No 261
>pfam03060 NPD 2-nitropropane dioxygenase. Members of this family catalyse the denitrification of a number of nitroalkanes using either FAD or FMN as a cofactor.
Probab=30.62  E-value=39  Score=14.56  Aligned_cols=22  Identities=14%  Similarity=0.220  Sum_probs=13.9

Q ss_pred             CHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             8445899999999999999996
Q gi|255764473|r   10 DLSNISSSNLSCIIEVAKKIKN   31 (306)
Q Consensus        10 ~~~dl~~~~i~~ll~~A~~~k~   31 (306)
                      ...-++.+++...++..+++-.
T Consensus        41 ~~~~~~~e~l~~~i~~~~~~t~   62 (330)
T pfam03060        41 GAGYLTPDRLEKEIRKVKELTD   62 (330)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHC
T ss_conf             2776999999999999998648


No 262
>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain. This family represents the largest portion of the catalytic domain of 2-hydroxyacid dehydrogenases as the NAD binding domain is inserted within the structural domain.
Probab=30.61  E-value=39  Score=14.56  Aligned_cols=72  Identities=18%  Similarity=0.157  Sum_probs=45.8

Q ss_pred             HHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHHHC------------------C-CCCCCCEEEECCCCCCCCCHHHC
Q ss_conf             7763012441240433320246--7876557664200------------------1-33677304610455554310100
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHPC--QIIADIMTFEEHR------------------G-SVKGKLFSWSGDGNNILHSLIEG  172 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e~~------------------g-~l~~~~i~~vGd~~~v~hS~i~~  172 (306)
                      .+.++...|+|.|+-+...-++  .+++=++++.++.                  + .+.++++.++|-+ ++.......
T Consensus        77 ~~~a~~~gI~V~n~p~~~~~aVAE~~i~l~L~l~R~~~~~~~~~r~g~w~~~~~~~~~l~~~~~giiG~G-~iG~~va~~  155 (313)
T pfam00389        77 LDAATERGILVTNVPGYSTESVAELTVGLILALARRIPEADASVRAGDWKKGGPIGLELRGKTLGVIGGG-GIGGIGAAI  155 (313)
T ss_pred             HHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEC-CHHHHHHHH
T ss_conf             9999979999998998772899999999999971230788999980876655655533689889999465-436999999


Q ss_pred             CCCCCEEEEEECHH
Q ss_conf             12331257652000
Q gi|255764473|r  173 AARFNYLLNIATPI  186 (306)
Q Consensus       173 ~~~~g~~v~~~~P~  186 (306)
                      +..||+.+....|.
T Consensus       156 ~~~~g~~v~~~d~~  169 (313)
T pfam00389       156 AKALGMGVVAYDPY  169 (313)
T ss_pred             HHHCCCEEEEEECC
T ss_conf             99769869999579


No 263
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation. This group includes the ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation. This group belongs to the the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=30.55  E-value=40  Score=14.55  Aligned_cols=99  Identities=14%  Similarity=0.106  Sum_probs=52.0

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECC-CCHHHHHHCCCCCCEECCCCCC----C
Q ss_conf             89999898634754333321000012321079999975-3001011121013-2006776301244124043332----0
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTN-HSRLLELTEYATVPVINALTDN----T  132 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~-~~~~~~~~~~~~vpvINa~~~~----~  132 (306)
                      --..+.++++.|-+++.......    .|.-.+.++.+ +..+|++++=... .....+..+..++||+.-....    .
T Consensus        18 ~~gi~~~~~~~gy~~ll~~~~~~----~~~e~~~i~~l~~~~vdgiIi~~~~~~~~~~~~l~~~~iPvV~id~~~~~~~~   93 (270)
T cd06296          18 LRGVEEAAAAAGYDVVLSESGRR----TSPERQWVERLSARRTDGVILVTPELTSAQRAALRRTGIPFVVVDPAGDPDAD   93 (270)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCC----HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             99999999984998999979999----69999999999954999999906889999999999749999998788888889


Q ss_pred             HHHHHHHHHHH----HHHHCCCCCCCCEEEECCC
Q ss_conf             24678765576----6420013367730461045
Q gi|255764473|r  133 HPCQIIADIMT----FEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus       133 HPtQaL~D~~T----i~e~~g~l~~~~i~~vGd~  162 (306)
                      -|+ +-.|-+.    .-+++-..--.+|+|++..
T Consensus        94 ~~~-V~~Dn~~a~~~a~~~L~~~G~~~I~~i~~~  126 (270)
T cd06296          94 VPS-VGATNWAGGLAATEHLLELGHRRIGFITGP  126 (270)
T ss_pred             CCE-EEECHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             868-995769999999999998589728884599


No 264
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1; InterPro: IPR011940    This entry describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (IPR011938 from INTERPRO) and RadB (IPR011939 from INTERPRO) and bacterial RecA. It has been characterised for human as a recombinase active only in meiosis .; GO: 0003677 DNA binding, 0005524 ATP binding, 0008094 DNA-dependent ATPase activity, 0007131 meiotic recombination, 0005634 nucleus.
Probab=30.31  E-value=20  Score=16.55  Aligned_cols=34  Identities=26%  Similarity=0.331  Sum_probs=30.0

Q ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9988877178445899999999999999996652
Q gi|255764473|r    1 MMTYPKHFADLSNISSSNLSCIIEVAKKIKNSSE   34 (306)
Q Consensus         1 ~m~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~   34 (306)
                      +|+.+|+|+.++-||...++.|.+.|.++.+...
T Consensus        29 ~~~T~r~L~~iKGlSEaKVdKi~EaA~K~~~~~f   62 (314)
T TIGR02238        29 IMTTKRELLKIKGLSEAKVDKIKEAASKIINVGF   62 (314)
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             9988888740378516779999999987641466


No 265
>cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins are accessory proteins, localized at synapses, which interact with the endocytic proteins, dynamin and synaptojanin. They are essential for synaptic vesicle formation from the plasma membrane. They interact with voltage-gated calcium channels, thus linking vesicle endocytosis to calcium regulation. They also play roles in virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Endophilin-A proteins are enriched in the brain and play multiple roles in receptor-mediated
Probab=30.26  E-value=5.3  Score=20.26  Aligned_cols=134  Identities=13%  Similarity=0.208  Sum_probs=71.6

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999999999999665236665443798799994288835789999898634754333321000012321079999975
Q gi|255764473|r   17 SNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL   96 (306)
Q Consensus        17 ~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l   96 (306)
                      +++..|...+...+....+.     + .++...|=-+|+.|.+.++-.+..++-|.+-.-....-...-|++.-+...-|
T Consensus         7 ~dF~~Le~r~d~t~~~~e~l-----~-~~t~~yLqPNP~~R~~~~~~~~~sK~rg~~k~~~~p~~~~~LG~~Mi~~G~d~   80 (223)
T cd07614           7 DDFKEMEKKVDLTSKAVTEV-----L-ARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGETMIRYGKEL   80 (223)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-----H-HHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             89999999998999999999-----9-98799828985778999999889998623568899982658999999862427


Q ss_pred             H---HCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHH--HHHHHHHHHCCCCCCCCEEEE
Q ss_conf             3---00101112101320067763012441240433320246787--655766420013367730461
Q gi|255764473|r   97 S---RYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQII--ADIMTFEEHRGSVKGKLFSWS  159 (306)
Q Consensus        97 s---~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL--~D~~Ti~e~~g~l~~~~i~~v  159 (306)
                      +   .|..+++-=+   .+...++..-.-.+.++.++--.|-+-+  .|+-+|..+++.+++.++.|=
T Consensus        81 g~~s~~G~aL~~~G---ea~~kla~~~~~~~~~~~~~fL~pL~~~l~~dlKei~~~RKkLe~rRLd~D  145 (223)
T cd07614          81 GDESNFGDALLDAG---ESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFD  145 (223)
T ss_pred             CCCCCHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99983699999998---999999999999999999988889999998579999999998874656679


No 266
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=29.89  E-value=24  Score=15.99  Aligned_cols=115  Identities=13%  Similarity=0.114  Sum_probs=57.3

Q ss_pred             HHHHHHHHH-CC---CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHH---HHCCCCCCCCCCCH
Q ss_conf             655766420-01---336773046104555543101001233125765200001321000024---32013322213664
Q gi|255764473|r  139 ADIMTFEEH-RG---SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNW---ARNQGASVALFHDA  211 (306)
Q Consensus       139 ~D~~Ti~e~-~g---~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~---~~~~g~~i~~~~d~  211 (306)
                      ...+|+-.+ .|   .++|++|++.|-.+....+++..+.+-|+++...+-..-..+.+.-..   .+.-.=++.....+
T Consensus       162 ~g~~tlvDklmGTalSLKGKTV~VTGASG~LG~aL~k~l~~~GAKVIalTs~~~~i~~~~~~~~~~~~~i~W~~G~E~~L  241 (410)
T PRK07424        162 CGTFTLVDKLMGTALSLKGKTVAVTGASGTLGQALLKELHQQGAKVIALTSNSDKIPLEINGEDLPVKTIHWQVGQEAAL  241 (410)
T ss_pred             EEEEHHHHHHHCCEEECCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCHHHH
T ss_conf             42220255552101301686799954773778999999997799899993589865534466546712786432888898


Q ss_pred             HHHCCCCCCCCCCCEE-ECCCC-----CHHHHHHCCCCCCCCHHHHHC
Q ss_conf             6630687332221000-00022-----013331001112336889962
Q gi|255764473|r  212 VQAVKGAHCVFTDTWI-SMNQE-----FKAREEHVFQPFQVNLSLMSM  253 (306)
Q Consensus       212 ~eal~~aD~V~~~~~~-~~~~~-----~~~~~~~~~~~y~i~~~~l~~  253 (306)
                      ++.++..|+++-.-=. ..++.     .+.-+.+.+..|++-+-+++.
T Consensus       242 ~~~L~kiDILILNHGIN~~g~~~~~~i~~S~EINalS~~rll~lF~~~  289 (410)
T PRK07424        242 AELLEKVDILVINHGINVHGERTPEAINKSYEVNTFSAWRLMELFLTT  289 (410)
T ss_pred             HHHHHHCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             888864689988488785666597898876747877799999999999


No 267
>PRK07680 late competence protein ComER; Validated
Probab=29.89  E-value=35  Score=14.91  Aligned_cols=31  Identities=10%  Similarity=0.053  Sum_probs=15.5

Q ss_pred             CCEEEEEECCC---CHHHHHHCC--CCCCEECCCCC
Q ss_conf             10111210132---006776301--24412404333
Q gi|255764473|r  100 VDAIVMRTTNH---SRLLELTEY--ATVPVINALTD  130 (306)
Q Consensus       100 ~D~iviR~~~~---~~~~~~~~~--~~vpvINa~~~  130 (306)
                      .|++++=..++   ..+.++..+  .+..||+-.-|
T Consensus        63 ~dvIiLaVKPq~~~~vl~~i~~~~~~~~~iISi~AG   98 (273)
T PRK07680         63 SELIFICVKPLDIYPLLKKLAPHFSDEKCLVSITSP   98 (273)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             998999648888999999988634788489995588


No 268
>pfam00148 Oxidored_nitro Nitrogenase component 1 type Oxidoreductase.
Probab=29.87  E-value=41  Score=14.48  Aligned_cols=36  Identities=14%  Similarity=0.111  Sum_probs=23.7

Q ss_pred             CCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             1336773046104555543101001233125765200
Q gi|255764473|r  149 GSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       149 g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      ..+.|+++++.||.. .+.++...+..+|+++..+.-
T Consensus       268 ~~l~gkrv~v~g~~~-~~~~l~~~L~ElG~~v~~~~~  303 (398)
T pfam00148       268 EYLAGKRVAIYGDPD-LAWGLARFLEELGMEVVAVGT  303 (398)
T ss_pred             HHHCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEEEE
T ss_conf             873797799988845-799999999987997999996


No 269
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=29.71  E-value=37  Score=14.74  Aligned_cols=22  Identities=14%  Similarity=0.157  Sum_probs=11.2

Q ss_pred             CCEEEEEECCCCHHHHHHCCCC
Q ss_conf             1011121013200677630124
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELTEYAT  121 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~~~~~  121 (306)
                      .|+|..=..+.-.+.+++....
T Consensus       110 ~~~IlASNTSsL~it~iA~~~~  131 (503)
T PRK08268        110 DDCILATNTSSLSITAIAAALK  131 (503)
T ss_pred             CCCEEEECCCCCCHHHHHHHCC
T ss_conf             8857984177677999997469


No 270
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional
Probab=29.61  E-value=28  Score=15.52  Aligned_cols=72  Identities=8%  Similarity=-0.055  Sum_probs=33.1

Q ss_pred             CCCCCCCEEEECC-----CCCCCCCHH----HCCCCC-CEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCC
Q ss_conf             1336773046104-----555543101----001233-125765200001321000024320133222136646630687
Q gi|255764473|r  149 GSVKGKLFSWSGD-----GNNILHSLI----EGAARF-NYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGA  218 (306)
Q Consensus       149 g~l~~~~i~~vGd-----~~~v~hS~i----~~~~~~-g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~a  218 (306)
                      +.+++.+|++.|=     .+.+..|-.    +.+... +.++.+.-|.-        ......-.......++.++++++
T Consensus       316 ~~~~~~~I~iLGlafK~~tdD~R~Sps~~ii~~L~~~~~a~v~~~DP~v--------~~~~~~~~~~~~~~~~~~~~~~a  387 (415)
T PRK11064        316 KRASEVKIACFGLAFKPNIDDLRESPAMEIAQLIAQWHSGETLVVEPNI--------HQLPKKLDGLVTLASLDEALATA  387 (415)
T ss_pred             CCCCCCEEEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCC--------CHHHHHHCCCCEECCHHHHHHCC
T ss_conf             6766877999976666999741358599999999973898399989988--------73357633871336799998279


Q ss_pred             CCCC-CCCEEE
Q ss_conf             3322-210000
Q gi|255764473|r  219 HCVF-TDTWIS  228 (306)
Q Consensus       219 D~V~-~~~~~~  228 (306)
                      |+|. .+.|..
T Consensus       388 D~vii~T~h~e  398 (415)
T PRK11064        388 DVLVMLVDHSQ  398 (415)
T ss_pred             CEEEEECCCHH
T ss_conf             99999249866


No 271
>cd01974 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitrogenase MoFe protein, beta subunit. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen to ammonia. The Molybdenum (Mo-) nitrogenase is the most widespread and best characterized of these systems.  Mo-nitrogenase consists of the MoFe protein (component 1) and the Fe protein (component 2).  MoFe is an alpha2beta2 tetramer. This group contains the beta subunit of the MoFe protein. Each alphabeta pair of MoFe contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha subunit. The Fe protein contains a single [4Fe-4S] cluster.  Electrons are transferred from the [4Fe-4S] cluster of the Fe protein to the P-cluster of the MoFe and in turn to FeMoCo, the site of substrate reduction.
Probab=29.56  E-value=41  Score=14.45  Aligned_cols=98  Identities=12%  Similarity=0.084  Sum_probs=48.0

Q ss_pred             CCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCC--CCCHHH---HHHHHHHH----------------
Q ss_conf             321079999975300101112101320067763012441240433--320246---78765576----------------
Q gi|255764473|r   85 RAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALT--DNTHPC---QIIADIMT----------------  143 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~--~~~HPt---QaL~D~~T----------------  143 (306)
                      .|-+++|..++=+....+++-+.........+.+...+|.+...-  |-..=.   ..|++++=                
T Consensus       213 ggt~~~~i~~~~~A~~ni~l~~~~~~~~a~~Le~~~giP~~~~~~P~G~~~Td~flr~l~~~~g~~~~~~i~~er~r~~d  292 (435)
T cd01974         213 GGTTLEELKDAGNAKATLALQEYATEKTAKFLEKKCKVPVETLNMPIGVAATDEFLMALSELTGKPIPEELEEERGRLVD  292 (435)
T ss_pred             CCCCHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             99869999975248499997777899999999998599869607764569999999999998589946999999999999


Q ss_pred             -HHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEE
Q ss_conf             -6420013367730461045555431010012331257652
Q gi|255764473|r  144 -FEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIA  183 (306)
Q Consensus       144 -i~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~  183 (306)
                       +.+....+.|+++++.||+. .+.++...+.-+|+++..+
T Consensus       293 ~~~d~~~~l~gkrvai~g~~~-~~~~l~~~l~elG~~~~~v  332 (435)
T cd01974         293 AMTDSHQYLHGKKFALYGDPD-FLIGLTSFLLELGMEPVHV  332 (435)
T ss_pred             HHHHHHHHHCCCEEEEECCHH-HHHHHHHHHHHCCCEEEEE
T ss_conf             999998874296799988828-9999999999889978999


No 272
>PRK10433 putative RNA methyltransferase; Provisional
Probab=29.20  E-value=23  Score=16.05  Aligned_cols=29  Identities=21%  Similarity=0.354  Sum_probs=14.5

Q ss_pred             EEEECCCCCHHHHHH-HHHHHHCCCCCCCC
Q ss_conf             999428883578999-98986347543333
Q gi|255764473|r   48 AMIFEKPSTRTRVSF-EVAMKHLGGDTIFL   76 (306)
Q Consensus        48 ~~lF~e~StRTR~SF-e~A~~~LG~~~~~~   76 (306)
                      ..++.||+.=-=+.+ .-|++.+|..-+.+
T Consensus         4 ~iVLvep~~p~NIGa~ARaMkN~G~~~L~L   33 (228)
T PRK10433          4 TIILVAPARAENIGAAARAMKTMGFSELRI   33 (228)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCCCEEE
T ss_conf             999967999751999999997289981699


No 273
>TIGR00050 rRNA_methyl_1 RNA methyltransferase, TrmH family, group 1; InterPro: IPR004384 These proteins are part of the trmH (spoU) family of rRNA methylases. The spoU gene of Escherichia coli codes for a protein that shows strong similarities to previously characterised 2'-O-methyltransferases . TrmH is a tRNA (guanosine-2'-O-)-methyltransferase (2.1.1.34 from EC), which specifically methylates guanosine-18 in various tRNAs using S-adenosyl-L-methionine.; GO: 0008173 RNA methyltransferase activity.
Probab=29.15  E-value=28  Score=15.52  Aligned_cols=73  Identities=12%  Similarity=0.095  Sum_probs=40.0

Q ss_pred             CCCCEEEECC-C-CCCCCCHHHCCCCCCEE-EEEECHHCCCCCCCCHHHH---HCCCCCCCCCCCHHHHCC--CCCCCCC
Q ss_conf             6773046104-5-55543101001233125-7652000013210000243---201332221366466306--8733222
Q gi|255764473|r  152 KGKLFSWSGD-G-NNILHSLIEGAARFNYL-LNIATPIGSEPRNEYLNWA---RNQGASVALFHDAVQAVK--GAHCVFT  223 (306)
Q Consensus       152 ~~~~i~~vGd-~-~~v~hS~i~~~~~~g~~-v~~~~P~~~~~~~~~~~~~---~~~g~~i~~~~d~~eal~--~aD~V~~  223 (306)
                      ...+|..|-. + +|| =|...++.-||++ +.++.|..-.+.++..-.|   +.-=....+++|+.|++.  +.|+|..
T Consensus         3 ~~I~ivLVep~~~gNv-G~~ARaMKnmGl~~L~Lv~p~~~~~~~eay~~A~~A~Di~~nA~vv~~L~Eal~sld~~~~vg   81 (253)
T TIGR00050         3 ENISIVLVEPKHSGNV-GSIARAMKNMGLEELILVNPRVDILEEEAYALAAHAKDILENAKVVDDLDEALDSLDCDLVVG   81 (253)
T ss_pred             CEEEEEEEECCCCCCH-HHHHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCEEECCHHHHHHHCCCCEEEE
T ss_conf             1247888617998644-699999876270012564662255687899987202786587547426799987319970786


Q ss_pred             CC
Q ss_conf             10
Q gi|255764473|r  224 DT  225 (306)
Q Consensus       224 ~~  225 (306)
                      ++
T Consensus        82 Ts   83 (253)
T TIGR00050        82 TS   83 (253)
T ss_pred             CC
T ss_conf             26


No 274
>CHL00076 chlB photochlorophyllide reductase subunit B
Probab=28.99  E-value=42  Score=14.38  Aligned_cols=41  Identities=10%  Similarity=0.158  Sum_probs=28.4

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEEC
Q ss_conf             21079999975300101112101320067763012441240
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN  126 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvIN  126 (306)
                      |-++.|..+.-..++.++..|-.......-+.+....|.+.
T Consensus       203 ga~~~dl~~L~~Ad~Nv~lYrE~g~~~a~~Ler~fg~Py~~  243 (510)
T CHL00076        203 GGSVEDLKNLPKAWFNLVPYREVGLMTAKYLEKEFGMPYVS  243 (510)
T ss_pred             CCCHHHHHCCCCCCEEEECCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             99988884055041888354877899999998873898142


No 275
>PRK10717 cysteine synthase A; Provisional
Probab=28.98  E-value=35  Score=14.91  Aligned_cols=51  Identities=14%  Similarity=0.214  Sum_probs=33.1

Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEE
Q ss_conf             942888357899998986347543333210000123210799999753001011121
Q gi|255764473|r   50 IFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMR  106 (306)
Q Consensus        50 lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR  106 (306)
                      +.+=+|-=|=.+...+|+.+|..++.+-+...+..|-    +.++.++  .+++.+.
T Consensus        67 vveaSSGN~g~alA~~a~~~G~~~~iv~p~~~~~~k~----~~i~~~G--AeVi~v~  117 (334)
T PRK10717         67 IVEGTAGNTGIGLALVAAARGYKTVIVMPETQSQEKK----DLLRALG--AELVEVP  117 (334)
T ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEECCCCHHHHH----HHHHHCC--CEEEECC
T ss_conf             9982797389999999998099659995685459999----9999759--8399768


No 276
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=28.78  E-value=32  Score=15.20  Aligned_cols=71  Identities=25%  Similarity=0.286  Sum_probs=47.0

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCC---CCHHHHCCC-CCCCCC
Q ss_conf             0133677304610455554310100123312576520000132100002432013322213---664663068-733222
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALF---HDAVQAVKG-AHCVFT  223 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~---~d~~eal~~-aD~V~~  223 (306)
                      .+--.|.+|+++|-+ .+.|.-++.+..+|+++..++-     .++..+.+++.|....+.   .|..+++++ +|+++.
T Consensus       162 ~~~~pG~~V~I~G~G-GlGh~avQ~Aka~ga~Via~~~-----~~~K~e~a~~lGAd~~i~~~~~~~~~~~~~~~d~ii~  235 (339)
T COG1064         162 ANVKPGKWVAVVGAG-GLGHMAVQYAKAMGAEVIAITR-----SEEKLELAKKLGADHVINSSDSDALEAVKEIADAIID  235 (339)
T ss_pred             CCCCCCCEEEEECCC-HHHHHHHHHHHHCCCEEEEEEC-----CHHHHHHHHHHCCCEEEECCCCHHHHHHHHHCCEEEE
T ss_conf             389999899998774-8999999999986996999957-----8779999998488289976781166776734739999


Q ss_pred             C
Q ss_conf             1
Q gi|255764473|r  224 D  224 (306)
Q Consensus       224 ~  224 (306)
                      .
T Consensus       236 t  236 (339)
T COG1064         236 T  236 (339)
T ss_pred             C
T ss_conf             8


No 277
>KOG1805 consensus
Probab=28.72  E-value=42  Score=14.35  Aligned_cols=12  Identities=0%  Similarity=0.318  Sum_probs=5.6

Q ss_pred             HCCHHHHHHHHH
Q ss_conf             589999999999
Q gi|255764473|r   13 NISSSNLSCIIE   24 (306)
Q Consensus        13 dl~~~~i~~ll~   24 (306)
                      .|++++..+++.
T Consensus       669 ~LN~dQr~A~~k  680 (1100)
T KOG1805         669 RLNNDQRQALLK  680 (1100)
T ss_pred             HCCHHHHHHHHH
T ss_conf             318899999999


No 278
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism]
Probab=28.52  E-value=43  Score=14.33  Aligned_cols=57  Identities=18%  Similarity=0.206  Sum_probs=39.6

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEE
Q ss_conf             379879999428883578999989863475433332100001232107999997530010111210
Q gi|255764473|r   42 LSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRT  107 (306)
Q Consensus        42 l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~  107 (306)
                      -.|+   .+.+=.|--|=.+....|..+|-+++..=|..+|..|...+    +  +....++....
T Consensus        60 ~pG~---tIVE~TSGNTGIaLA~vaa~~Gy~~~ivmP~~~S~er~~~l----~--a~GAevi~t~~  116 (300)
T COG0031          60 KPGG---TIVEATSGNTGIALAMVAAAKGYRLIIVMPETMSQERRKLL----R--ALGAEVILTPG  116 (300)
T ss_pred             CCCC---EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHH----H--HCCCEEEECCC
T ss_conf             9999---89970897279999999998199289995898999999999----9--82998998379


No 279
>KOG3420 consensus
Probab=28.36  E-value=23  Score=16.16  Aligned_cols=47  Identities=19%  Similarity=0.275  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEECCCCC---CCCCHHHCCCCCCEE
Q ss_conf             24678765576642001336773046104555---543101001233125
Q gi|255764473|r  133 HPCQIIADIMTFEEHRGSVKGKLFSWSGDGNN---ILHSLIEGAARFNYL  179 (306)
Q Consensus       133 HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~---v~hS~i~~~~~~g~~  179 (306)
                      -|--|-.=++||.+..|+++|+++.=+|.+-.   ++-|....-..+|++
T Consensus        29 ~p~iAasM~~~Ih~TygdiEgkkl~DLgcgcGmLs~a~sm~~~e~vlGfD   78 (185)
T KOG3420          29 RPHIAASMLYTIHNTYGDIEGKKLKDLGCGCGMLSIAFSMPKNESVLGFD   78 (185)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCHHHHCCCHHHHHHHHHCCCCCEEEEEE
T ss_conf             67899999999986201204746225247611567775057873378640


No 280
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]
Probab=28.25  E-value=41  Score=14.42  Aligned_cols=60  Identities=17%  Similarity=0.071  Sum_probs=30.6

Q ss_pred             HHHHHHHHHCCCCCCCCC--CCCCCC--CCCCCHHHHH-----HHHHHCCCEEEEEECCCCHHHHHHCC
Q ss_conf             999989863475433332--100001--2321079999-----97530010111210132006776301
Q gi|255764473|r   60 VSFEVAMKHLGGDTIFLS--GSEMQL--GRAETIGDTA-----KVLSRYVDAIVMRTTNHSRLLELTEY  119 (306)
Q Consensus        60 ~SFe~A~~~LG~~~~~~~--~~~ss~--~kgEsl~Dt~-----~~ls~~~D~iviR~~~~~~~~~~~~~  119 (306)
                      -||-.+.++-|..+...+  ....+.  .....+.|..     .......|++++=.|-......+.+.
T Consensus        16 ~s~a~~l~~~g~~v~i~g~d~~~~~~~~a~~lgv~d~~~~~~~~~~~~~aDlVivavPi~~~~~~l~~l   84 (279)
T COG0287          16 GSLARALKEAGLVVRIIGRDRSAATLKAALELGVIDELTVAGLAEAAAEADLVIVAVPIEATEEVLKEL   84 (279)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCHHHHHHHHHCCCCHHHCCCHHHHHCCCCCEEEEECCHHHHHHHHHHH
T ss_conf             999999997698479972477467787766358530100115554135699899957788999999986


No 281
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR). Ligand-binding domain of DNA transcription repressor specific for xylose (XylR), a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of XylR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=28.24  E-value=43  Score=14.30  Aligned_cols=94  Identities=17%  Similarity=0.175  Sum_probs=51.9

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-CCCEEEEEECCCCHHHHHHCCCCCCEECCCCC---CCHHH
Q ss_conf             999989863475433332100001232107999997530-01011121013200677630124412404333---20246
Q gi|255764473|r   60 VSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSR-YVDAIVMRTTNHSRLLELTEYATVPVINALTD---NTHPC  135 (306)
Q Consensus        60 ~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~-~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~---~~HPt  135 (306)
                      ..-|-++++.|..++..++.        .-++..+.+.. -+|+++.+..++.....+ +..++|++-.+..   ...|+
T Consensus        18 ~GIe~~a~~~Gy~~il~~~~--------~~~~~~~~l~~~~VDGiI~~~~~~~~~~~l-~~~~iPvV~i~~~~~~~~~~~   88 (265)
T cd01543          18 RGIARYAREHGPWSIYLEPR--------GLQEPLRWLKDWQGDGIIARIDDPEMAEAL-QKLGIPVVDVSGSREKPGIPR   88 (265)
T ss_pred             HHHHHHHHHCCCEEEEECCC--------CHHHHHHHHHHCCCCEEEEECCCHHHHHHH-HHCCCCEEEECCCCCCCCCCE
T ss_conf             99999999749989998382--------348999999837988899727998999999-847995999898888899998


Q ss_pred             HHHHHHHH----HHHHCCCCCCCCEEEECCCC
Q ss_conf             78765576----64200133677304610455
Q gi|255764473|r  136 QIIADIMT----FEEHRGSVKGKLFSWSGDGN  163 (306)
Q Consensus       136 QaL~D~~T----i~e~~g~l~~~~i~~vGd~~  163 (306)
                       +..|-+.    .-++.-..--.+|+++|...
T Consensus        89 -V~~Dn~~~~~~a~~~L~~~Ghr~I~~ig~~~  119 (265)
T cd01543          89 -VTTDNAAIGRMAAEHFLERGFRHFAFYGLPG  119 (265)
T ss_pred             -EECCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             -9629999999999999986997499989998


No 282
>pfam02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain. Members of this family are UDP-N-acetylenolpyruvoylglucosamine reductase enzymes EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
Probab=28.20  E-value=43  Score=14.29  Aligned_cols=83  Identities=11%  Similarity=0.063  Sum_probs=41.4

Q ss_pred             HHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEEC
Q ss_conf             99665236665443798799994288835789999898634754333321000012321079999975300101112101
Q gi|255764473|r   29 IKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTT  108 (306)
Q Consensus        29 ~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~  108 (306)
                      ++.........+|+.-.+.+.+|-+|--.                                     .-+...|-+..|..
T Consensus         8 m~~~~~~R~~~qP~~~~~~GS~FKNP~~~-------------------------------------~Ag~LIe~~G~kG~   50 (103)
T pfam02873         8 MKKIRQTRKSTQPYKFPNAGSTFKNPEGF-------------------------------------AAGWLIEEAGLKGY   50 (103)
T ss_pred             HHHHHHHHCCCCCCCCCCEEEEEECCCCC-------------------------------------CHHHHHHHHCCCCC
T ss_conf             99999986869969999872785590997-------------------------------------39999999687988


Q ss_pred             CCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHH--HHHHCC
Q ss_conf             32006776301244124043332024678765576--642001
Q gi|255764473|r  109 NHSRLLELTEYATVPVINALTDNTHPCQIIADIMT--FEEHRG  149 (306)
Q Consensus       109 ~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~T--i~e~~g  149 (306)
                      ..+....-.+++.+ ++|.++..+--...|++...  .++++|
T Consensus        51 ~~G~a~vS~kHanf-ivN~g~ata~di~~l~~~v~~~V~~~~g   92 (103)
T pfam02873        51 QIGGAQVSEKHANF-IINTGNATAEDVVDLIRHVRQTVFEKFG   92 (103)
T ss_pred             CCCCEEEEECCCCE-EEECCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             55998896256718-9968998999999999999999999889


No 283
>KOG0523 consensus
Probab=28.14  E-value=43  Score=14.29  Aligned_cols=55  Identities=13%  Similarity=0.164  Sum_probs=22.9

Q ss_pred             CEEEECCCCCCCCCHH--HCCCCCCEEEEEECHHCCCCCC--CCHHHHHCCCCCCCCCC
Q ss_conf             3046104555543101--0012331257652000013210--00024320133222136
Q gi|255764473|r  155 LFSWSGDGNNILHSLI--EGAARFNYLLNIATPIGSEPRN--EYLNWARNQGASVALFH  209 (306)
Q Consensus       155 ~i~~vGd~~~v~hS~i--~~~~~~g~~v~~~~P~~~~~~~--~~~~~~~~~g~~i~~~~  209 (306)
                      +|+.+|-++-|-.++-  +.+...|.+++++.|..+.|-+  .....++.....+++..
T Consensus       507 dV~LiG~Gs~v~~cl~AA~~L~e~gi~vrVvd~~~~kplD~~li~~~~q~~~~ri~v~e  565 (632)
T KOG0523         507 DVILIGTGSEVQECLEAAELLSEDGIKVRVVDPFTWKPLDVALIRSLAQSHEYRISVLE  565 (632)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHCCCCEEEEECC
T ss_conf             77999265899999999999986496389954532000235877655135541799804


No 284
>pfam04309 G3P_antiterm Glycerol-3-phosphate responsive antiterminator. Intracellular glycerol is usually converted to glycerol-3-phosphate in an ATP-requiring phosphorylation reaction catalysed by glycerol kinase (GlpK) glycerol-3-phosphate activates the antiterminator GlpP.
Probab=28.11  E-value=35  Score=14.88  Aligned_cols=65  Identities=18%  Similarity=0.163  Sum_probs=27.7

Q ss_pred             HHHHHHHHHHHCCCCCCC--CCCCCCCCCCCCCHHHHHHHHH-HCCCEEEEEEC-CCCHHHHHHCCCCCCEECCC
Q ss_conf             789999898634754333--3210000123210799999753-00101112101-32006776301244124043
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIF--LSGSEMQLGRAETIGDTAKVLS-RYVDAIVMRTT-NHSRLLELTEYATVPVINAL  128 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~--~~~~~ss~~kgEsl~Dt~~~ls-~~~D~iviR~~-~~~~~~~~~~~~~vpvINa~  128 (306)
                      ||.+--..|+++|.-++-  |=-++++      ++-..+.+. ...|++-+... -...+.++.+..++|||-+|
T Consensus        78 Tk~~~i~~Ak~~gl~tIqR~FliDS~a------l~~~~~~i~~~~PD~IEilPG~~p~~i~~i~~~~~~PiIAGG  146 (174)
T pfam04309        78 TKSKVIKKAKKLGLPAIQRLFLLDSIA------LERSIEQIEKLEPDFIEVLPGVMPKVIQEITERTNIPIIAGG  146 (174)
T ss_pred             CCHHHHHHHHHCCCEEEEEEEEEEHHH------HHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             889999999987992897764341778------999999986479899999866699999999974799999767


No 285
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed
Probab=28.02  E-value=23  Score=16.13  Aligned_cols=11  Identities=9%  Similarity=0.283  Sum_probs=6.8

Q ss_pred             CCEEEEEECCC
Q ss_conf             10111210132
Q gi|255764473|r  100 VDAIVMRTTNH  110 (306)
Q Consensus       100 ~D~iviR~~~~  110 (306)
                      .|++++=..++
T Consensus        62 ~dvi~LaVKP~   72 (255)
T PRK06476         62 SDVVFLAVRPQ   72 (255)
T ss_pred             CCEEEEEECHH
T ss_conf             88788861788


No 286
>pfam02548 Pantoate_transf Ketopantoate hydroxymethyltransferase. Ketopantoate hydroxymethyltransferase (EC:2.1.2.11) is the first enzyme in the pantothenate biosynthesis pathway.
Probab=27.96  E-value=43  Score=14.29  Aligned_cols=21  Identities=14%  Similarity=0.381  Sum_probs=8.5

Q ss_pred             CCCHHHHHHHHH-HCCCEEEEE
Q ss_conf             210799999753-001011121
Q gi|255764473|r   86 AETIGDTAKVLS-RYVDAIVMR  106 (306)
Q Consensus        86 gEsl~Dt~~~ls-~~~D~iviR  106 (306)
                      .|.++...+.+- ..+|++-+-
T Consensus        94 ~~a~~nA~rlmke~GadaVKlE  115 (261)
T pfam02548        94 EQALRNAARLMKEAGADAVKLE  115 (261)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEC
T ss_conf             9999999999985499989978


No 287
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Members of this group are belonging to the type I periplasmic binding protein superfamily, whose members are involved in chemotaxis, ATP-binding cassette transport, and intercellular communication in central nervous system. The thermophilic and mesophilic ribose-binding proteins are structurally very similar, but differ substantially in thermal stability.
Probab=27.77  E-value=44  Score=14.25  Aligned_cols=84  Identities=20%  Similarity=0.254  Sum_probs=47.9

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHCCCEEEEEECCCCH---HHHHHCCCCCCEECCCCC-
Q ss_conf             357899998986347543333210000123210799999-753001011121013200---677630124412404333-
Q gi|255764473|r   56 TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAK-VLSRYVDAIVMRTTNHSR---LLELTEYATVPVINALTD-  130 (306)
Q Consensus        56 tRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~-~ls~~~D~iviR~~~~~~---~~~~~~~~~vpvINa~~~-  130 (306)
                      .+-.-..+.++++.|.+++..+....    .|.-.+.++ .++..+|++++-..+...   ..+.+...++|||--... 
T Consensus        15 ~~~~~gi~~~a~~~Gy~~~i~~s~~~----~~~e~~~i~~l~~~~vdgiI~~p~~~~~~~~~i~~~~~~~iPvV~id~~~   90 (268)
T cd06323          15 VTLKDGAQKEAKELGYELTVLDAQND----AAKQLNDIEDLITRGVDAIIINPTDSDAVVPAVKAANEAGIPVFTIDREA   90 (268)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCC----HHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHCCCCEEEECCCC
T ss_conf             99999999999975998999819999----99999999999964999899756542124699999997699689963666


Q ss_pred             -CCHH-HHHHHHHHH
Q ss_conf             -2024-678765576
Q gi|255764473|r  131 -NTHP-CQIIADIMT  143 (306)
Q Consensus       131 -~~HP-tQaL~D~~T  143 (306)
                       ...+ +++..|-+.
T Consensus        91 ~~~~~~~~V~~d~~~  105 (268)
T cd06323          91 NGGEVVSQIASDNVA  105 (268)
T ss_pred             CCCCCCCEEEECHHH
T ss_conf             788866189853799


No 288
>PRK06128 oxidoreductase; Provisional
Probab=27.75  E-value=27  Score=15.68  Aligned_cols=86  Identities=14%  Similarity=0.125  Sum_probs=37.8

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-CCCEEEEEEC--CCCHHHH
Q ss_conf             544379879999428883578999989863475433332100001232107999997530-0101112101--3200677
Q gi|255764473|r   39 NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSR-YVDAIVMRTT--NHSRLLE  115 (306)
Q Consensus        39 ~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~-~~D~iviR~~--~~~~~~~  115 (306)
                      +-.|+||++ ++ -=.|.-==.+...+..+-|++|+.-+-..    ..+..+++.+.+.. ...++.+...  +...+..
T Consensus        50 ~grL~GKvA-lV-TGgssGIG~AiA~~lA~eGA~Vvi~~~~~----~~~~a~~~~~~i~~~G~~a~~v~~Dvsd~~~~~~  123 (300)
T PRK06128         50 FGRLQGRKA-LI-TGADSGIGRATAIAFAREGADIVLNYLPE----EEQDAAEVVQLIQAEGRKAVAVPGDLKDEAFCRQ  123 (300)
T ss_pred             CCCCCCCEE-EE-ECCCCHHHHHHHHHHHHCCCEEEEECCCC----CHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHH
T ss_conf             887899958-99-17366999999999998699999942995----5678999999999659818999747899999999


Q ss_pred             HH-----C--CCCCCEECCCCC
Q ss_conf             63-----0--124412404333
Q gi|255764473|r  116 LT-----E--YATVPVINALTD  130 (306)
Q Consensus       116 ~~-----~--~~~vpvINa~~~  130 (306)
                      +.     +  ..++-|-|||..
T Consensus       124 ~v~~~~~~~G~iDiLVNNAG~~  145 (300)
T PRK06128        124 LVERAVKELGGLDILVNIAGKQ  145 (300)
T ss_pred             HHHHHHHHHCCCCEEEECCCCC
T ss_conf             9999999809999899899997


No 289
>PRK10481 hypothetical protein; Provisional
Probab=27.72  E-value=36  Score=14.86  Aligned_cols=28  Identities=18%  Similarity=0.315  Sum_probs=18.1

Q ss_pred             CCCCCCCHHHCCCCCCEEEEEECHHCCCC
Q ss_conf             55554310100123312576520000132
Q gi|255764473|r  162 GNNILHSLIEGAARFNYLLNIATPIGSEP  190 (306)
Q Consensus       162 ~~~v~hS~i~~~~~~g~~v~~~~P~~~~~  190 (306)
                      +.++.++++.++.- |..+.++.|..-+.
T Consensus       114 P~ril~~lV~ai~~-~~~lGVvvP~~eQ~  141 (224)
T PRK10481        114 PSRILPPLVAAIVD-GHQLGVIVPVEEQL  141 (224)
T ss_pred             HHHHHHHHHHHHCC-CCEEEEEECCHHHH
T ss_conf             58866899998568-98699996278999


No 290
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=27.71  E-value=44  Score=14.24  Aligned_cols=100  Identities=16%  Similarity=0.204  Sum_probs=54.5

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHH-HHHCCCEEEEEEC-CCCHHHHHHCCCCCCEECCCCC-CCHHH
Q ss_conf             8999989863475433332100001232107999997-5300101112101-3200677630124412404333-20246
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKV-LSRYVDAIVMRTT-NHSRLLELTEYATVPVINALTD-NTHPC  135 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~-ls~~~D~iviR~~-~~~~~~~~~~~~~vpvINa~~~-~~HPt  135 (306)
                      --..|..+.+.|-+++..+...    ..|.-++..+. ++..+|++++=.. .+....+......+||+..+.. ..+|+
T Consensus        18 ~~~i~~~~~~~gy~~~i~~s~~----~~~~e~~~i~~l~~~~vdGiIi~~~~~~~~~~~~l~~~~iPvV~~~~~~~~~~~   93 (265)
T cd06285          18 YEGIEEAAAERGYSTFVANTGD----NPDAQRRAIEMLLDRRVDGLILGDARSDDHFLDELTRRGVPFVLVLRHAGTSPA   93 (265)
T ss_pred             HHHHHHHHHHCCCEEEEEECCC----CHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCE
T ss_conf             9999999998699899997999----989999999999956999999768879989999999679978998556899997


Q ss_pred             HHHHHHHH----HHHHCCCCCCCCEEEECCCC
Q ss_conf             78765576----64200133677304610455
Q gi|255764473|r  136 QIIADIMT----FEEHRGSVKGKLFSWSGDGN  163 (306)
Q Consensus       136 QaL~D~~T----i~e~~g~l~~~~i~~vGd~~  163 (306)
                      -. .|-+.    +-+++-..-..+|++++...
T Consensus        94 v~-~dn~~~~~~~~~~Li~~G~~~i~~l~~~~  124 (265)
T cd06285          94 VT-GDDVLGGRLATRHLLDLGHRRIAVLAGPD  124 (265)
T ss_pred             EE-ECHHHHHHHHHHHHHHHCCCCEEECCCCC
T ss_conf             98-77799999999999983886587547887


No 291
>PTZ00082 L-lactate dehydrogenase; Provisional
Probab=27.55  E-value=42  Score=14.37  Aligned_cols=39  Identities=15%  Similarity=0.234  Sum_probs=16.5

Q ss_pred             HHHHHHHHC-CCEEEEE--ECCCCHHHHHHCCCCCC---EECCCC
Q ss_conf             999975300-1011121--01320067763012441---240433
Q gi|255764473|r   91 DTAKVLSRY-VDAIVMR--TTNHSRLLELTEYATVP---VINALT  129 (306)
Q Consensus        91 Dt~~~ls~~-~D~iviR--~~~~~~~~~~~~~~~vp---vINa~~  129 (306)
                      |.+.-+..+ .|++++=  .|-+-....+.+.+..|   ||..|+
T Consensus       111 ~i~~~i~~~~p~aiiivvsNPvDv~t~~~~k~sg~p~~rViG~Gt  155 (322)
T PTZ00082        111 EVGENIKKYCPNAFVIVITNPLDVMVQLLLKVSGFPKNKVVGMGG  155 (322)
T ss_pred             HHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             999998740998359974892699999999976898224896412


No 292
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR.  Glutamate mediates the majority of excitatory synaptic transmission in the central nervous system via two broad classes of ionotropic receptors, characterized by their response to glutamate agonists: N-methyl-d -aspartate (NMDA) and non-NMDA receptors. NMDA receptors
Probab=27.43  E-value=45  Score=14.21  Aligned_cols=131  Identities=12%  Similarity=0.228  Sum_probs=51.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCCC-----CCCCCCCCCCCCCCHHHHHHHHHHC-CCEEEEEECCC----CHHHHH
Q ss_conf             9999428883578999989863475433-----3321000012321079999975300-10111210132----006776
Q gi|255764473|r   47 LAMIFEKPSTRTRVSFEVAMKHLGGDTI-----FLSGSEMQLGRAETIGDTAKVLSRY-VDAIVMRTTNH----SRLLEL  116 (306)
Q Consensus        47 i~~lF~e~StRTR~SFe~A~~~LG~~~~-----~~~~~~ss~~kgEsl~Dt~~~ls~~-~D~iviR~~~~----~~~~~~  116 (306)
                      |+.+|.+.|.--+..|+.|+.+.-...-     .+.+..-.+....|+.=+-++-+.+ ..+.+|=+|.+    ..+..+
T Consensus         2 IGaiF~~~~~~~~~Af~~Av~~vN~~~~~l~~~~L~~~~~~~~~~dsf~~~~~~C~ll~~gV~AI~Gp~~~~~~~~v~si   81 (324)
T cd06368           2 IGAIFDEDARQEELAFRFAIDRINTNEEILAKFTLVPDIDELNTNDSFELTNKACDLLSQGVAAIFGPSSSSSANTVQSI   81 (324)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHH
T ss_conf             38894689979999999999998568775788189999995336876899999999875495899988975689999998


Q ss_pred             HCCCCCCEECCC-C--------C-CCHH-----HHHHHHHHHHHHHCCCCCCCCEEEECCCC-CCCCCHHHCCCCCCEEE
Q ss_conf             301244124043-3--------3-2024-----67876557664200133677304610455-55431010012331257
Q gi|255764473|r  117 TEYATVPVINAL-T--------D-NTHP-----CQIIADIMTFEEHRGSVKGKLFSWSGDGN-NILHSLIEGAARFNYLL  180 (306)
Q Consensus       117 ~~~~~vpvINa~-~--------~-~~HP-----tQaL~D~~Ti~e~~g~l~~~~i~~vGd~~-~v~hS~i~~~~~~g~~v  180 (306)
                      +....||.|--. +        . ..||     .||++|+..-..    ++...+.|-.|.+ ..+.-++..+..-+..+
T Consensus        82 ~~~~~vP~i~~~~~~~~~~~~~~~~~~p~~~~l~~Ai~dli~~~~----W~~~~~iYd~d~gl~~Lq~ll~~~~~~~~~i  157 (324)
T cd06368          82 CDALEIPHITTSWSPNPKPRQFTINLYPSMRDLSDALLDLIKYFG----WRKFVYIYDSDEGLLRLQELLDALSPKGIQV  157 (324)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHCC----CCEEEEEEECCCCHHHHHHHHHHHHCCCCEE
T ss_conf             633268558822788877554651101587889999999999679----8489999957720667999998653259779


Q ss_pred             E
Q ss_conf             6
Q gi|255764473|r  181 N  181 (306)
Q Consensus       181 ~  181 (306)
                      .
T Consensus       158 ~  158 (324)
T cd06368         158 T  158 (324)
T ss_pred             E
T ss_conf             9


No 293
>PRK06585 holA DNA polymerase III subunit delta; Reviewed
Probab=27.41  E-value=45  Score=14.20  Aligned_cols=84  Identities=18%  Similarity=0.169  Sum_probs=50.8

Q ss_pred             CEEEEEECCCCCHHHHHHHHHHHHCCC------CCCCCCCCCCCCCCCCCHHHHHHHHHHCCC--EEEEEECCCCHHHHH
Q ss_conf             879999428883578999989863475------433332100001232107999997530010--111210132006776
Q gi|255764473|r   45 KVLAMIFEKPSTRTRVSFEVAMKHLGG------DTIFLSGSEMQLGRAETIGDTAKVLSRYVD--AIVMRTTNHSRLLEL  116 (306)
Q Consensus        45 k~i~~lF~e~StRTR~SFe~A~~~LG~------~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D--~iviR~~~~~~~~~~  116 (306)
                      -.+.+++=+..-.-+-..+.-++.++.      +++.++..+..-+ .+.+.|.+.++|.+.+  ++++|...+.....+
T Consensus        20 ~~~~LlyG~d~glv~e~~~~l~~~~~~~~~~~f~~~~l~~~el~~d-~~~l~de~~t~slF~~~rlI~i~~~~d~~~~~l   98 (343)
T PRK06585         20 IRAVLLYGPDRGLVRERARRLAKSVVDDPDDPFAVVRLDGDELDAD-PARLEDEANTISLFGGRRLIWVRAGGKSLAAAL   98 (343)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCEEEEECHHHHHCC-HHHHHHHHHCCCCCCCCEEEEEECCCHHHHHHH
T ss_conf             6589996387647999999999972556678741577479988339-999999984768768984899726872569999


Q ss_pred             HCCC------CCCEECCCC
Q ss_conf             3012------441240433
Q gi|255764473|r  117 TEYA------TVPVINALT  129 (306)
Q Consensus       117 ~~~~------~vpvINa~~  129 (306)
                      ..+.      .+-||.|++
T Consensus        99 ~~~l~~~~~~~~lIi~a~~  117 (343)
T PRK06585         99 KALLAEPPGDAFIVIEAGD  117 (343)
T ss_pred             HHHHHCCCCCEEEEEECCC
T ss_conf             9998178998289997389


No 294
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism]
Probab=27.38  E-value=45  Score=14.20  Aligned_cols=99  Identities=19%  Similarity=0.202  Sum_probs=40.1

Q ss_pred             CCHHHHHHHH-HHCCCEEEEEECCCCHHHHHH-CCC-CCCEECCCCC---CCHHHHHHHHH-HHHHHHCCCCCCCCE---
Q ss_conf             1079999975-300101112101320067763-012-4412404333---20246787655-766420013367730---
Q gi|255764473|r   87 ETIGDTAKVL-SRYVDAIVMRTTNHSRLLELT-EYA-TVPVINALTD---NTHPCQIIADI-MTFEEHRGSVKGKLF---  156 (306)
Q Consensus        87 Esl~Dt~~~l-s~~~D~iviR~~~~~~~~~~~-~~~-~vpvINa~~~---~~HPtQaL~D~-~Ti~e~~g~l~~~~i---  156 (306)
                      |..+.+.+.+ ..+.|++..--   +.+.... .|. ++|+|=-.++   ..+|. -.-.+ .|..+.. .+.-.-+   
T Consensus        43 ~d~e~~v~~~~~~g~dav~~~~---Gi~~~~~~~y~~dvplivkl~~~t~l~~~~-~~~~~~~~ve~ai-~lgadAV~~~  117 (265)
T COG1830          43 EDPENIVAKVAEAGADAVAMTP---GIARSVHRGYAHDVPLIVKLNGSTSLSPDP-NDQVLVATVEDAI-RLGADAVGAT  117 (265)
T ss_pred             CCHHHHHHHHHHCCCCEEEECH---HHHHHCCCCCCCCCCEEEEECCCCCCCCCC-CCCEEEEEHHHHH-HCCCCEEEEE
T ss_conf             6999999999854899898467---588650755357767799964666567786-4311234098897-4787479999


Q ss_pred             EEECC-CCC----CCCCHHHCCCCCCEEEEE-ECHHCCCC
Q ss_conf             46104-555----543101001233125765-20000132
Q gi|255764473|r  157 SWSGD-GNN----ILHSLIEGAARFNYLLNI-ATPIGSEP  190 (306)
Q Consensus       157 ~~vGd-~~~----v~hS~i~~~~~~g~~v~~-~~P~~~~~  190 (306)
                      .++|- ..+    -+-.....+.++|+-+.. +.|.+-..
T Consensus       118 Vy~Gse~e~~~i~~~~~v~~~a~~~Gmp~v~~~YpRg~~~  157 (265)
T COG1830         118 VYVGSETEREMIENISQVVEDAHELGMPLVAWAYPRGPAI  157 (265)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             9668762589999999999999870996499881358776


No 295
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]
Probab=27.27  E-value=38  Score=14.65  Aligned_cols=70  Identities=20%  Similarity=0.242  Sum_probs=31.9

Q ss_pred             CCEEEECCCCCCCCCHHHCCCC-CC-EEEEEECHHCCCCCCCCHHHHHCC-CCCCCCCCCHHHHCCCCCCCCCCC
Q ss_conf             7304610455554310100123-31-257652000013210000243201-332221366466306873322210
Q gi|255764473|r  154 KLFSWSGDGNNILHSLIEGAAR-FN-YLLNIATPIGSEPRNEYLNWARNQ-GASVALFHDAVQAVKGAHCVFTDT  225 (306)
Q Consensus       154 ~~i~~vGd~~~v~hS~i~~~~~-~g-~~v~~~~P~~~~~~~~~~~~~~~~-g~~i~~~~d~~eal~~aD~V~~~~  225 (306)
                      ..++++|.+. .++-.++++.. ++ -++.+.++..-.. ..+....+.. +..+.-..+.+++++++|+|.+..
T Consensus       131 ~~laiIGaG~-qA~~ql~a~~~v~~~~~I~i~~r~~~~~-e~~a~~l~~~~~~~v~a~~s~~~av~~aDiIvt~T  203 (330)
T COG2423         131 STLAIIGAGA-QARTQLEALKAVRDIREIRVYSRDPEAA-EAFAARLRKRGGEAVGAADSAEEAVEGADIVVTAT  203 (330)
T ss_pred             CEEEEECCCH-HHHHHHHHHHHHCCCCEEEEECCCHHHH-HHHHHHHHHHCCCCCEECCCHHHHHHCCCEEEEEC
T ss_conf             5799988848-9999999999628961899976898999-99999987633865132368998861399899942


No 296
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=27.21  E-value=27  Score=15.69  Aligned_cols=20  Identities=20%  Similarity=0.135  Sum_probs=11.3

Q ss_pred             CCHHHCCCCCCEEEEEECHH
Q ss_conf             31010012331257652000
Q gi|255764473|r  167 HSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       167 hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +|+...+...|..++.++|-
T Consensus       167 r~lA~e~~~~gIrvN~V~PG  186 (247)
T PRK05565        167 KALAKELAPSGIRVNAIAPG  186 (247)
T ss_pred             HHHHHHHHHHCEEEEEEEEC
T ss_conf             99999954309499999609


No 297
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily. Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily. The members of this family function as the primary receptors for chemotaxis and transport of many sugar based solutes in bacteria and archaea. The sugar binding domain is also homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR. Moreover, this periplasmic binding domain, also known as Venus flytrap domain, undergoes transition from an open to a closed conformational state upon the binding of ligands such as lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. This family also includes the periplasmic binding domain of autoinducer-2 (AI-2
Probab=27.03  E-value=45  Score=14.16  Aligned_cols=101  Identities=18%  Similarity=0.179  Sum_probs=52.8

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHCCCEEEEEECCCCHH---HHHHCCCCCCEECCCCCC-
Q ss_conf             57899998986347543333210000123210799999-7530010111210132006---776301244124043332-
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAK-VLSRYVDAIVMRTTNHSRL---LELTEYATVPVINALTDN-  131 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~-~ls~~~D~iviR~~~~~~~---~~~~~~~~vpvINa~~~~-  131 (306)
                      +-.-..+.++++.|.+++..+...+ ..+   -...++ .++..+|++++-..+....   .+......+|||.-.... 
T Consensus        16 ~~~~gi~~~a~~~g~~~~~~~~~~~-~~~---e~~~i~~~~~~~vdgiI~~~~~~~~~~~~~~~~~~~~iPvV~~d~~~~   91 (267)
T cd01536          16 AMNKGAEAAAKELGVELIVLDAQND-VSK---QIQQIEDLIAQGVDGIIISPVDSAALTPALKKANAAGIPVVTVDSDID   91 (267)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCC-HHH---HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9999999999984999999969999-999---999999999759999999315841558999999987996999825667


Q ss_pred             CH--HHHHHHHHHHH----HHHCCCC--CCCCEEEECC
Q ss_conf             02--46787655766----4200133--6773046104
Q gi|255764473|r  132 TH--PCQIIADIMTF----EEHRGSV--KGKLFSWSGD  161 (306)
Q Consensus       132 ~H--PtQaL~D~~Ti----~e~~g~l--~~~~i~~vGd  161 (306)
                      ..  -+..-.|-+..    -++.-..  ...+|++++.
T Consensus        92 ~~~~~~~V~~D~~~~g~~a~~~L~~~~~g~~~i~~i~g  129 (267)
T cd01536          92 GGNRLAYVGTDNYEAGRLAGEYLAKLLGGKGKVAIIEG  129 (267)
T ss_pred             CCCCCEEEECCHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             88864599628899999999999997499947999548


No 298
>COG2098 Uncharacterized protein conserved in archaea [Function unknown]
Probab=26.89  E-value=38  Score=14.68  Aligned_cols=44  Identities=27%  Similarity=0.438  Sum_probs=29.7

Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             942888357899998986347543333210000123210799999
Q gi|255764473|r   50 IFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAK   94 (306)
Q Consensus        50 lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~   94 (306)
                      -|++-|-|.|.-||.++ +||+-..-|-..-.|.+.-||++-.++
T Consensus         4 ~f~~~tdrerAiFEaGI-klGalyHqf~GtPvs~~~a~~le~aI~   47 (116)
T COG2098           4 YFKKLTDRERAIFEAGI-KLGALYHQFVGTPVSPGTAESLEKAIE   47 (116)
T ss_pred             CCCCCCHHHHHHHHCCC-CHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             00236778888887152-033122333077678543689999999


No 299
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated
Probab=26.62  E-value=19  Score=16.69  Aligned_cols=99  Identities=17%  Similarity=0.136  Sum_probs=53.8

Q ss_pred             CCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEEC-CCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCC-C-
Q ss_conf             1079999975300101112101320067763012441240-433320246787655766420013367730461045-5-
Q gi|255764473|r   87 ETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVIN-ALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG-N-  163 (306)
Q Consensus        87 Esl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvIN-a~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~-~-  163 (306)
                      +..+++...|+.|--+-+.||+.--...++.+..---.+- .||...      .|=-.|.--++.+.|..|+++|.- + 
T Consensus        45 ~l~k~iYsnLspw~~v~~aRhp~Rp~~~dyi~~~~~~f~elhGDr~~------~dD~aii~G~~~~~~~~V~vig~~KG~  118 (318)
T PRK05724         45 KLTKKIYANLTPWQKLQVARHPQRPYTLDYIELLFTDFTELHGDRAF------ADDKAIVGGLARFDGRPVMVIGHQKGR  118 (318)
T ss_pred             HHHHHHHHCCCHHHHHHHHHCCCCCCHHHHHHHHHCCCEEEECCCCC------CCCCCEEEEEEEECCEEEEEEEEECCC
T ss_conf             99999985799999999964789998999999982776785078456------779651788889989569999997588


Q ss_pred             ----CC--------------CCCHHHCCCCCCEE-EEEECHHCCCCC
Q ss_conf             ----55--------------43101001233125-765200001321
Q gi|255764473|r  164 ----NI--------------LHSLIEGAARFNYL-LNIATPIGSEPR  191 (306)
Q Consensus       164 ----~v--------------~hS~i~~~~~~g~~-v~~~~P~~~~~~  191 (306)
                          |+              +--++..+.+|+.- ++++-.+|..|-
T Consensus       119 ~t~e~i~rNFGm~~PeGYRKAlRlm~lAekf~~Pvit~IDTpGAypG  165 (318)
T PRK05724        119 DTKERIRRNFGMPRPEGYRKALRLMEMAERFGLPIITFIDTPGAYPG  165 (318)
T ss_pred             CCHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             83777874679999178999999999999709977999348976789


No 300
>TIGR01748 rhaA L-rhamnose isomerase; InterPro: IPR009308   This family consists of several bacterial L-rhamnose isomerase proteins (5.3.1.14 from EC). This enzyme interconverts L-rhamnose and L-rhamnulose. In some species, including Escherichia coli, this is the first step in rhamnose catabolism. Sequential steps are catalyzed by rhamnulose kinase (rhaB), then rhamnulose-1-phosphate aldolase (rhaD) to yield glycerone phosphate and (S)-lactaldehyde. ; GO: 0008740 L-rhamnose isomerase activity, 0030145 manganese ion binding, 0019299 rhamnose metabolic process.
Probab=26.61  E-value=24  Score=15.93  Aligned_cols=14  Identities=29%  Similarity=0.304  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             87755999999999
Q gi|255764473|r  287 EAENRLHTQKAILL  300 (306)
Q Consensus       287 Qa~Ngl~vr~AiL~  300 (306)
                      |.+|....||||++
T Consensus       361 e~egdyT~RlAl~E  374 (415)
T TIGR01748       361 EEEGDYTERLALLE  374 (415)
T ss_pred             HHCCCHHHHHHHHH
T ss_conf             75077557889877


No 301
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed
Probab=26.24  E-value=37  Score=14.72  Aligned_cols=32  Identities=19%  Similarity=0.170  Sum_probs=18.4

Q ss_pred             CCCEEEEEECCCC---HHHHHHCCCCCCEECCCCC
Q ss_conf             0101112101320---0677630124412404333
Q gi|255764473|r   99 YVDAIVMRTTNHS---RLLELTEYATVPVINALTD  130 (306)
Q Consensus        99 ~~D~iviR~~~~~---~~~~~~~~~~vpvINa~~~  130 (306)
                      ..|++++=..++.   .+.++..+.+-.||+-.-|
T Consensus        62 ~~diIiLaVKP~~~~~vl~~l~~~~~~~iISv~AG   96 (267)
T PRK11880         62 EADVVVLAVKPQVMEDVLSELKGSLDKLVVSIAAG   96 (267)
T ss_pred             CCCEEEEEECHHHHHHHHHHHHHHHCCEEEEECCC
T ss_conf             19999997287899999999876508789991699


No 302
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway. Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes the first committed step in the biosynthesis of pantothenate (vitamin B5), which is a precursor to coenzyme A and is required for penicillin biosynthesis.
Probab=25.97  E-value=47  Score=14.04  Aligned_cols=27  Identities=26%  Similarity=0.317  Sum_probs=9.4

Q ss_pred             CCEEEEEECCCCHHHHHHCCCCCCEEC
Q ss_conf             101112101320067763012441240
Q gi|255764473|r  100 VDAIVMRTTNHSRLLELTEYATVPVIN  126 (306)
Q Consensus       100 ~D~iviR~~~~~~~~~~~~~~~vpvIN  126 (306)
                      +..+|+-+-+.....++.+..++|+|.
T Consensus       172 af~ivlE~vp~~la~~It~~~~IPtIG  198 (254)
T cd06557         172 AFALVLECVPAELAKEITEALSIPTIG  198 (254)
T ss_pred             CEEEEEECCHHHHHHHHHHCCCCCEEE
T ss_conf             559999567099999998578988894


No 303
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=25.72  E-value=45  Score=14.21  Aligned_cols=24  Identities=33%  Similarity=0.607  Sum_probs=17.2

Q ss_pred             CCCCCEEEEEECCCC-CHHHHHHHH
Q ss_conf             437987999942888-357899998
Q gi|255764473|r   41 PLSGKVLAMIFEKPS-TRTRVSFEV   64 (306)
Q Consensus        41 ~l~gk~i~~lF~e~S-tRTR~SFe~   64 (306)
                      .|.|+..+.+-..|. ||-|.+.+.
T Consensus       298 RL~g~r~AIV~d~pGvTRDR~~~~~  322 (714)
T PRK09518        298 RILGRREAVVEDTPGVTRDRVSYDA  322 (714)
T ss_pred             HHHCCCEEEECCCCCCCCCCCEEEE
T ss_conf             8628841684698998837555799


No 304
>PRK12367 short chain dehydrogenase; Provisional
Probab=25.68  E-value=33  Score=15.10  Aligned_cols=37  Identities=19%  Similarity=0.190  Sum_probs=22.0

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             544379879999428883578999989863475433332
Q gi|255764473|r   39 NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLS   77 (306)
Q Consensus        39 ~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~   77 (306)
                      ....+||+|+.-=.  |---=.+-...-++-|+.|+-|+
T Consensus        12 ~~~~kgKtIgITGA--sGaLG~AL~k~f~~~GakVIalT   48 (250)
T PRK12367         12 NSRWNGKRIGITGA--SGALGKALTKLFRAKGAKVIGLT   48 (250)
T ss_pred             CCCCCCCEEEEECC--CCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             55638987999678--73899999999998899899983


No 305
>pfam00533 BRCT BRCA1 C Terminus (BRCT) domain. The BRCT domain is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage. The BRCT domain of XRCC1 forms a homodimer in the crystal structure. This suggests that pairs of BRCT domains associate as homo- or heterodimers. BRCT domains are often found as tandem-repeat pairs. Structures of the BRCA1 BRCT domains revealed a basis for a widely utilized head-to-tail BRCT-BRCT oligomerisation mode. This conserved tandem BRCT architecture facilitates formation of the canonical BRCT phospho-peptide interaction cleft at a groove between the BRCT domains. Disease associated missense and nonsense mutations in the BRCA1 BRCT domains disrupt peptide binding by directly occluding this peptide binding groove, or by disrupting key conserved BRCT core folding determinants.
Probab=25.60  E-value=48  Score=13.99  Aligned_cols=34  Identities=24%  Similarity=0.365  Sum_probs=24.8

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             544379879999428883578999989863475433
Q gi|255764473|r   39 NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTI   74 (306)
Q Consensus        39 ~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~   74 (306)
                      ..+|.|.+++..-+....|+.+  +..+..+||.+.
T Consensus         3 ~~~f~~~~~~i~~~~~~~r~~l--~~~i~~~Gg~~~   36 (77)
T pfam00533         3 EKLFKGKTFVITGLDSLEREEL--EELIEKLGGKVT   36 (77)
T ss_pred             CCCCCCCEEEEECCCCCCHHHH--HHHHHHHCCEEE
T ss_conf             8537996899979498499999--999999599471


No 306
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=25.48  E-value=39  Score=14.61  Aligned_cols=36  Identities=25%  Similarity=0.307  Sum_probs=18.2

Q ss_pred             CCCCCEEEEEECCCC-CHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             437987999942888-35789999898634754333321
Q gi|255764473|r   41 PLSGKVLAMIFEKPS-TRTRVSFEVAMKHLGGDTIFLSG   78 (306)
Q Consensus        41 ~l~gk~i~~lF~e~S-tRTR~SFe~A~~~LG~~~~~~~~   78 (306)
                      .|.|+..+.+-.+|. ||-|..  .-+..-|.....+|-
T Consensus        57 rL~~~~~AIV~d~pGvTRDr~~--~~~~~~~~~f~lvDT   93 (474)
T PRK03003         57 RILGRREAVVEDIPGVTRDRVS--YDAEWNGRRFVVQDT   93 (474)
T ss_pred             HHHCCCEEEECCCCCCCCCCEE--EEEEECCCEEEEEEC
T ss_conf             9868863880598998808636--899999928999979


No 307
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=25.23  E-value=44  Score=14.28  Aligned_cols=24  Identities=17%  Similarity=0.321  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             578999989863475433332100
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSE   80 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~   80 (306)
                      +|=.|-.....++|..|+..|...
T Consensus        27 ~SG~s~a~~L~~~G~~v~~~D~~~   50 (476)
T PRK00141         27 VSGLGIAKMLSELGCDVVVADDNE   50 (476)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             889999999997899799998998


No 308
>CHL00194 ycf39 Ycf39; Provisional
Probab=25.16  E-value=29  Score=15.48  Aligned_cols=122  Identities=12%  Similarity=0.037  Sum_probs=49.4

Q ss_pred             HHHHHHHHCCC-CCCCCCCCCCC----CCCCCCHHHHHHHH-HHCCCEEEEEECC--CCHHHHHHC--CCCCCEECCCCC
Q ss_conf             99989863475-43333210000----12321079999975-3001011121013--200677630--124412404333
Q gi|255764473|r   61 SFEVAMKHLGG-DTIFLSGSEMQ----LGRAETIGDTAKVL-SRYVDAIVMRTTN--HSRLLELTE--YATVPVINALTD  130 (306)
Q Consensus        61 SFe~A~~~LG~-~~~~~~~~~ss----~~kgEsl~Dt~~~l-s~~~D~iviR~~~--~~~~~~~~~--~~~vpvINa~~~  130 (306)
                      .+--||++-|- ++++++.-.-.    ..-..+-..+-+.| ....+..++|...  ++.+..++.  ..+-||.-.+++
T Consensus        92 ~li~AAk~aGVkr~V~lS~lga~~~~~~p~~~~K~~~E~~L~~Sgl~~TIlRPs~F~q~l~~~~a~pi~~~~~v~~~~~~  171 (319)
T CHL00194         92 ALIEAAKAAKVKRFIFFSILNAEQYPQVPLMKIKSDIEEKLKQSGINYTIFRLAGFFQGLISQYAIPILDSQTIWITGES  171 (319)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHHHCCCCEEECCCC
T ss_conf             99999998499889996135666688756778799999999867998599847399998899876776307857766998


Q ss_pred             CC---HHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCC-CEEEEE
Q ss_conf             20---24678765576642001336773046104555543101001233-125765
Q gi|255764473|r  131 NT---HPCQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARF-NYLLNI  182 (306)
Q Consensus       131 ~~---HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~-g~~v~~  182 (306)
                      ..   =-+|=++++..=.-.....+|+.+...|.-.=...-.++++.++ |-...+
T Consensus       172 ~~ia~I~~~DVA~~~a~aL~~~~~~gk~y~L~GP~a~T~~EIa~l~~~~~Gk~~~i  227 (319)
T CHL00194        172 TPIAYIDTQDAAKFALKSLSLPETKNKTFPLVGPKSWNSSEIISLCEQLSGQKAKV  227 (319)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCE
T ss_conf             75288779999999999958977589899954986389999999999985999877


No 309
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=25.04  E-value=49  Score=13.93  Aligned_cols=101  Identities=14%  Similarity=0.151  Sum_probs=55.6

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEEC--CCCHHHHHHCCCCCCEECCCCC--C
Q ss_conf             5789999898634754333321000012321079999975-300101112101--3200677630124412404333--2
Q gi|255764473|r   57 RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTT--NHSRLLELTEYATVPVINALTD--N  131 (306)
Q Consensus        57 RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~--~~~~~~~~~~~~~vpvINa~~~--~  131 (306)
                      +--...|.++.+.|-+++..+....    .|.-++..+.+ +..+|++++=..  .+....+..+..++||+-.+..  .
T Consensus        16 ~~~~gi~~~~~~~Gy~~ll~~s~~~----~~~e~~~l~~l~~~~vdGiIi~~~~~~~~~~~~~~~~~~iPvV~~~r~~~~   91 (269)
T cd06281          16 QLFSGAEDRLRAAGYSLLIANSLND----PERELEILRSFEQRRMDGIIIAPGDERDPELVDALASLDLPIVLLDRDMGG   91 (269)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCC----HHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             9999999999986998999968999----899999999998579989997677779999999998479988998446899


Q ss_pred             CHHHHHHHHHHH----HHHHCCCCCCCCEEEECCC
Q ss_conf             024678765576----6420013367730461045
Q gi|255764473|r  132 THPCQIIADIMT----FEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus       132 ~HPtQaL~D~~T----i~e~~g~l~~~~i~~vGd~  162 (306)
                      ..|+ +..|-+.    .-++.-..-..+|++++..
T Consensus        92 ~~~~-V~~D~~~~~~~a~~~L~~~G~~~I~~i~~~  125 (269)
T cd06281          92 GADA-VLFDHAAGMRQAVEYLISLGHRRIALVGGG  125 (269)
T ss_pred             CCCE-EEECHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             9998-998759999999999997599866898078


No 310
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane]
Probab=24.97  E-value=49  Score=13.92  Aligned_cols=67  Identities=19%  Similarity=0.214  Sum_probs=49.0

Q ss_pred             EEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-CCCEEEEEEC-CCCHHHHHHCCCCCCEEC
Q ss_conf             99428883578999989863475433332100001232107999997530-0101112101-320067763012441240
Q gi|255764473|r   49 MIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSR-YVDAIVMRTT-NHSRLLELTEYATVPVIN  126 (306)
Q Consensus        49 ~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~-~~D~iviR~~-~~~~~~~~~~~~~vpvIN  126 (306)
                      +++..++-.+|..+..+...              -.-+|-|.|+++-|.. ..|+|++=+. -|....++.+.+++|+|+
T Consensus        38 i~~~s~~f~~~~~~q~~~~w--------------~~~~~~L~~~a~~Le~~GAd~i~l~~NT~H~~~d~iq~~~~iPllh  103 (230)
T COG1794          38 LLLYSVDFPEIETLQRAGEW--------------DEAGEILIDAAKKLERAGADFIVLPTNTMHKVADDIQKAVGIPLLH  103 (230)
T ss_pred             HHEECCCCCCHHHHHCCCCC--------------CCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCEEH
T ss_conf             31226886559998736765--------------6589999999999996599989970773789999999854997330


Q ss_pred             CCC
Q ss_conf             433
Q gi|255764473|r  127 ALT  129 (306)
Q Consensus       127 a~~  129 (306)
                      .-+
T Consensus       104 Iid  106 (230)
T COG1794         104 IID  106 (230)
T ss_pred             HHH
T ss_conf             789


No 311
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional
Probab=24.90  E-value=40  Score=14.55  Aligned_cols=12  Identities=25%  Similarity=0.338  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             559999999999
Q gi|255764473|r  290 NRLHTQKAILLW  301 (306)
Q Consensus       290 Ngl~vr~AiL~~  301 (306)
                      |+++..-++..+
T Consensus       430 ~~l~~~RrLf~~  441 (613)
T PRK02048        430 NRVGEHRALAHQ  441 (613)
T ss_pred             CCHHHHHHHHHH
T ss_conf             415899999999


No 312
>pfam04723 GRDA Glycine reductase complex selenoprotein A. Found in clostridia, this protein contains one active site selenocysteine and catalyses the reductive deamination of glycine, which is coupled to the esterification of orthophosphate resulting in the formation of ATP. A member of this family may also exist in Treponema denticola.
Probab=24.86  E-value=50  Score=13.90  Aligned_cols=40  Identities=18%  Similarity=0.101  Sum_probs=29.9

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCC-CEEEEEECHHCCC
Q ss_conf             336773046104555543101001233-1257652000013
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARF-NYLLNIATPIGSE  189 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~-g~~v~~~~P~~~~  189 (306)
                      -++|+|+.++||...|+---++.+.+- |.++.+.+.+.|-
T Consensus         2 ~l~gKkviiiGdRDGiPgpaie~c~k~~gaevvfs~TECFV   42 (150)
T pfam04723         2 IFQGKKVIIIGDRDGIPGPAIEECLKSIGAEVAFSSTECFV   42 (150)
T ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEEEEEEEE
T ss_conf             66786699981688997488999985459669997435677


No 313
>KOG4165 consensus
Probab=24.83  E-value=49  Score=13.97  Aligned_cols=46  Identities=22%  Similarity=0.433  Sum_probs=31.8

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCH
Q ss_conf             210799999753001011121013200677630124412404333202
Q gi|255764473|r   86 AETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTH  133 (306)
Q Consensus        86 gEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~H  133 (306)
                      .|-+.|..+ +..|.|.++-|.+ +.-+..+.+.+.|||..--+|..|
T Consensus       179 REev~dLl~-ld~~IDLvIPRGS-s~LVr~Ik~~tkIPVLGHA~Gich  224 (433)
T KOG4165         179 REEVSDLLK-LDDYIDLVIPRGS-SDLVRSIKDTTKIPVLGHAEGICH  224 (433)
T ss_pred             HHHHHHHHH-HHHHEEEEECCCC-HHHHHHHHHCCCCCCCCCCCCEEE
T ss_conf             877888860-2200467723883-799998764565740024564269


No 314
>PRK12831 putative oxidoreductase; Provisional
Probab=24.80  E-value=46  Score=14.16  Aligned_cols=258  Identities=16%  Similarity=0.158  Sum_probs=111.5

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC------------CCCCCCCHH-HHHHHHHHCCCEEEE
Q ss_conf             5443798799994288835789999898634754333321000------------012321079-999975300101112
Q gi|255764473|r   39 NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM------------QLGRAETIG-DTAKVLSRYVDAIVM  105 (306)
Q Consensus        39 ~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s------------s~~kgEsl~-Dt~~~ls~~~D~ivi  105 (306)
                      ..+-.||.|+.+=-=|+   =+|=..--.++|-.|..|.....            -+-|-|-+. +...+.+..   +-+
T Consensus       135 ~~~~~gkkVAVIGsGPA---GLsaA~~La~~G~~VtVfE~~~~~GG~l~yGIP~~RLpk~~vl~~ei~~l~~~G---V~~  208 (464)
T PRK12831        135 TEEKKGKKVAVIGSGPA---GLTCAGDLAKKGYDVTIFEALHEPGGVLVYGIPEFRLPKETVVKKEIENIKKLG---VKI  208 (464)
T ss_pred             CCCCCCCEEEEECCCHH---HHHHHHHHHHCCCCEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCC---CEE
T ss_conf             88789998999897689---999999999769917998278888980445168887667899999999998529---389


Q ss_pred             EE----CCCCHHHHHHC---CCCCCEECCCCCC----CHHHHHH------HHHHHHHHH----CC-----CCCCCCEEEE
Q ss_conf             10----13200677630---1244124043332----0246787------655766420----01-----3367730461
Q gi|255764473|r  106 RT----TNHSRLLELTE---YATVPVINALTDN----THPCQII------ADIMTFEEH----RG-----SVKGKLFSWS  159 (306)
Q Consensus       106 R~----~~~~~~~~~~~---~~~vpvINa~~~~----~HPtQaL------~D~~Ti~e~----~g-----~l~~~~i~~v  159 (306)
                      +.    ..+-.+.++.+   |.-| +|--|...    .=|-.-|      .|+++-...    ..     ...|++|+++
T Consensus       209 ~~n~~vG~dis~~~L~~~~~yDAV-~la~Ga~~~r~l~ipG~~~~gV~~a~~fL~~~n~~~~~~~~~~~~~~~Gk~VvVI  287 (464)
T PRK12831        209 ETNVIVGRTVTIDELLEEEGFDAV-FIGSGAGLPKFMGIPGENLNGVFSANEFLTRVNLMKAYKPEYDTPIKVGKKVAVV  287 (464)
T ss_pred             EECCCCCCCCCHHHHHHCCCCCEE-EEECCCCCCCCCCCCCCCCCCEEEHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEE
T ss_conf             915742787679999635699889-9944888764378887668886897999999873001266566742258778998


Q ss_pred             CCCCCCCCCHHHCCCCCCEEEEEECHHCC--CCC-CCCHHHHHCCCCCCCCCCCHHHHCCCCC-CCCCCCEEEC--CCCC
Q ss_conf             04555543101001233125765200001--321-0000243201332221366466306873-3222100000--0220
Q gi|255764473|r  160 GDGNNILHSLIEGAARFNYLLNIATPIGS--EPR-NEYLNWARNQGASVALFHDAVQAVKGAH-CVFTDTWISM--NQEF  233 (306)
Q Consensus       160 Gd~~~v~hS~i~~~~~~g~~v~~~~P~~~--~~~-~~~~~~~~~~g~~i~~~~d~~eal~~aD-~V~~~~~~~~--~~~~  233 (306)
                      |.++ |+---+..+.|+|.+++++.-...  .|. ..-++.+...|..+.....+.+.+.+.+ -|---..+.+  ++.+
T Consensus       288 GGGn-tA~D~arta~R~GaeV~ivyrr~~~~mpa~~~E~~~a~eeGv~~~~~~~p~~i~~~e~G~v~gv~~~~~~l~~~d  366 (464)
T PRK12831        288 GGGN-VAMDAARTALRLGAEVHIVYRRSEEELPARVEEVHHAKEEGVIFDLLTNPVEILGDENGWVKGMKCIKMELGEPD  366 (464)
T ss_pred             CCCH-HHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCEEEECCCCEEEEECCCCCEEEEEEEEEEECCCC
T ss_conf             8855-689999988742977999704572138987012337874897899656855887548883887899998843557


Q ss_pred             HH--------HHHH-------CCC--CCCCCHHH------HHCCCCCCEEECCC---CCCCCCCCCHHHHCCCCCHHHHH
Q ss_conf             13--------3310-------011--12336889------96289872992599---98748735767967997106868
Q gi|255764473|r  234 KA--------REEH-------VFQ--PFQVNLSL------MSMAHPDALFMHCL---PAHRGEEVINEVLDGPQSVVFDE  287 (306)
Q Consensus       234 ~~--------~~~~-------~~~--~y~i~~~~------l~~a~~~~~vmHpl---P~~rg~EI~~~v~d~~~s~~~~Q  287 (306)
                      ..        ...+       .+.  .+..+...      ++.-+.+.++-.+-   .-..|+=...|+..+|. .+.+-
T Consensus       367 ~~Gr~~~~~~~g~~~~i~~D~Vi~AiGq~~~~~~~~~~~gi~~~~~g~i~~~~~~~~Ts~~gVFa~GD~~~G~~-~vV~A  445 (464)
T PRK12831        367 ASGRRRPVEIEGSEFVMEVDTVIMSLGTSPNPLISSTTPGLEINKRGCIVADEETGLTSIEGVYAGGDAVTGAA-TVILA  445 (464)
T ss_pred             CCCCEEEEECCCCEEEEECCEEEECCCCCCCCCCCCCCCCEEECCCCCEEECCCCCCCCCCCEEECCCCCCCCH-HHHHH
T ss_conf             88877137649937999899999998689874300136680277999888478998428999998278676833-99999


Q ss_pred             HHHHHHHHHHHHHHHHCC
Q ss_conf             775599999999996255
Q gi|255764473|r  288 AENRLHTQKAILLWCFGI  305 (306)
Q Consensus       288 a~Ngl~vr~AiL~~~lG~  305 (306)
                      +..|--+..+|-.|+.|.
T Consensus       446 i~~Gr~AA~~I~~yL~gk  463 (464)
T PRK12831        446 MGAGKKAAKAIDEYLSKK  463 (464)
T ss_pred             HHHHHHHHHHHHHHHCCC
T ss_conf             999999999999997359


No 315
>PRK00124 hypothetical protein; Validated
Probab=24.76  E-value=50  Score=13.89  Aligned_cols=26  Identities=12%  Similarity=0.144  Sum_probs=15.7

Q ss_pred             CCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             04555543101001233125765200
Q gi|255764473|r  160 GDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       160 Gd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      +|.--|..-.+.++.+++..+.+++-
T Consensus         7 ADACPVk~~i~~~a~r~~i~v~~Van   32 (149)
T PRK00124          7 ADACPVKEIIYRVAERHGIPVTLVAN   32 (149)
T ss_pred             CCCCCHHHHHHHHHHHHCCEEEEEEC
T ss_conf             88894099999999986976999968


No 316
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=24.63  E-value=29  Score=15.49  Aligned_cols=12  Identities=25%  Similarity=0.313  Sum_probs=4.4

Q ss_pred             CCHHHHHHHHHH
Q ss_conf             835789999898
Q gi|255764473|r   55 STRTRVSFEVAM   66 (306)
Q Consensus        55 StRTR~SFe~A~   66 (306)
                      ..|..-+.+.|+
T Consensus        51 Dl~d~~~~~~~~   62 (328)
T TIGR03466        51 DLRDPASLRKAL   62 (328)
T ss_pred             ECCCHHHHHHHH
T ss_conf             079999999997


No 317
>PRK13265 glycine/sarcosine/betaine reductase complex protein A; Reviewed
Probab=24.62  E-value=50  Score=13.88  Aligned_cols=41  Identities=17%  Similarity=0.065  Sum_probs=30.0

Q ss_pred             CCCCCCCEEEECCCCCCCCCHHHCCCCC-CEEEEEECHHCCC
Q ss_conf             1336773046104555543101001233-1257652000013
Q gi|255764473|r  149 GSVKGKLFSWSGDGNNILHSLIEGAARF-NYLLNIATPIGSE  189 (306)
Q Consensus       149 g~l~~~~i~~vGd~~~v~hS~i~~~~~~-g~~v~~~~P~~~~  189 (306)
                      +.++|+|+.++||...|+---++.+.+- |.++.+.+.+.|-
T Consensus         2 ~~l~gKkviiiGdRDGiPgpai~~c~k~~gaevvfs~TECFV   43 (157)
T PRK13265          2 SLFEGKKVIIIGDRDGIPGPAIEECIKGTGAEVVFSSTECFV   43 (157)
T ss_pred             CCCCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEEEEEEEE
T ss_conf             755686699981688997488999985359659997435677


No 318
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=24.55  E-value=50  Score=13.87  Aligned_cols=38  Identities=18%  Similarity=0.445  Sum_probs=27.6

Q ss_pred             CCCEEEEEECCCCCHHHHHH--HHHHHHCCCCCCCCCCCC
Q ss_conf             79879999428883578999--989863475433332100
Q gi|255764473|r   43 SGKVLAMIFEKPSTRTRVSF--EVAMKHLGGDTIFLSGSE   80 (306)
Q Consensus        43 ~gk~i~~lF~e~StRTR~SF--e~A~~~LG~~~~~~~~~~   80 (306)
                      .||.+...=.+.|--|-++.  -..+++.|+.++++|..+
T Consensus        54 ~GRivei~G~essGKTtlal~~ia~aQk~gg~~~~iDaE~   93 (325)
T cd00983          54 KGRIIEIYGPESSGKTTLALHAIAEAQKLGGTVAFIDAEH   93 (325)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHH
T ss_conf             8808999889877799999999999873598399996254


No 319
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=24.48  E-value=28  Score=15.50  Aligned_cols=113  Identities=21%  Similarity=0.261  Sum_probs=64.7

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEEC------------CCCHHHHHHCC----C--
Q ss_conf             89999898634754333321000012321079999975300101112101------------32006776301----2--
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTT------------NHSRLLELTEY----A--  120 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~------------~~~~~~~~~~~----~--  120 (306)
                      |=-|..+++++|-.|-.-..       .+|+++.....+.-.==+++|..            +...+.++++.    |  
T Consensus       128 Re~F~~~M~ei~~pvp~S~~-------~~~~eEA~~~a~~~GyPviVRpAftLGG~GgGiA~n~eEL~~~~~~aL~~SpI  200 (1089)
T TIGR01369       128 RELFREAMKEIGEPVPKSEI-------VHSVEEALKAAKEIGYPVIVRPAFTLGGTGGGIASNEEELKEIVERALSASPI  200 (1089)
T ss_pred             HHHHHHHHHHCCCCCCCCCC-------CCCHHHHHHHHHHCCCCEEECCCHHCCCCCCCEECCHHHHHHHHHHHHHHCCC
T ss_conf             79999999973899881100-------27889999999626896898100323889985225778999999988630888


Q ss_pred             -------------------------C-CCEECCC--CC------CC---HHHHHHHHH---------HHHHHHCCCCCC-
Q ss_conf             -------------------------4-4124043--33------20---246787655---------766420013367-
Q gi|255764473|r  121 -------------------------T-VPVINAL--TD------NT---HPCQIIADI---------MTFEEHRGSVKG-  153 (306)
Q Consensus       121 -------------------------~-vpvINa~--~~------~~---HPtQaL~D~---------~Ti~e~~g~l~~-  153 (306)
                                               + |=|=|+.  |.      ++   =|+|.|.|-         +.|-++.|-.-| 
T Consensus       201 ~qvL~EkSl~GWKE~EYEVmRD~~dNCItVCNmEN~DPmGVHTGdSIVVAPSQTLtD~EYQ~LR~~sikIIR~lGi~GgG  280 (1089)
T TIGR01369       201 NQVLVEKSLAGWKEIEYEVMRDSKDNCITVCNMENFDPMGVHTGDSIVVAPSQTLTDKEYQMLRDASIKIIRELGIVGGG  280 (1089)
T ss_pred             CEEEEEEECCCCEEEEEEEEEECCCCEEEEECCCCCCCCCEEECCCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEECC
T ss_conf             55750110033178898898626878899974547689845707833650763688078999999999999873912167


Q ss_pred             CCEEEECCC----------C-CCCCCHHHCCCCCCE
Q ss_conf             730461045----------5-554310100123312
Q gi|255764473|r  154 KLFSWSGDG----------N-NILHSLIEGAARFNY  178 (306)
Q Consensus       154 ~~i~~vGd~----------~-~v~hS~i~~~~~~g~  178 (306)
                      ++|=|.=|+          | ||-||=..++..-|+
T Consensus       281 CNvQFAL~P~s~~Y~vIEvNPRvSRSSALASKATGY  316 (1089)
T TIGR01369       281 CNVQFALDPDSGRYYVIEVNPRVSRSSALASKATGY  316 (1089)
T ss_pred             CCEEEEECCCCCCEEEEEECCCCCHHHHHHHHHHCC
T ss_conf             421321507897069998678821358987665166


No 320
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
Probab=24.29  E-value=51  Score=13.84  Aligned_cols=106  Identities=9%  Similarity=0.103  Sum_probs=48.5

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             99999999999999665236665443798799994288835789999898634754333321000012321079999975
Q gi|255764473|r   17 SNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL   96 (306)
Q Consensus        17 ~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l   96 (306)
                      -.+..-+.+|.+++..   +        ..+ ..+..+.-....   .-..+-|..+..+.....   ..+....+...+
T Consensus        16 GH~~RclaLA~~l~~~---g--------~~v-~f~~~~~~~~~~---~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~   77 (280)
T TIGR03590        16 GHVMRCLTLARELRKR---G--------AEV-AFACKTLPGDLI---DLILSAGFPVYVLPDTSS---WQDDALELINLL   77 (280)
T ss_pred             HHHHHHHHHHHHHHHC---C--------CEE-EEEEECCCHHHH---HHHHHCCCCEEECCCCCC---CCCCHHHHHHHH
T ss_conf             0899999999999988---9--------949-999927958899---999975981798167565---201299999999


Q ss_pred             HHC-CCEEEEEECCC-CHHHHHHCCCCCCEECCCCC--CCHHHHHHHH
Q ss_conf             300-10111210132-00677630124412404333--2024678765
Q gi|255764473|r   97 SRY-VDAIVMRTTNH-SRLLELTEYATVPVINALTD--NTHPCQIIAD  140 (306)
Q Consensus        97 s~~-~D~iviR~~~~-~~~~~~~~~~~vpvINa~~~--~~HPtQaL~D  140 (306)
                      ... .|.+|+-+..- .......+....+++.-.|-  ..|+|..+.+
T Consensus        78 ~~~~~d~vIiD~y~~~~~~~~~lk~~~~~~i~iDD~~~~~~~~d~vin  125 (280)
T TIGR03590        78 EKEKFDILIVDHYALDADWEKLIKHFGRKLLVIDDLADRPHDCDLLLD  125 (280)
T ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHCCEEEEEECCCCCCCCCCEEEC
T ss_conf             737979999925999979999999839839999367654656142541


No 321
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan synthase beta chain (Trp-synth_B), cystathionine beta-synthase (CBS), O-acetylserine sulfhydrylase (CS), serine dehydratase (Ser-dehyd), threonine dehydratase (Thr-dehyd), diaminopropionate ammonia lyase (DAL), and threonine synthase (Thr-synth). ACCD catalyzes the conversion of 1-aminocyclopropane-1-carboxylate  to alpha-ketobutyrate and ammonia. Tryptophan synthase folds into a tetramer, where the beta chain is the catalytic PLP-binding subunit and catalyzes the formation of L-tryptophan from indole and L-serine. CBS is a tetrameric hemeprotein that catalyzes condensation of serine and homocysteine to cystathionine. CS is a homodimer that catalyzes the formation of L-cysteine from O-acetyl-L-serine. Ser-dehy
Probab=24.05  E-value=51  Score=13.81  Aligned_cols=53  Identities=13%  Similarity=0.177  Sum_probs=32.1

Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEEC
Q ss_conf             94288835789999898634754333321000012321079999975300101112101
Q gi|255764473|r   50 IFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTT  108 (306)
Q Consensus        50 lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~  108 (306)
                      +.+-.|--|=.+...+++.+|..++.+=+...+..|    .+..+.+  ..+++.+-..
T Consensus        53 vv~aSsGN~g~a~A~~a~~~G~~~~i~~p~~~~~~k----~~~~~~~--GA~vi~~~~~  105 (244)
T cd00640          53 IIESTGGNTGIALAAAAARLGLKCTIVMPEGASPEK----VAQMRAL--GAEVVLVPGD  105 (244)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEECCHHHHHH----HHHHHHC--CCEEEEECCC
T ss_conf             999278578999999887469663377675156789----9988707--9779998995


No 322
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed
Probab=23.97  E-value=52  Score=13.80  Aligned_cols=17  Identities=29%  Similarity=0.462  Sum_probs=8.0

Q ss_pred             HHHHHHHHCCCCCCCCC
Q ss_conf             99989863475433332
Q gi|255764473|r   61 SFEVAMKHLGGDTIFLS   77 (306)
Q Consensus        61 SFe~A~~~LG~~~~~~~   77 (306)
                      +|...+.+-|.+.+-.+
T Consensus        28 ~~A~~~d~~giD~iLVG   44 (266)
T PRK00311         28 SFARLFDEAGVDVILVG   44 (266)
T ss_pred             HHHHHHHHCCCCEEEEC
T ss_conf             99999997599889977


No 323
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR011294   This entry represents a subfamily of the short chain dehydrogenases. Characterised members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polymers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.; GO: 0003858 3-hydroxybutyrate dehydrogenase activity.
Probab=23.82  E-value=52  Score=13.78  Aligned_cols=135  Identities=17%  Similarity=0.235  Sum_probs=71.2

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHC--CCEEEEEECCC--CHHHHH--HCCCCCCEECCCCCC
Q ss_conf             89999898634754333321000012321079999975-300--10111210132--006776--301244124043332
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRY--VDAIVMRTTNH--SRLLEL--TEYATVPVINALTDN  131 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~--~D~iviR~~~~--~~~~~~--~~~~~vpvINa~~~~  131 (306)
                      .-.-+..+...|++++++..+   +.|-+.++|+.+.. ..|  .|++|==--=+  ..+++|  .+|..+-=||. ++-
T Consensus        40 ~~~~~~~~~~~G~~v~~~~~D---~T~~~e~~~~~~~~~~~fG~~DiLVNNAG~QhVaPiEeFP~~~w~~iiav~L-tsa  115 (258)
T TIGR01963        40 AEAAAKVATDAGGSVIYLVAD---VTKEEEIADMIQAVAAEFGGLDILVNNAGIQHVAPIEEFPPEKWDRIIAVML-TSA  115 (258)
T ss_pred             HHHHHHHHHHCCCCEEEEECC---CCCHHHHHHHHHHHHHHHCCCCEEEECCCEEECCCCCCCCHHHHHHHHHHCC-CHH
T ss_conf             999999999618835775147---8888999999999999856887488446401417654778667873730216-888


Q ss_pred             CHHHHHHHHHHHHHHHCC-CCCCCCEEEECC------------CCCCCCCHHH-----C--CCCCCEEEEEECHHCCCCC
Q ss_conf             024678765576642001-336773046104------------5555431010-----0--1233125765200001321
Q gi|255764473|r  132 THPCQIIADIMTFEEHRG-SVKGKLFSWSGD------------GNNILHSLIE-----G--AARFNYLLNIATPIGSEPR  191 (306)
Q Consensus       132 ~HPtQaL~D~~Ti~e~~g-~l~~~~i~~vGd------------~~~v~hS~i~-----~--~~~~g~~v~~~~P~~~~~~  191 (306)
                      .|=+.+=+=.|-=+ -+| ++     ..++-            +..-.|-++=     +  .+.-|...+.+|| +|--.
T Consensus       116 F~t~raAlP~Mk~~-gwGGRI-----iNIAS~HGLvASp~KSAYVAAKHG~~GLTKv~ALE~A~~giT~NaiCP-GYV~T  188 (258)
T TIGR01963       116 FHTIRAALPHMKKQ-GWGGRI-----INIASVHGLVASPFKSAYVAAKHGLIGLTKVLALEVAAHGITANAICP-GYVRT  188 (258)
T ss_pred             HHHHHHCCCCCCCC-CCCCEE-----EEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECC-CCCCC
T ss_conf             99997506432137-855379-----971010000035321345677430212115555420478875866728-75675


Q ss_pred             C----CCHHHHHCCCCC
Q ss_conf             0----000243201332
Q gi|255764473|r  192 N----EYLNWARNQGAS  204 (306)
Q Consensus       192 ~----~~~~~~~~~g~~  204 (306)
                      +    ++.+.+|..|..
T Consensus       189 PLV~~Qi~DqAk~rGi~  205 (258)
T TIGR01963       189 PLVEKQIADQAKTRGIP  205 (258)
T ss_pred             HHHHHHHHHHHHHCCCC
T ss_conf             54676589998651889


No 324
>PRK09526 lacI lac repressor; Reviewed
Probab=23.79  E-value=52  Score=13.77  Aligned_cols=147  Identities=7%  Similarity=0.084  Sum_probs=73.6

Q ss_pred             HCCHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCEEEEEECCC---C-CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             589999999999999999665236665-443798799994288---8-35789999898634754333321000012321
Q gi|255764473|r   13 NISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKP---S-TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAE   87 (306)
Q Consensus        13 dl~~~~i~~ll~~A~~~k~~~~~~~~~-~~l~gk~i~~lF~e~---S-tRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgE   87 (306)
                      ..+.+--..+++.|+++.-.+...... .--+.++|+++...-   . .+--...+..+.+.|.+++......+.   -+
T Consensus        31 ~vs~~tr~rV~~~a~elgY~pn~~Ar~l~~~~t~~Igli~~~i~~~~~~~~~~~i~~~~~~~gy~~~l~~~~~~~---~~  107 (342)
T PRK09526         31 HVSAKTREKVEAAMAELNYVPNRVAQQLAGKQSLTIGLVTTSLALHAPSQIAAAIKSRADQLGYSVVISMVERSG---VE  107 (342)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCC---HH
T ss_conf             999999999999999839997888887513887279999346665247999999999999869969999688980---89


Q ss_pred             CHHHHHHHH-HHCCCEEEEEEC-CCCHHHHH-HCCCCCCEECCCCCCCH-HHHHHHHHHH----HHHHCCCCCCCCEEEE
Q ss_conf             079999975-300101112101-32006776-30124412404333202-4678765576----6420013367730461
Q gi|255764473|r   88 TIGDTAKVL-SRYVDAIVMRTT-NHSRLLEL-TEYATVPVINALTDNTH-PCQIIADIMT----FEEHRGSVKGKLFSWS  159 (306)
Q Consensus        88 sl~Dt~~~l-s~~~D~iviR~~-~~~~~~~~-~~~~~vpvINa~~~~~H-PtQaL~D~~T----i~e~~g~l~~~~i~~v  159 (306)
                      .+++....+ +..+|++++-.+ .......+ ....++|++--....+. ..-+..|-+-    .-++.-..--.+|+++
T Consensus       108 ~~~~~~~~l~~~~vdGiIi~~~~~~~~~~~l~~~~~~ip~v~~~~~~~~~~~~V~~D~~~~~~~a~~~L~~~Ghr~I~~i  187 (342)
T PRK09526        108 ACQAAVNELLAQRVSGVIINVPLEDADAEKIVADCADVPCLFLDVSPQSPVNSVSFSHEDGTRLGVEHLVELGHQQIALL  187 (342)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCCCCCCCEEEECHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999996698889995688844899999857998599980688889998996479999999999997599759999


Q ss_pred             CCC
Q ss_conf             045
Q gi|255764473|r  160 GDG  162 (306)
Q Consensus       160 Gd~  162 (306)
                      |..
T Consensus       188 ~~~  190 (342)
T PRK09526        188 AGP  190 (342)
T ss_pred             ECC
T ss_conf             589


No 325
>PRK07985 oxidoreductase; Provisional
Probab=23.76  E-value=35  Score=14.91  Aligned_cols=20  Identities=25%  Similarity=0.250  Sum_probs=10.9

Q ss_pred             CCHHHCCCCCCEEEEEECHH
Q ss_conf             31010012331257652000
Q gi|255764473|r  167 HSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       167 hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +|+..-+...|..++-++|-
T Consensus       211 rslA~Ela~~gIRVN~IaPG  230 (294)
T PRK07985        211 RGLAKQVAEKGIRVNIVAPG  230 (294)
T ss_pred             HHHHHHHCCCCEEEEEEEEC
T ss_conf             99999965339299999638


No 326
>PRK07201 short chain dehydrogenase; Provisional
Probab=23.63  E-value=28  Score=15.53  Aligned_cols=39  Identities=18%  Similarity=0.123  Sum_probs=28.1

Q ss_pred             CCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHH
Q ss_conf             013367730461045555431010012331257652000
Q gi|255764473|r  148 RGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       148 ~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +|.++|+.+.+.|-.+.+.......+++-|+.+.+++-.
T Consensus       371 ~g~L~GKvalITGASSGIG~A~A~~LA~~GA~Vvl~AR~  409 (663)
T PRK07201        371 RGPLEGKHVIITGASSGIGRATAIKVAEAGATVFALARD  409 (663)
T ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             888799479993887599999999999879989999899


No 327
>PRK13530 arsenate reductase; Provisional
Probab=23.51  E-value=53  Score=13.74  Aligned_cols=73  Identities=15%  Similarity=0.065  Sum_probs=33.6

Q ss_pred             CCCCEEEECCCCCCCCCHH-HCC-CCC-CE--EEEEECHHCCCCCCCCHHHHHCCCCCCCCC--CCHH-HHCCCCCCCCC
Q ss_conf             6773046104555543101-001-233-12--576520000132100002432013322213--6646-63068733222
Q gi|255764473|r  152 KGKLFSWSGDGNNILHSLI-EGA-ARF-NY--LLNIATPIGSEPRNEYLNWARNQGASVALF--HDAV-QAVKGAHCVFT  223 (306)
Q Consensus       152 ~~~~i~~vGd~~~v~hS~i-~~~-~~~-g~--~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~--~d~~-eal~~aD~V~~  223 (306)
                      .+++|.++.-+ |.++|.+ +++ ..+ |-  .+.-++-......+..+...+..|..++-.  ..++ ..+.++|+|+|
T Consensus         2 ~kk~VLFvCt~-Ns~RSqmAEal~~~~~~~~~~v~SAG~~~~~v~p~ai~vm~e~Gidis~~~~k~i~~~~~~~~D~VIt   80 (133)
T PRK13530          2 NKKTIYFLCTG-NSCRSQMAEGWGKQYLGDEWNVYSAGIEAHGVNPNAIKAMKEVGIDISNQTSDLIDNDILNNADLVVT   80 (133)
T ss_pred             CCCEEEEEECC-CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHCCCCCEEEE
T ss_conf             98879999599-62788999999998658966998067787786989999999869165557877578646246898999


Q ss_pred             CC
Q ss_conf             10
Q gi|255764473|r  224 DT  225 (306)
Q Consensus       224 ~~  225 (306)
                      .+
T Consensus        81 ~c   82 (133)
T PRK13530         81 LC   82 (133)
T ss_pred             EC
T ss_conf             56


No 328
>PRK11749 putative oxidoreductase; Provisional
Probab=23.45  E-value=34  Score=15.01  Aligned_cols=260  Identities=17%  Similarity=0.140  Sum_probs=114.0

Q ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC---CCCC--------CCHHHHHHHH-HHCCCEEEEE
Q ss_conf             54437987999942888357899998986347543333210000---1232--------1079999975-3001011121
Q gi|255764473|r   39 NKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQ---LGRA--------ETIGDTAKVL-SRYVDAIVMR  106 (306)
Q Consensus        39 ~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss---~~kg--------Esl~Dt~~~l-s~~~D~iviR  106 (306)
                      ..+-.||.|+.+=-=|+   =+|-..-..++|.+|..+.....-   +..|        |-+..-...+ +..++. ...
T Consensus       135 ~~~~~gkkVAIIGaGPA---GLsAA~~Lar~G~~VtVfE~~~~~GGll~~GIP~~rlpk~v~~~ei~~i~~~GV~~-~~n  210 (460)
T PRK11749        135 PAPKTGKKVAVIGAGPA---GLTAAHRLARKGYDVTIFEARDKAGGLLRYGIPEFRLPKDIVDREVERLLKLGVEI-RTN  210 (460)
T ss_pred             CCCCCCCEEEEECCCHH---HHHHHHHHHHCCCEEEEEECCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEE-ECC
T ss_conf             86678998999896789---99999999976984799704787875575458997554479999999998539789-855


Q ss_pred             E--CCCCHHHHHHCCCCCCEECCCCC---------CCHH--HHHHHHHHHHH---HHC----CCCCCCCEEEECCCCCCC
Q ss_conf             0--13200677630124412404333---------2024--67876557664---200----133677304610455554
Q gi|255764473|r  107 T--TNHSRLLELTEYATVPVINALTD---------NTHP--CQIIADIMTFE---EHR----GSVKGKLFSWSGDGNNIL  166 (306)
Q Consensus       107 ~--~~~~~~~~~~~~~~vpvINa~~~---------~~HP--tQaL~D~~Ti~---e~~----g~l~~~~i~~vGd~~~v~  166 (306)
                      +  ..+-.+.++.+.-+.=+|--|..         ..+|  ..+ .|+++-.   +..    ....|++|+++|.++ |+
T Consensus       211 ~~vG~ditl~~L~~~ydAV~lAtGa~~~r~l~ipGe~~~GV~~a-~dfL~~~~~~~~~~~~~~~~~Gk~VvVIGgGn-vA  288 (460)
T PRK11749        211 TAVGRDITLDELRAEYDAVFIGTGLGLPRFLGIPGENLGGVYSA-VDFLTRVNQDAVADDDTLIAVGKRVVVIGGGN-TA  288 (460)
T ss_pred             EEECCCCCHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCEEEH-HHHHHHHHCCCCCCCCCCCCCCCEEEEECCCH-HH
T ss_conf             58566432887741148899944789886479998668887898-99999974365444577554487489989846-69


Q ss_pred             CCHHHCCCCCCEE-EEEECHHCCC--CC-CCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEEC--CCCC-------
Q ss_conf             3101001233125-7652000013--21-00002432013322213664663068733222100000--0220-------
Q gi|255764473|r  167 HSLIEGAARFNYL-LNIATPIGSE--PR-NEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM--NQEF-------  233 (306)
Q Consensus       167 hS~i~~~~~~g~~-v~~~~P~~~~--~~-~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~--~~~~-------  233 (306)
                      ---+..+.++|.+ |+++...+..  |. ..-++.++..|..+.....+.+.+.+.+-+-.-....+  .+..       
T Consensus       289 ~D~Arta~r~GA~~V~vv~rr~~~~mpa~~~Ei~~A~~eGv~~~~~~~p~ei~~~~~~v~gv~~~~~~l~~~d~g~~~~~  368 (460)
T PRK11749        289 MDAARTAKRLGAESVTIVYRRGREEMPASEEEVEHAKEEGVEFVWLAAPVAILGDEGRVTGVKFERMELGEPDAGRRRPV  368 (460)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCHHCCCCCHHHHHHHHHCCEEEEECCCCEEEEECCCCEEEEEEEEEEEECCCCCCCCCE
T ss_conf             99899999828984633000752009989999998874570888266878999659957999999988615777873524


Q ss_pred             -------HHHHHHCCC--CCCCCHHHH------HCCCCCCEEECCCCC---CCCCCCCHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             -------133310011--123368899------628987299259998---74873576796799710686877559999
Q gi|255764473|r  234 -------KAREEHVFQ--PFQVNLSLM------SMAHPDALFMHCLPA---HRGEEVINEVLDGPQSVVFDEAENRLHTQ  295 (306)
Q Consensus       234 -------~~~~~~~~~--~y~i~~~~l------~~a~~~~~vmHplP~---~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr  295 (306)
                             ...-.-.+-  .+..+...+      +..+.+.++.-+-..   ..|+=...|+..+|. .+.+-+..|-.+.
T Consensus       369 ~~~g~~~~i~aD~Vi~AiG~~p~~~~~~~~~g~~~~~~g~i~~~d~~~~Ts~~gVFAaGD~~~G~~-~vv~Ai~~Gr~AA  447 (460)
T PRK11749        369 PIEGSEFTLEADMVIKAIGQTPNPLILATTPGLAVTRWGTIIADDETGRTSLPGVFAGGDIVTGAA-TVVLAVGDGKDAA  447 (460)
T ss_pred             ECCCCEEEEECCEEEECCCCCCCCCCCCCCCCCEECCCCCEEECCCCCCCCCCCEEEECCCCCCCH-HHHHHHHHHHHHH
T ss_conf             079957999899999998789884100346681276899988468997228999999458776705-9999999999999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999996255
Q gi|255764473|r  296 KAILLWCFGI  305 (306)
Q Consensus       296 ~AiL~~~lG~  305 (306)
                      .+|-.|+.|-
T Consensus       448 ~~I~~~L~G~  457 (460)
T PRK11749        448 EAIHEYLEGA  457 (460)
T ss_pred             HHHHHHHCCC
T ss_conf             9999985898


No 329
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional
Probab=23.15  E-value=54  Score=13.69  Aligned_cols=165  Identities=13%  Similarity=0.157  Sum_probs=82.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCEEEEEEC---CCCC-HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999999999999999665236665-4437987999942---8883-57899998986347543333210000123210
Q gi|255764473|r   14 ISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFE---KPST-RTRVSFEVAMKHLGGDTIFLSGSEMQLGRAET   88 (306)
Q Consensus        14 l~~~~i~~ll~~A~~~k~~~~~~~~~-~~l~gk~i~~lF~---e~St-RTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEs   88 (306)
                      .+++.-..+++.|+++--.+...... ..-+-++|++++.   .|+. +--...|.++++-|.+++......    ..|.
T Consensus        30 Vs~~Tr~rV~~aa~eLgY~Pn~~Ar~L~~~~t~~Igvvvp~~~n~~~~~l~~~i~~~~~~~gy~~li~~s~~----~~~~  105 (330)
T PRK11303         30 ISDKTVEKVMAVVREHNYHPNAVAAGLRAGRTRSIGLIIPDLENTSYARIAKLLEQQARQRGYQLLIACSDD----QPDN  105 (330)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC----CHHH
T ss_conf             699999999999999689948889886308777677754544431567888999999996698799994799----9899


Q ss_pred             HHHHHHHH-HHCCCEEEEEE--CCCCHHHHHHCCCCCCEECCCCC--CCHHHHHHHHHH----HHHHHCCCCCCCCEEEE
Q ss_conf             79999975-30010111210--13200677630124412404333--202467876557----66420013367730461
Q gi|255764473|r   89 IGDTAKVL-SRYVDAIVMRT--TNHSRLLELTEYATVPVINALTD--NTHPCQIIADIM----TFEEHRGSVKGKLFSWS  159 (306)
Q Consensus        89 l~Dt~~~l-s~~~D~iviR~--~~~~~~~~~~~~~~vpvINa~~~--~~HPtQaL~D~~----Ti~e~~g~l~~~~i~~v  159 (306)
                      -.+..+.+ +..+|++++-.  +.+...........+|+|--+..  ..+-..+..|-+    .+-++.-..-..+|+|+
T Consensus       106 e~~~~~~l~~~~vdgiIv~~~~~~~~~~~~~l~~~~iPvV~i~~~~~~~~~~~V~~d~~~~~~~a~~~L~~~GhrrI~~i  185 (330)
T PRK11303        106 EMQCAEHLLQRQVDALIVATSLPPEHPFYQRLQNDGFPIIALDRALDREHFTSVVSDDQDAAEMLAESLLKFPAESILLL  185 (330)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999974899899946888862999999846997899725678888998997219999999999998699979999


Q ss_pred             CCCCC--CCC----CHHHCCCCCCEEEEE
Q ss_conf             04555--543----101001233125765
Q gi|255764473|r  160 GDGNN--ILH----SLIEGAARFNYLLNI  182 (306)
Q Consensus       160 Gd~~~--v~h----S~i~~~~~~g~~v~~  182 (306)
                      |....  +.+    .+..++...|..+.+
T Consensus       186 ~~~~~~~~~~~R~~Gf~~al~~~g~~~~~  214 (330)
T PRK11303        186 GALPELSVSFLREQGFRQALKDDPREVHF  214 (330)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             68975637999999999999967998059


No 330
>COG2719 SpoVR Uncharacterized conserved protein [Function unknown]
Probab=22.91  E-value=54  Score=13.66  Aligned_cols=17  Identities=6%  Similarity=0.137  Sum_probs=6.8

Q ss_pred             CCHHHHHHHHHHHHHHH
Q ss_conf             89999999999999999
Q gi|255764473|r   14 ISSSNLSCIIEVAKKIK   30 (306)
Q Consensus        14 l~~~~i~~ll~~A~~~k   30 (306)
                      ...++++.+||.+..+.
T Consensus       153 ~G~~~VE~~LDs~hai~  169 (495)
T COG2719         153 HGVEEVERFLDSCHAIM  169 (495)
T ss_pred             HCHHHHHHHHHHHHHHH
T ss_conf             58899999999999999


No 331
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=22.85  E-value=38  Score=14.64  Aligned_cols=53  Identities=19%  Similarity=0.367  Sum_probs=32.6

Q ss_pred             EEECCCCCHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC--CCEEEEE
Q ss_conf             99428883578999-9898634754333321000012321079999975300--1011121
Q gi|255764473|r   49 MIFEKPSTRTRVSF-EVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRY--VDAIVMR  106 (306)
Q Consensus        49 ~lF~e~StRTR~SF-e~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~--~D~iviR  106 (306)
                      .||+-|.-=-++++ .+=++.||.+....+...     =|...|.+..|+..  .|++-|=
T Consensus        54 ~Ll~GPPGlGKTTLA~iiA~E~~~~~~~tsGP~-----lek~~DL~~iLt~l~~~dvLFID  109 (328)
T PRK00080         54 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPA-----LEKAGDLAALLTNLEEGDVLFID  109 (328)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCEECCCCC-----CCCHHHHHHHHHHCCCCCEEEEH
T ss_conf             576588998899999999998688815624500-----16747899999608878767650


No 332
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional
Probab=22.82  E-value=54  Score=13.65  Aligned_cols=147  Identities=12%  Similarity=0.093  Sum_probs=77.6

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCEEEEEECCCCC----HHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             4589999999999999999665236665-44379879999428883----578999989863475433332100001232
Q gi|255764473|r   12 SNISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPST----RTRVSFEVAMKHLGGDTIFLSGSEMQLGRA   86 (306)
Q Consensus        12 ~dl~~~~i~~ll~~A~~~k~~~~~~~~~-~~l~gk~i~~lF~e~St----RTR~SFe~A~~~LG~~~~~~~~~~ss~~kg   86 (306)
                      ...+.+.-..+++.|+++--.+...... ..-+.++|+++....+.    +--...+.++.+.|..++..+...    ..
T Consensus        26 ~~Vs~~Tr~rV~~aa~eLgY~pn~~Ar~L~~~~s~~Igviv~~~~~~~~~~~~~~i~~~~~~~gy~~~l~~~~~----~~  101 (335)
T PRK10703         26 RFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEIIEAVEKNCYQKGYTLILCNAWN----NL  101 (335)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCEEEEEECCCCCCEEHHHHHHHHHHHHHCCCEEEEEECCC----CH
T ss_conf             99899999999999998299978778754117774599995478886506543369999997399799992789----86


Q ss_pred             CCHHHHHHHH-HHCCCEEEEEEC--CCCHHHHHHCCCCCCEECCC--CC-CCHHHHHHHHHHH----HHHHCCCCCCCCE
Q ss_conf             1079999975-300101112101--32006776301244124043--33-2024678765576----6420013367730
Q gi|255764473|r   87 ETIGDTAKVL-SRYVDAIVMRTT--NHSRLLELTEYATVPVINAL--TD-NTHPCQIIADIMT----FEEHRGSVKGKLF  156 (306)
Q Consensus        87 Esl~Dt~~~l-s~~~D~iviR~~--~~~~~~~~~~~~~vpvINa~--~~-~~HPtQaL~D~~T----i~e~~g~l~~~~i  156 (306)
                      |...+....+ +..+|++++=..  .+..+..+.++.++|++--.  .. ...+.-..-|-+.    .-++.-..-..+|
T Consensus       102 ~~~~~~l~~l~~~~vdGiIi~~~~~~~~~~~~l~~~~~iP~V~id~~~~~~~~~~~v~~~~~~~~~~a~~~L~~~Ghr~I  181 (335)
T PRK10703        102 EKQRAYLSMLAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDAIIDNAFEGGYLAGRYLIERGHRDI  181 (335)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCEE
T ss_conf             99999999999558877999768899799999997089988999477777888959974879999999999997599869


Q ss_pred             EEECCC
Q ss_conf             461045
Q gi|255764473|r  157 SWSGDG  162 (306)
Q Consensus       157 ~~vGd~  162 (306)
                      ++++..
T Consensus       182 a~i~~~  187 (335)
T PRK10703        182 GVIPGP  187 (335)
T ss_pred             EEEECC
T ss_conf             999588


No 333
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. There are five types of kainate receptors, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeric receptor channels activated
Probab=22.80  E-value=54  Score=13.65  Aligned_cols=133  Identities=17%  Similarity=0.297  Sum_probs=56.4

Q ss_pred             EEEEEECC----CCCH---HHHHHHHHHHHCCCCCCCCCCCCC-----CCCCCCCHHHHHHHHHHC-CCEEEEEECCC--
Q ss_conf             79999428----8835---789999898634754333321000-----012321079999975300-10111210132--
Q gi|255764473|r   46 VLAMIFEK----PSTR---TRVSFEVAMKHLGGDTIFLSGSEM-----QLGRAETIGDTAKVLSRY-VDAIVMRTTNH--  110 (306)
Q Consensus        46 ~i~~lF~e----~StR---TR~SFe~A~~~LG~~~~~~~~~~s-----s~~kgEsl~Dt~~~ls~~-~D~iviR~~~~--  110 (306)
                      .|+-+|..    .|+.   -+++|+.|+.+.-.+.-.+.....     .+...-|++=+.++...+ -++..|=+|.+  
T Consensus         4 ~iGaiF~~~~~~~~~~~~~~e~Af~~Av~~iN~~~~iL~~t~L~~~i~~v~~~dsF~~~~~~C~l~~~GV~AIfGP~s~~   83 (384)
T cd06393           4 RIGGIFEYLDGPNNQVMSAEELAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGS   83 (384)
T ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCHH
T ss_conf             98478513777642000678999999999851685447996579886654779878999999998736937998988667


Q ss_pred             --CHHHHHHCCCCCCEECCC-C-----C------CCHH-----HHHHHHHHHHHHHCCCCCCCCEEEECCCC-CCCCCHH
Q ss_conf             --006776301244124043-3-----3------2024-----67876557664200133677304610455-5543101
Q gi|255764473|r  111 --SRLLELTEYATVPVINAL-T-----D------NTHP-----CQIIADIMTFEEHRGSVKGKLFSWSGDGN-NILHSLI  170 (306)
Q Consensus       111 --~~~~~~~~~~~vpvINa~-~-----~------~~HP-----tQaL~D~~Ti~e~~g~l~~~~i~~vGd~~-~v~hS~i  170 (306)
                        ..+..++....||-|--. +     .      .-||     .+|++|+.+-..++    ...+.|--|.+ .-+.-++
T Consensus        84 sa~~v~sic~~l~IPhi~~~~~~~~~~~~~~f~inl~P~~~~l~~Ai~dlV~~~~W~----~~~iiYd~d~gl~~Lq~ll  159 (384)
T cd06393          84 CTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQYLKWR----SATVVYDDSTGLIRLQELI  159 (384)
T ss_pred             HHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHCCCC----EEEEEEECCCCHHHHHHHH
T ss_conf             899999985356687163355678867666644871488789999999999867984----7999996771278999999


Q ss_pred             HCCCCCCEEEEE
Q ss_conf             001233125765
Q gi|255764473|r  171 EGAARFNYLLNI  182 (306)
Q Consensus       171 ~~~~~~g~~v~~  182 (306)
                      .+..+.+..+.+
T Consensus       160 ~~~~~~~~~v~~  171 (384)
T cd06393         160 MAPSRYNIRLKI  171 (384)
T ss_pred             HHHHCCCCEEEE
T ss_conf             753136857999


No 334
>TIGR00195 exoDNase_III exodeoxyribonuclease III; InterPro: IPR000097 DNA damaging agents such as the antitumor drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA. Amongst these is base-loss which forms apurinic/apyrimidinic (AP) sites or strand breaks with atypical 3' termini. DNA repair at the AP sites is initiated by specific endonuclease cleavage of the phosphodiester backbone. Such endonucleases are also generally capable of removing blocking groups from the 3' terminus of DNA strand breaks.   AP endonucleases can be classified into two families based on sequence similarity. This family contains members of AP endonuclease family 1. Except for Rrp1 and arp, these enzymes are proteins of about 300 amino-acid residues. Rrp1 and arp both contain additional and unrelated sequences in their N-terminal section (about 400 residues for Rrp1 and 270 for arp). The proteins contain glutamate which has been shown , in the Escherichia coli enzyme to bind a divalent metal ion such as magnesium or manganese.; GO: 0003677 DNA binding, 0004519 endonuclease activity, 0006281 DNA repair, 0005622 intracellular.
Probab=22.72  E-value=55  Score=13.64  Aligned_cols=102  Identities=15%  Similarity=0.112  Sum_probs=54.0

Q ss_pred             HHHCCCCCCCCCC---CCCC---CCCCCCHHHHHHHHHHCCCEE-EEEEC-CCCHHHHHHCCCCCC----EECCCCC---
Q ss_conf             8634754333321---0000---123210799999753001011-12101-320067763012441----2404333---
Q gi|255764473|r   66 MKHLGGDTIFLSG---SEMQ---LGRAETIGDTAKVLSRYVDAI-VMRTT-NHSRLLELTEYATVP----VINALTD---  130 (306)
Q Consensus        66 ~~~LG~~~~~~~~---~~ss---~~kgEsl~Dt~~~ls~~~D~i-viR~~-~~~~~~~~~~~~~vp----vINa~~~---  130 (306)
                      ..+.|-|+.+-..   +-|.   .+|.|.+.|.-.=|+  .+-- .+-+. +.+.=...+++.++-    |||.=..   
T Consensus        49 ~~~~GYh~f~~~~~~KGy~GVA~~sk~EP~~dV~~G~~--~e~~PaltGdlD~e~R~I~a~~~~~~G~~Tv~N~Y~PnGE  126 (281)
T TIGR00195        49 FEEEGYHVFFSGAKKKGYSGVAIFSKEEPLSDVRYGFG--VEEEPALTGDLDAEGRVITAEFDGFLGLLTVVNGYFPNGE  126 (281)
T ss_pred             HHHCCCEEEECCCEEECCCCEEEEECCCCHHHHHCCCC--CCCCCCCCCCCCCCCCEEEEEECCCEEEEEEEEEEECCCC
T ss_conf             97649817873642336430799862688588603678--8776533276121671799975783024899986655984


Q ss_pred             -CCHHH--HHHHHHHHHHHHC-C--CCCCCC-EEEECCCCCCCCCHH
Q ss_conf             -20246--7876557664200-1--336773-046104555543101
Q gi|255764473|r  131 -NTHPC--QIIADIMTFEEHR-G--SVKGKL-FSWSGDGNNILHSLI  170 (306)
Q Consensus       131 -~~HPt--QaL~D~~Ti~e~~-g--~l~~~~-i~~vGd~~~v~hS~i  170 (306)
                       ..|+.  +.=++.+.-.+++ .  .-++.. |.||||.| |+|+=+
T Consensus       127 S~~~~~k~~YKl~w~~~l~~yl~~~~~~~~p~v~~CGD~N-iAp~ei  172 (281)
T TIGR00195       127 SRLDSEKLPYKLQWLEALQNYLEKLRDKDKPEVIICGDFN-IAPEEI  172 (281)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCC
T ss_conf             3001455788999999999999998636898899976778-898613


No 335
>PRK09492 treR trehalose repressor; Provisional
Probab=22.41  E-value=55  Score=13.60  Aligned_cols=145  Identities=14%  Similarity=0.134  Sum_probs=75.2

Q ss_pred             HCCHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCEEEEEECCCCCHHH----HHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             589999999999999999665236665-44379879999428883578----9999898634754333321000012321
Q gi|255764473|r   13 NISSSNLSCIIEVAKKIKNSSENIFEN-KPLSGKVLAMIFEKPSTRTR----VSFEVAMKHLGGDTIFLSGSEMQLGRAE   87 (306)
Q Consensus        13 dl~~~~i~~ll~~A~~~k~~~~~~~~~-~~l~gk~i~~lF~e~StRTR----~SFe~A~~~LG~~~~~~~~~~ss~~kgE   87 (306)
                      ..+.+.-+.+++.|+++--.|...... ..-+-++|+.++-..++...    -.++.++.+-|-+++......+    .|
T Consensus        30 ~vs~eTr~rV~~~a~elgY~Pn~~Ar~L~~~~t~~Ig~i~~~~~~~~~~~~~~~i~~~~~~~gy~~~i~~~~~~----~~  105 (315)
T PRK09492         30 KVSPRTRERVEAVINQHGFSPSKSARAMRGQSDKVVGIIVSRLDSPSENLAVQTMLPAFYQQGYDPIIMESQFS----PQ  105 (315)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCC----HH
T ss_conf             99999999999999996998077889750488864666226778836789999999999974981899946899----79


Q ss_pred             CHHHHHHHHH-HCCCEEEEEECCCCHHHHHHCCCC-CCEECCCCCCCHHHHHHHHHH----HHHHHCCCCCCCCEEEEC-
Q ss_conf             0799999753-001011121013200677630124-412404333202467876557----664200133677304610-
Q gi|255764473|r   88 TIGDTAKVLS-RYVDAIVMRTTNHSRLLELTEYAT-VPVINALTDNTHPCQIIADIM----TFEEHRGSVKGKLFSWSG-  160 (306)
Q Consensus        88 sl~Dt~~~ls-~~~D~iviR~~~~~~~~~~~~~~~-vpvINa~~~~~HPtQaL~D~~----Ti~e~~g~l~~~~i~~vG-  160 (306)
                      ..++....+. ..+|++++-.........+..+.. ++++.- +... -..+..|-+    .+-++.-..--.+|+|+| 
T Consensus       106 ~~~~~~~~l~~~~vdGiIl~~~~~~~~~~l~~~~~~~v~i~~-~~~~-~~~V~~d~~~~~~~a~~~L~~~Gh~~i~~i~~  183 (315)
T PRK09492        106 LVNEHLGVLRRRNVDGVILFGFTGITEEMLAPWQDSLVVLAR-DAKG-FSSVCYDDEGAIKLLMQRLYDQGHRHISYLGV  183 (315)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHCCCEEEEEC-CCCC-CCEEEECHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             999999999967989899968988889999981798699941-6899-87687657999999999999759986999926


Q ss_pred             CCC
Q ss_conf             455
Q gi|255764473|r  161 DGN  163 (306)
Q Consensus       161 d~~  163 (306)
                      +.+
T Consensus       184 ~~~  186 (315)
T PRK09492        184 PHS  186 (315)
T ss_pred             CCC
T ss_conf             854


No 336
>TIGR01258 pgm_1 phosphoglycerate mutase 1 family; InterPro: IPR005952    Most members of this family are phosphoglycerate mutase (5.4.2.1 from EC). This enzyme interconverts 2-phosphoglycerate and 3-phosphoglycerate.  2-phospho-D-glycerate + 2,3-diphosphoglycerate = 3-phospho-D-glycerate + 2,3-diphosphoglycerate. The enzyme is transiently phosphorylated on an active site histidine by 2,3-diphosphoglyerate, which is both substrate and product. Some members of this family have are phosphoglycerate mutase as a minor activity and act primarily as a bisphoglycerate mutase, interconverting 2,3-diphosphoglycerate and 1,3-diphosphoglycerate (5.4.2.4 from EC). ; GO: 0016868 intramolecular transferase activity phosphotransferases, 0006096 glycolysis.
Probab=22.36  E-value=39  Score=14.59  Aligned_cols=20  Identities=30%  Similarity=0.448  Sum_probs=10.9

Q ss_pred             CCCCCEEEECCCCCCCCCHHH
Q ss_conf             367730461045555431010
Q gi|255764473|r  151 VKGKLFSWSGDGNNILHSLIE  171 (306)
Q Consensus       151 l~~~~i~~vGd~~~v~hS~i~  171 (306)
                      .+|++|.|+-++| -++.++.
T Consensus       173 ~~GK~VLI~AHGN-SLRALvK  192 (248)
T TIGR01258       173 KSGKRVLIAAHGN-SLRALVK  192 (248)
T ss_pred             HCCCEEEEEECCH-HHHHHHH
T ss_conf             4689799982280-4899999


No 337
>PRK13609 diacylglycerol glucosyltransferase; Provisional
Probab=22.30  E-value=56  Score=13.59  Aligned_cols=42  Identities=26%  Similarity=0.279  Sum_probs=25.8

Q ss_pred             HHHHHHC-CCEEEEEECCCCHHHHHH--CCCCCCEECCCCC-CCHHH
Q ss_conf             9975300-101112101320067763--0124412404333-20246
Q gi|255764473|r   93 AKVLSRY-VDAIVMRTTNHSRLLELT--EYATVPVINALTD-NTHPC  135 (306)
Q Consensus        93 ~~~ls~~-~D~iviR~~~~~~~~~~~--~~~~vpvINa~~~-~~HPt  135 (306)
                      .+.+..+ .|++|--+|-.. +..+.  ...++|+++-.+| ..||+
T Consensus        97 ~~li~~~kPDvII~T~P~~~-l~~lk~~~~~~iP~~tViTD~~~H~~  142 (388)
T PRK13609         97 KLLLQAEKPDIVINTFPIIA-VPELKKQTGISIPVYNVLTDFCVHKI  142 (388)
T ss_pred             HHHHHHCCCCEEEECCCHHH-HHHHHHHCCCCCCEEEEECCCCCHHH
T ss_conf             99999829599998887899-99999845999988999478520464


No 338
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=22.21  E-value=56  Score=13.57  Aligned_cols=19  Identities=16%  Similarity=0.251  Sum_probs=10.5

Q ss_pred             HHHHHHHHCCCCCCCCCCC
Q ss_conf             9998986347543333210
Q gi|255764473|r   61 SFEVAMKHLGGDTIFLSGS   79 (306)
Q Consensus        61 SFe~A~~~LG~~~~~~~~~   79 (306)
                      ....+..+.|.+|+-+|..
T Consensus        14 ~~a~~la~~G~~V~g~D~d   32 (185)
T pfam03721        14 PTAVCLAEIGHDVVGVDIN   32 (185)
T ss_pred             HHHHHHHHCCCEEEEEECC
T ss_conf             9999999489939999799


No 339
>TIGR01169 rplA_bact ribosomal protein L1; InterPro: IPR005878   Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.    Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , .    Ribosomal protein L1 is the largest protein from the large ribosomal subunit. In Escherichia coli, L1 is known to bind to the 23S rRNA. This model describe s bacterial and chloroplast ribosomal protein L1. Most mitochondrial L1 sequences are sufficiently divergent to be the contained in a different entry (IPR005879 from INTERPRO).; GO: 0003723 RNA binding, 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit.
Probab=22.11  E-value=25  Score=15.90  Aligned_cols=27  Identities=37%  Similarity=0.497  Sum_probs=18.3

Q ss_pred             EECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCC
Q ss_conf             5200001321000024320133222136646630687
Q gi|255764473|r  182 IATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGA  218 (306)
Q Consensus       182 ~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~a  218 (306)
                      +.+|.|++|.+       +.|   +++.|+.+|++++
T Consensus       128 iLGPRGLMPNP-------K~G---TVT~dva~Av~~~  154 (227)
T TIGR01169       128 ILGPRGLMPNP-------KTG---TVTADVAKAVKEA  154 (227)
T ss_pred             HCCCCCCCCCC-------CCC---CCCHHHHHHHHHH
T ss_conf             04788847535-------966---5224379999987


No 340
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=21.96  E-value=57  Score=13.54  Aligned_cols=84  Identities=12%  Similarity=0.041  Sum_probs=48.5

Q ss_pred             HHHHHHHHHHHHHHHCCCC-CCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCC---
Q ss_conf             2467876557664200133-677304610455554310100123312576520000132100002432013322213---
Q gi|255764473|r  133 HPCQIIADIMTFEEHRGSV-KGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALF---  208 (306)
Q Consensus       133 HPtQaL~D~~Ti~e~~g~l-~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~---  208 (306)
                      -|+.+++=...+.+ .+.+ .+.++.+.|-.+.|....++++..+|+++.....     .++..+++++.|....+.   
T Consensus       121 ~~~~~~Ta~~~l~~-~~~~~~g~~vLi~gaaGgVG~~avQlAk~~Ga~Vi~t~~-----s~~k~e~~~~lGA~~vi~~~~  194 (327)
T PRK10754        121 SFLKGLTVYYLLRK-TYEIKPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTVG-----SAQKAQRALKAGAWQVINYRE  194 (327)
T ss_pred             HHHHHHHHHHHHHH-CCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCEEEEEEC-----CHHHHHHHHHCCCCEEEECCC
T ss_conf             21358879887653-137899999999817761126899999986999999989-----899999999669999998999


Q ss_pred             CCHHHHC------CCCCCCC
Q ss_conf             6646630------6873322
Q gi|255764473|r  209 HDAVQAV------KGAHCVF  222 (306)
Q Consensus       209 ~d~~eal------~~aD~V~  222 (306)
                      .|+.+.+      +++|+++
T Consensus       195 ~~~~~~i~~~t~g~gvdvv~  214 (327)
T PRK10754        195 ENIVERVKEITGGKKVRVVY  214 (327)
T ss_pred             CCHHHHHHHHHCCCCCEEEE
T ss_conf             99999999986899836999


No 341
>PRK02910 light-independent protochlorophyllide reductase subunit B; Provisional
Probab=21.85  E-value=57  Score=13.53  Aligned_cols=140  Identities=13%  Similarity=0.110  Sum_probs=66.0

Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECC-CCCCCHHHH----HHHH
Q ss_conf             86347543333210000123210799999753001011121013200677630124412404-333202467----8765
Q gi|255764473|r   66 MKHLGGDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINA-LTDNTHPCQ----IIAD  140 (306)
Q Consensus        66 ~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa-~~~~~HPtQ----aL~D  140 (306)
                      ...||..+-..-|      -|-|+.|..+.-..++.++..|-.......-+.+....|.+-- -= .-++|.    .|..
T Consensus       184 l~~lGi~VNvV~P------~Gas~~dl~rL~~A~~Nv~lYrE~g~~aa~~Le~~fg~P~~~~~Pi-Gv~~T~~flrel~~  256 (524)
T PRK02910        184 LATLGIDVNVVAP------LGASPADLKRLPAAWFNVVLYREIGESAAEYLEREFGMPYVTTVPI-GVGATARFIREVAE  256 (524)
T ss_pred             HHHCCCEEEEEEC------CCCCHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHCCCEECCCCC-CHHHHHHHHHHHHH
T ss_conf             9875966889804------9999788851020407464258777999999998858970103475-41799999999999


Q ss_pred             HHHH--------------------H--HH--CCCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHH
Q ss_conf             5766--------------------4--20--0133677304610455554310100123312576520000132100002
Q gi|255764473|r  141 IMTF--------------------E--EH--RGSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLN  196 (306)
Q Consensus       141 ~~Ti--------------------~--e~--~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~  196 (306)
                      ++-+                    |  +.  ...+.|+++.+.||.+.+.--.-.+..-+|+++..++.=.-.....+..
T Consensus       257 ~lg~~~~~~~~~i~~~~~~~s~~~W~srSvD~~~ltgKr~fVfGDaTha~a~~kil~~ElG~~vvg~GTY~r~~Ar~~r~  336 (524)
T PRK02910        257 LLNLDGADLEAFILDELSAPSRLPWFSRSVDSTYLTGKRVFVFGDATHAVAAAKILRDELGFEVVGAGTYLREDARWVRA  336 (524)
T ss_pred             HHCCCCCCHHHHHHHHCCCCCCCCEEEECCCCHHHCCCEEEEECCCHHHHHHHHHHHHHHCEEEEEECCCHHHHHHHHHH
T ss_conf             96899642255554420142335301213650121364479965607999999998886480787313551877899999


Q ss_pred             HHHCCCCCCCCCCCHH
Q ss_conf             4320133222136646
Q gi|255764473|r  197 WARNQGASVALFHDAV  212 (306)
Q Consensus       197 ~~~~~g~~i~~~~d~~  212 (306)
                      .++..+.+..+++|..
T Consensus       337 ~~~~~~~e~lItdD~~  352 (524)
T PRK02910        337 AAKGYGDEALITDDYL  352 (524)
T ss_pred             HHHHHCCCCEECCCHH
T ss_conf             9986064506406789


No 342
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=21.79  E-value=42  Score=14.41  Aligned_cols=21  Identities=14%  Similarity=0.064  Sum_probs=14.1

Q ss_pred             CCCHHHCCCCCCEEEEEECHH
Q ss_conf             431010012331257652000
Q gi|255764473|r  166 LHSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       166 ~hS~i~~~~~~g~~v~~~~P~  186 (306)
                      .+|+..-+..+|.+++.++|-
T Consensus       177 tr~lA~e~a~~gIrVNaIaPG  197 (259)
T PRK08213        177 TRALAAEWGPHGIRVNAIAPG  197 (259)
T ss_pred             HHHHHHHHHHCCEEEEEEEEC
T ss_conf             999999961039199999779


No 343
>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]
Probab=21.61  E-value=57  Score=13.50  Aligned_cols=83  Identities=20%  Similarity=0.296  Sum_probs=49.4

Q ss_pred             CEEEEEECCCC--CHH--HHHHHHHHHHCCC--CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHH--
Q ss_conf             87999942888--357--8999989863475--433332100001232107999997530010111210132006776--
Q gi|255764473|r   45 KVLAMIFEKPS--TRT--RVSFEVAMKHLGG--DTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLEL--  116 (306)
Q Consensus        45 k~i~~lF~e~S--tRT--R~SFe~A~~~LG~--~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~--  116 (306)
                      ++|+.+....+  .++  +-.++.+++.+|.  .+...+...+.-   +-+.+.-..++..+|+|++=..+...+...  
T Consensus        34 ~~i~~~~~~~~~~f~~~~~~g~~~~a~~~g~~~~~~~~~~~~d~~---~Q~~~i~~~ia~~~daIiv~~~d~~a~~~~v~  110 (322)
T COG1879          34 KTIGVVVPTLGNPFFQAVRKGAEAAAKKLGVVVAVVIADAQNDVA---KQIAQIEDLIAQGVDAIIINPVDPDALTPAVK  110 (322)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHH---HHHHHHHHHHHCCCCEEEEECCCHHHHHHHHH
T ss_conf             879999477888189999999999998649955897157888819---99999999985599889992898075899999


Q ss_pred             -HCCCCCCEECCCCC
Q ss_conf             -30124412404333
Q gi|255764473|r  117 -TEYATVPVINALTD  130 (306)
Q Consensus       117 -~~~~~vpvINa~~~  130 (306)
                       +....||||.--++
T Consensus       111 ~a~~aGIpVv~~d~~  125 (322)
T COG1879         111 KAKAAGIPVVTVDSD  125 (322)
T ss_pred             HHHHCCCEEEEECCC
T ss_conf             999779849996167


No 344
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism]
Probab=21.50  E-value=50  Score=13.87  Aligned_cols=136  Identities=12%  Similarity=0.015  Sum_probs=59.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCC--CCCCCCCHHHHHH-----HHHHCCCEEEEEECCCCHHHHHHC
Q ss_conf             799994288835789999898634754333321000--0123210799999-----753001011121013200677630
Q gi|255764473|r   46 VLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEM--QLGRAETIGDTAK-----VLSRYVDAIVMRTTNHSRLLELTE  118 (306)
Q Consensus        46 ~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~s--s~~kgEsl~Dt~~-----~ls~~~D~iviR~~~~~~~~~~~~  118 (306)
                      |+.+.=-=.|--+| ++.+++++||.+.+.+=....  -.-+|--+.|..-     +++...|...-++ .....++..+
T Consensus        66 TlvT~Gg~QSNh~r-~tAa~A~~lGlk~v~ile~~~~~y~~~gn~Ll~~~~G~~~~~~~~~~d~~~~~~-~~~~~e~~~~  143 (323)
T COG2515          66 TLVTYGGIQSNHVR-QTAAVAAKLGLKCVLILENIEANYLLNGNLLLSKLMGAEVRAVDAGTDIGINAS-AEELAEEVRK  143 (323)
T ss_pred             EEEEECCCCHHHHH-HHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHCCCEEEEECCCCCHHHCHH-HHHHHHHHHH
T ss_conf             79981651025899-999999865971899981550103566400123324765787158888643310-6789999996


Q ss_pred             CCCC-CEECCCCCCCHHHHHHHHHHHHHHHCCCCCC-CCE---EEECCCCCCCCCHHHCCCCCCEEEEEECH
Q ss_conf             1244-1240433320246787655766420013367-730---46104555543101001233125765200
Q gi|255764473|r  119 YATV-PVINALTDNTHPCQIIADIMTFEEHRGSVKG-KLF---SWSGDGNNILHSLIEGAARFNYLLNIATP  185 (306)
Q Consensus       119 ~~~v-pvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~-~~i---~~vGd~~~v~hS~i~~~~~~g~~v~~~~P  185 (306)
                      ...- -||-.|+  +||--+|.=+-.-.|..--.++ .++   +.+.-...+.--++..++.++..+.+++.
T Consensus       144 ~g~kpyvIp~gG--~~~~g~lGyv~~a~Ei~~Q~~~~~~fD~vVva~gs~gT~AGl~~g~~~~~~~~~ViG~  213 (323)
T COG2515         144 QGGKPYVIPEGG--SSPLGALGYVRLALEIAEQAEQLLKFDSVVVAPGSGGTHAGLLVGLAQLGPDVEVIGI  213 (323)
T ss_pred             CCCCCCEECCCC--CCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEE
T ss_conf             179983722677--6855441288899999999963137777999678851089999876510688846887


No 345
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds. Typical members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), 2-methylisocitrate lyase (MICL), and ketopantoate hydroxymethyltransferase (KPHMT).
Probab=21.45  E-value=58  Score=13.48  Aligned_cols=18  Identities=11%  Similarity=0.252  Sum_probs=9.9

Q ss_pred             HHHHHHHCCCCCCCCCCC
Q ss_conf             998986347543333210
Q gi|255764473|r   62 FEVAMKHLGGDTIFLSGS   79 (306)
Q Consensus        62 Fe~A~~~LG~~~~~~~~~   79 (306)
                      |..-+.+.|.+.+..+.+
T Consensus        24 ~A~~~~~agvD~iLVGDS   41 (240)
T cd06556          24 MAKQFADAGLNVMLVGDS   41 (240)
T ss_pred             HHHHHHHCCCCEEEEECC
T ss_conf             999998779989998067


No 346
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR. Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR, all of which are members of the LacI-GalR family of bacterial transcription regulators. RegR regulates bacterial competence and the expression of virulence factors, including hyaluronidase. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA b
Probab=21.39  E-value=58  Score=13.47  Aligned_cols=100  Identities=12%  Similarity=0.066  Sum_probs=54.0

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECCC-CHHHHHHCCCCCCEECCCCC---CC
Q ss_conf             789999898634754333321000012321079999975-30010111210132-00677630124412404333---20
Q gi|255764473|r   58 TRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTNH-SRLLELTEYATVPVINALTD---NT  132 (306)
Q Consensus        58 TR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~~-~~~~~~~~~~~vpvINa~~~---~~  132 (306)
                      --.++|.++.+.|.+++..+...    ..|.-.+.++.+ +..+|++++-.... ..........++|||..+..   ..
T Consensus        17 i~~gi~~~a~~~gy~l~i~~s~~----~~~~e~~~i~~l~~~~vDgiIl~~~~~~~~~~~~~~~~~iPvV~i~~~~~~~~   92 (267)
T cd06283          17 VLKGIEDVCRAHGYQVLVCNSDN----DPEKEKEYLESLLAYQVDGLIVNPTGNNKELYQRLAKNGKPVVLVDRKIPELG   92 (267)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCC----CHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             99999999998699899997899----98999999999996699999985877998999999976998999688578999


Q ss_pred             HHHHHHHHHHH----HHHHCCCCCCCCEEEECCC
Q ss_conf             24678765576----6420013367730461045
Q gi|255764473|r  133 HPCQIIADIMT----FEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus       133 HPtQaL~D~~T----i~e~~g~l~~~~i~~vGd~  162 (306)
                      .|+ +-.|-+.    .-++.-..-..+|+++|.+
T Consensus        93 ~~~-V~~D~~~~~~~~~~~L~~~G~~~i~~i~~~  125 (267)
T cd06283          93 VDT-VTLDNYEAAKEAVDHLIEKGYERILFVTEP  125 (267)
T ss_pred             CCE-EEECHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             988-997779999999999997599729999568


No 347
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit; InterPro: IPR001095 This entry contains the alpha subunit the acetyl coenzyme A carboxylase complex (). It catalyzes the first step in the synthesis of long-chain fatty acids which involves the carboxylation of acetyl-CoA to malonyl-CoA. The acetyl-CoA carboxylase complex () is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase and two non-identical carboxyl transferase subunits (alpha and beta) in a 2:2 association . The reaction involves two steps:  Biotin carrier protein + ATP + HCO_3^- -> Carboxybiotin carrier protein + ADP + P_i   Carboxybiotin carrier protein + Acetyl-CoA -> Malonyl-CoA + Biotin carrier protein ; GO: 0003989 acetyl-CoA carboxylase activity, 0006633 fatty acid biosynthetic process, 0009317 acetyl-CoA carboxylase complex.
Probab=21.34  E-value=43  Score=14.33  Aligned_cols=17  Identities=24%  Similarity=0.567  Sum_probs=7.9

Q ss_pred             HHHHHCCCCCCEECCCC
Q ss_conf             67763012441240433
Q gi|255764473|r  113 LLELTEYATVPVINALT  129 (306)
Q Consensus       113 ~~~~~~~~~vpvINa~~  129 (306)
                      +-++|+.-+.|||--=|
T Consensus       151 Lm~~AerF~~PIi~fiD  167 (329)
T TIGR00513       151 LMKMAERFNLPIITFID  167 (329)
T ss_pred             HHHHHHHCCCCEEEEEC
T ss_conf             99877761798588653


No 348
>pfam11339 DUF3141 Protein of unknown function (DUF3141). This family of proteins with unknown function appears to be restricted to Proteobacteria.
Probab=21.32  E-value=52  Score=13.80  Aligned_cols=31  Identities=19%  Similarity=0.201  Sum_probs=13.7

Q ss_pred             CCCCCHHHHHHH---HHHHHHHHCCCCCCCCEEEE
Q ss_conf             333202467876---55766420013367730461
Q gi|255764473|r  128 LTDNTHPCQIIA---DIMTFEEHRGSVKGKLFSWS  159 (306)
Q Consensus       128 ~~~~~HPtQaL~---D~~Ti~e~~g~l~~~~i~~v  159 (306)
                      ||+..-|-|||-   |+|.=-+. -...|.+|+|+
T Consensus       307 GDNITPPqQAL~WI~dlY~~~~e-i~a~gQ~IVY~  340 (581)
T pfam11339       307 GDNITPPQQALNWIADLYADVEE-IRAHGQTIVYC  340 (581)
T ss_pred             CCCCCCCHHHHCCHHHHCCCHHH-HHHCCCEEEEE
T ss_conf             88899965775628876489999-98589879998


No 349
>PRK07791 short chain dehydrogenase; Provisional
Probab=21.26  E-value=42  Score=14.40  Aligned_cols=21  Identities=14%  Similarity=0.184  Sum_probs=15.7

Q ss_pred             CCCHHHCCCCCCEEEEEECHH
Q ss_conf             431010012331257652000
Q gi|255764473|r  166 LHSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       166 ~hS~i~~~~~~g~~v~~~~P~  186 (306)
                      .+|+..-+..+|..++-++|-
T Consensus       181 Tr~lA~Ela~~gIrVNaVaPg  201 (285)
T PRK07791        181 TLVAAAELGRYGVTVNAIAPA  201 (285)
T ss_pred             HHHHHHHHHHCCEEEEEECCC
T ss_conf             999999963129599998377


No 350
>cd01019 ZnuA Zinc binding protein ZnuA. These proteins have been shown to function as initial receptors in the ABC uptake of Zn2+.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism.  They are comprised of two globular subdomains connected by a single helix and bind their specific ligands in the cleft between these domains.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=21.22  E-value=52  Score=13.77  Aligned_cols=14  Identities=7%  Similarity=-0.092  Sum_probs=8.4

Q ss_pred             CCHHHCCCCCCEEE
Q ss_conf             31010012331257
Q gi|255764473|r  167 HSLIEGAARFNYLL  180 (306)
Q Consensus       167 hS~i~~~~~~g~~v  180 (306)
                      .++-..+.+||+++
T Consensus       187 ~af~Yfa~~ygl~~  200 (286)
T cd01019         187 DAYGYFEKRYGLTQ  200 (286)
T ss_pred             CCHHHHHHHCCCEE
T ss_conf             63689998669838


No 351
>PTZ00123 phosphoglycerate mutase I; Provisional
Probab=21.20  E-value=41  Score=14.48  Aligned_cols=51  Identities=10%  Similarity=0.144  Sum_probs=37.1

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCC
Q ss_conf             45899999999999999996652366654437987999942888357899998986347543
Q gi|255764473|r   12 SNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDT   73 (306)
Q Consensus        12 ~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~   73 (306)
                      .+||...+..--..+..+|+..-.           +-.+|-=+=.|+.-+-++....||-.-
T Consensus        13 v~Lt~~G~~qA~~ag~~Lk~~~~~-----------fd~~~TS~L~RA~~Ta~iIL~~l~~~~   63 (235)
T PTZ00123         13 VDLSEKGVQEAREAGELLKEEGFR-----------FDVVYTSVLKRAIKTANIVLETLNQLW   63 (235)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCC-----------CCEEEECCCHHHHHHHHHHHHHCCCCC
T ss_conf             995989999999999999975998-----------898985611999999999997305678


No 352
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=21.15  E-value=59  Score=13.44  Aligned_cols=117  Identities=14%  Similarity=0.049  Sum_probs=60.9

Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECC-CCHHHHHHCCCCCCEECCCCCC--
Q ss_conf             35789999898634754333321000012321079999975-3001011121013-2006776301244124043332--
Q gi|255764473|r   56 TRTRVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTN-HSRLLELTEYATVPVINALTDN--  131 (306)
Q Consensus        56 tRTR~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~-~~~~~~~~~~~~vpvINa~~~~--  131 (306)
                      ++--...|.++.+-|-+++..+.... .   |.-++..+.+ +..+|++++=... ...+..+ ...++|++-.+...  
T Consensus        18 ~~l~~gie~~~~~~Gy~lll~~~~~~-~---~~e~~~~~~l~~~~vdGiI~~~~~~~~~~~~l-~~~~~P~V~id~~~~~   92 (268)
T cd06277          18 SEIYRAIEEEAKKYGYNLILKFVSDE-D---EEEFELPSFLEDGKVDGIILLGGISTEYIKEI-KELGIPFVLVDHYIPN   92 (268)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCC-H---HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH-HHCCCCEEEECCCCCC
T ss_conf             99999999999984998999938999-8---99999999999489878999789997999999-9759989996776899


Q ss_pred             -CHHHHHHHHHHH----HHHHCCCCCCCCEEEECCCCC--CCCCH----HHCCCCCCE
Q ss_conf             -024678765576----642001336773046104555--54310----100123312
Q gi|255764473|r  132 -THPCQIIADIMT----FEEHRGSVKGKLFSWSGDGNN--ILHSL----IEGAARFNY  178 (306)
Q Consensus       132 -~HPtQaL~D~~T----i~e~~g~l~~~~i~~vGd~~~--v~hS~----i~~~~~~g~  178 (306)
                       .-| .+..|-+.    +-++.-..--.+|+++|....  ....+    ..++...|.
T Consensus        93 ~~~~-~V~~Dn~~a~~~a~~~L~~~Ghr~I~~i~~~~~~~~~~~R~~Gf~~al~~~gl  149 (268)
T cd06277          93 EKAD-CVLTDNYSGAYAATEYLIEKGHRKIGFVGDPLYSPSFEERYEGYKKALLDHGI  149 (268)
T ss_pred             CCCC-EEEECHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             9998-89966599999999999970998369972788881299999999999998599


No 353
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=21.06  E-value=59  Score=13.42  Aligned_cols=82  Identities=27%  Similarity=0.406  Sum_probs=41.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCHHHCCCCCCEE-EEEECHHCCCCCCCCHHHHHCCCCCCCCC---CC
Q ss_conf             678765576642001336773046104555543101001233125-76520000132100002432013322213---66
Q gi|255764473|r  135 CQIIADIMTFEEHRGSVKGKLFSWSGDGNNILHSLIEGAARFNYL-LNIATPIGSEPRNEYLNWARNQGASVALF---HD  210 (306)
Q Consensus       135 tQaL~D~~Ti~e~~g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~-v~~~~P~~~~~~~~~~~~~~~~g~~i~~~---~d  210 (306)
                      |..++-.+...+..+--.|.+|++.|.+ -+....+.++..+|.. +..+.+     .+.-++.+++.|....+.   .+
T Consensus       159 ~~~~~~~~~~~~~~~~~~g~~VlV~GaG-~iGl~a~~~ak~~Ga~~Vi~~d~-----~~~rl~~A~~lGa~~~i~~~~~~  232 (358)
T TIGR03451       159 CGVMAGLGAAVNTGGVKRGDSVAVIGCG-GVGDAAIAGAALAGASKIIAVDI-----DDRKLEWAREFGATHTVNSSGTD  232 (358)
T ss_pred             CCHHHHHHHHHHHCCCCCCCEEEEECCC-HHHHHHHHHHHHCCCCEEEEEEC-----CHHHHHHHHHCCCEEEECCCCCC
T ss_conf             2144546889864079999889996737-69999999999839918999919-----88999999965990997399878


Q ss_pred             HHHHCC------CCCCCC
Q ss_conf             466306------873322
Q gi|255764473|r  211 AVQAVK------GAHCVF  222 (306)
Q Consensus       211 ~~eal~------~aD~V~  222 (306)
                      +.+.++      ++|+|+
T Consensus       233 ~~~~v~~~t~g~G~Dvvi  250 (358)
T TIGR03451       233 PVEAIRALTGGFGADVVI  250 (358)
T ss_pred             HHHHHHHHHCCCCCCEEE
T ss_conf             899999985898874999


No 354
>KOG1191 consensus
Probab=21.05  E-value=59  Score=13.42  Aligned_cols=143  Identities=20%  Similarity=0.148  Sum_probs=65.0

Q ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCC-CCCC----------CCCCCCCCHHHHHHH---------HHHC-
Q ss_conf             437987999942888357899998986347543333-2100----------001232107999997---------5300-
Q gi|255764473|r   41 PLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFL-SGSE----------MQLGRAETIGDTAKV---------LSRY-   99 (306)
Q Consensus        41 ~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~-~~~~----------ss~~kgEsl~Dt~~~---------ls~~-   99 (306)
                      -+.|--++=++.+.|.-+-..+..|+..-|..-+-+ .+++          -++.+-|-+.|.+..         ++.. 
T Consensus       121 sFtgeD~~el~~hgs~avv~~~l~a~~~sg~~~ir~a~~geft~Raf~ngk~~Ltq~eg~~~lI~a~t~~q~~~Al~~v~  200 (531)
T KOG1191         121 SFTGEDVVELQTHGSSAVVVGVLTALGASGIPGIRLAEPGEFTRRAFLNGKLDLTQAEGIIDLIVAETESQRRAALDEVA  200 (531)
T ss_pred             EEEEEEEEEEEEECCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             23433258899834760013677776541677864358234543434415312555248234421102766544465413


Q ss_pred             C-C-EEEEEECCCCHHHHHHCCC--------CCCEECCCCC-CCHHHHHHH-HHHHHHHHCC---CC-CCCCEEEECCCC
Q ss_conf             1-0-1112101320067763012--------4412404333-202467876-5576642001---33-677304610455
Q gi|255764473|r  100 V-D-AIVMRTTNHSRLLELTEYA--------TVPVINALTD-NTHPCQIIA-DIMTFEEHRG---SV-KGKLFSWSGDGN  163 (306)
Q Consensus       100 ~-D-~iviR~~~~~~~~~~~~~~--------~vpvINa~~~-~~HPtQaL~-D~~Ti~e~~g---~l-~~~~i~~vGd~~  163 (306)
                      . + .+..++.  ..+.+.-...        ..|..--++. .-|-.|.|. |+.|..+...   .+ +|+.|+++|-+|
T Consensus       201 g~~~~l~~~~r--~~lIe~~a~l~a~idf~e~~~l~~~~t~~~~~~~~~l~d~v~s~l~~~~~~e~lq~gl~iaIvGrPN  278 (531)
T KOG1191         201 GEALALCFGWR--KILIEALAGLEARIDFEEERPLEEIETVEIFIESLSLLDDVLSHLNKADEIERLQSGLQIAIVGRPN  278 (531)
T ss_pred             CHHHHHHHHHH--HHHHHHHHCCCEEECHHHCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             31677665389--9999987322024144330755540300203678888999998887534677763577289976998


Q ss_pred             CCCCCHHHCCCCCCEEEEEECHHC
Q ss_conf             554310100123312576520000
Q gi|255764473|r  164 NILHSLIEGAARFNYLLNIATPIG  187 (306)
Q Consensus       164 ~v~hS~i~~~~~~g~~v~~~~P~~  187 (306)
                      -=.-|++.++.+  -++.+++|..
T Consensus       279 vGKSSLlNaL~~--~drsIVSpv~  300 (531)
T KOG1191         279 VGKSSLLNALSR--EDRSIVSPVP  300 (531)
T ss_pred             CCHHHHHHHHHC--CCCEEECCCC
T ss_conf             778899988750--7744767899


No 355
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=20.93  E-value=55  Score=13.63  Aligned_cols=15  Identities=20%  Similarity=0.062  Sum_probs=9.8

Q ss_pred             CCCEEEECCCCCCCCC
Q ss_conf             7730461045555431
Q gi|255764473|r  153 GKLFSWSGDGNNILHS  168 (306)
Q Consensus       153 ~~~i~~vGd~~~v~hS  168 (306)
                      ..+|+++|-+| |.-|
T Consensus       172 ~iriaivGrPN-vGKS  186 (429)
T TIGR03594       172 PIKIAIIGRPN-VGKS  186 (429)
T ss_pred             CEEEEEECCCC-CCHH
T ss_conf             52699974887-6546


No 356
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of TreR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding wh
Probab=20.91  E-value=59  Score=13.40  Aligned_cols=98  Identities=17%  Similarity=0.159  Sum_probs=51.5

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHCCCEEEEEECC-CCHHHHHHCCCCCCEECCCCC-CCHHH
Q ss_conf             89999898634754333321000012321079999975-3001011121013-200677630124412404333-20246
Q gi|255764473|r   59 RVSFEVAMKHLGGDTIFLSGSEMQLGRAETIGDTAKVL-SRYVDAIVMRTTN-HSRLLELTEYATVPVINALTD-NTHPC  135 (306)
Q Consensus        59 R~SFe~A~~~LG~~~~~~~~~~ss~~kgEsl~Dt~~~l-s~~~D~iviR~~~-~~~~~~~~~~~~vpvINa~~~-~~HPt  135 (306)
                      =-..|.++.+-|-+++..+...+ .   |.-.+..+.+ +..+|++++-... .....+..+..++||+--+.. ...||
T Consensus        18 ~~gie~~~~~~Gy~~ll~~s~~~-~---~~e~~~l~~l~~~~vDGiIl~~~~~~~~~~~~l~~~~iPvV~i~~~~~~~~~   93 (259)
T cd01542          18 VKGILAALYENGYQMLLMNTNFS-I---EKEIEALELLARQKVDGIILLATTITDEHREAIKKLNVPVVVVGQDYPGISS   93 (259)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCC-H---HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCCE
T ss_conf             99999999986998999978999-8---9999999999956999899937777759999999669999995986899988


Q ss_pred             HHHHHHHH----HHHHCCCCCCCCEEEECC
Q ss_conf             78765576----642001336773046104
Q gi|255764473|r  136 QIIADIMT----FEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus       136 QaL~D~~T----i~e~~g~l~~~~i~~vGd  161 (306)
                       +..|-+.    .-++.-..-..+|+++|.
T Consensus        94 -V~~Dn~~~~~~a~~~L~~~Ghr~I~~i~~  122 (259)
T cd01542          94 -VVYDDYGAGYELGEYLAQQGHKNIAYLGV  122 (259)
T ss_pred             -EEECHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             -99867999999999999828985999955


No 357
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]
Probab=20.83  E-value=60  Score=13.39  Aligned_cols=17  Identities=12%  Similarity=0.149  Sum_probs=6.9

Q ss_pred             HHHHHHHHCCCCCCCCC
Q ss_conf             99989863475433332
Q gi|255764473|r   61 SFEVAMKHLGGDTIFLS   77 (306)
Q Consensus        61 SFe~A~~~LG~~~~~~~   77 (306)
                      |--....++|..+...|
T Consensus        21 a~a~~L~~~G~~v~v~D   37 (448)
T COG0771          21 AAARFLLKLGAEVTVSD   37 (448)
T ss_pred             HHHHHHHHCCCEEEEEC
T ss_conf             99999997798699983


No 358
>KOG3042 consensus
Probab=20.82  E-value=60  Score=13.39  Aligned_cols=13  Identities=31%  Similarity=0.460  Sum_probs=7.3

Q ss_pred             CCCEEEEEECCCC
Q ss_conf             7987999942888
Q gi|255764473|r   43 SGKVLAMIFEKPS   55 (306)
Q Consensus        43 ~gk~i~~lF~e~S   55 (306)
                      ..++++.+|-+||
T Consensus        50 ~~~tVVSIfVNP~   62 (283)
T KOG3042          50 NTYTVVSIFVNPS   62 (283)
T ss_pred             CCEEEEEEEECHH
T ss_conf             7469999996624


No 359
>PRK08703 short chain dehydrogenase; Provisional
Probab=20.82  E-value=46  Score=14.13  Aligned_cols=15  Identities=27%  Similarity=0.275  Sum_probs=8.2

Q ss_pred             CCCCC-EEEEEECHHC
Q ss_conf             12331-2576520000
Q gi|255764473|r  173 AARFN-YLLNIATPIG  187 (306)
Q Consensus       173 ~~~~g-~~v~~~~P~~  187 (306)
                      ...+| .+++.++|-.
T Consensus       178 ~~~~g~IrVN~i~PG~  193 (239)
T PRK08703        178 WERFGNLRANVLVPGP  193 (239)
T ss_pred             HCCCCCEEEEEEEECC
T ss_conf             4789898999998488


No 360
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=20.66  E-value=47  Score=14.08  Aligned_cols=20  Identities=25%  Similarity=0.175  Sum_probs=11.5

Q ss_pred             CCHHHCCCCCCEEEEEECHH
Q ss_conf             31010012331257652000
Q gi|255764473|r  167 HSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       167 hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +|+..-+...|.+++.++|-
T Consensus       167 ~~lA~e~~~~gIrvN~V~PG  186 (248)
T PRK05557        167 KSLARELASRGITVNAVAPG  186 (248)
T ss_pred             HHHHHHHHHHCEEEEEEEEC
T ss_conf             99999853319499999748


No 361
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=20.61  E-value=50  Score=13.90  Aligned_cols=16  Identities=0%  Similarity=-0.211  Sum_probs=7.8

Q ss_pred             CHHHCCHHHHHHHHHH
Q ss_conf             8445899999999999
Q gi|255764473|r   10 DLSNISSSNLSCIIEV   25 (306)
Q Consensus        10 ~~~dl~~~~i~~ll~~   25 (306)
                      .+.|.+.+.++.-.+.
T Consensus        29 ~l~D~~~~~~~~~~~~   44 (284)
T PRK07819         29 LVFETTEEAATAGRNR   44 (284)
T ss_pred             EEEECCHHHHHHHHHH
T ss_conf             9997988999999999


No 362
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides. On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified in the literacture into three major branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases. Further sequence analysis reveals several new closely related, yet uncharacterized subgroups.
Probab=20.53  E-value=60  Score=13.35  Aligned_cols=31  Identities=16%  Similarity=0.356  Sum_probs=25.4

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             8771784458999999999999999966523
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSEN   35 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~   35 (306)
                      ++|+-++.|++.+++..++..++++...-.+
T Consensus        26 k~h~~~l~dl~~~~~~~l~~~~~~~~~~l~~   56 (86)
T cd00468          26 KRHVETLPDLDEALLADLVITAQRVAAELEK   56 (86)
T ss_pred             CHHHCCHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             2241993469999999999999999999997


No 363
>PRK06223 malate dehydrogenase; Reviewed
Probab=20.50  E-value=60  Score=13.35  Aligned_cols=39  Identities=23%  Similarity=0.258  Sum_probs=15.7

Q ss_pred             HHHHHHHHC-CCEEEEE--ECCCCHHHHHHCCCCCC---EECCCC
Q ss_conf             999975300-1011121--01320067763012441---240433
Q gi|255764473|r   91 DTAKVLSRY-VDAIVMR--TTNHSRLLELTEYATVP---VINALT  129 (306)
Q Consensus        91 Dt~~~ls~~-~D~iviR--~~~~~~~~~~~~~~~vp---vINa~~  129 (306)
                      +.+.-+..+ .+++++=  .|-+.....+.+.+..|   ||-.|+
T Consensus       100 ~i~~~i~~~~p~~iilvvsNPvDv~t~~~~k~sg~p~~rviG~gT  144 (312)
T PRK06223        100 DVGEGIKKYAPDAIVIVITNPVDAMTYVALKESGFPKERVIGMGG  144 (312)
T ss_pred             HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCHHHHCCCCH
T ss_conf             999999840998189993693689999999860999888114311


No 364
>PRK06721 threonine synthase; Reviewed
Probab=20.46  E-value=61  Score=13.34  Aligned_cols=105  Identities=14%  Similarity=0.195  Sum_probs=52.0

Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHCCCEEEEEECCCC---HHHHHHCCCCCCEE
Q ss_conf             942888357899998986347543333210-00012321079999975300101112101320---06776301244124
Q gi|255764473|r   50 IFEKPSTRTRVSFEVAMKHLGGDTIFLSGS-EMQLGRAETIGDTAKVLSRYVDAIVMRTTNHS---RLLELTEYATVPVI  125 (306)
Q Consensus        50 lF~e~StRTR~SFe~A~~~LG~~~~~~~~~-~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~---~~~~~~~~~~vpvI  125 (306)
                      +.+-+|-=|=.|...+|.++|.+++.+=+. ..+..|-      ..+......++.+...-+.   ...++++.....++
T Consensus        78 vv~aSsGN~g~alA~~aa~~G~~~~IvmP~~~~~~~Ki------~~~~~~GAevi~v~~~~~~~~~~~~~~~~~~~~~~~  151 (352)
T PRK06721         78 IICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKL------AQAVAYGAEIISIEGNFDDALKAVRNIAAEEPITLV  151 (352)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCHHHH------HHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCEEE
T ss_conf             99978567999999999984896699924776727799------999864986998089999999999999985498652


Q ss_pred             CCCCCCCHHHHHHHH---HHHHHHHCCCCCCCCEEEECCCCC
Q ss_conf             043332024678765---576642001336773046104555
Q gi|255764473|r  126 NALTDNTHPCQIIAD---IMTFEEHRGSVKGKLFSWSGDGNN  164 (306)
Q Consensus       126 Na~~~~~HPtQaL~D---~~Ti~e~~g~l~~~~i~~vGd~~~  164 (306)
                      |.-+    |-+.-.-   .+-|.|..+..-+.-++-+|.++.
T Consensus       152 ~~~n----p~~ieG~~Ti~~EI~eQl~~~pD~vv~pvG~Gg~  189 (352)
T PRK06721        152 NSVN----PYRIEGQKTAAFEICDQLQRAPDVLAIPVGNAGN  189 (352)
T ss_pred             CCCC----HHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHH
T ss_conf             2578----1666410437878999819999989991797099


No 365
>PRK07806 short chain dehydrogenase; Provisional
Probab=20.36  E-value=45  Score=14.20  Aligned_cols=14  Identities=7%  Similarity=-0.071  Sum_probs=7.1

Q ss_pred             CCCCCCEEEEEECH
Q ss_conf             01233125765200
Q gi|255764473|r  172 GAARFNYLLNIATP  185 (306)
Q Consensus       172 ~~~~~g~~v~~~~P  185 (306)
                      -+...|..++.++|
T Consensus       170 ela~~gIrvn~v~p  183 (248)
T PRK07806        170 ELAHAGIGFVVVSG  183 (248)
T ss_pred             HHHHHCCEEEEEEC
T ss_conf             97765988999727


No 366
>TIGR00433 bioB biotin synthase; InterPro: IPR002684   Biotin synthase 2.8.1.6 from EC works with flavodoxin, S-adenosylmethionine, and possibly cysteine to catalyze the last step of the biotin biosynthetic pathway. The reaction consists of the introduction of a sulphur atom into dethiobiotin, thus requiring activation of C-H bonds . Biotin (vitamin H) is a prosthetic group in enzymes catalysing carboxylation and transcarboxylation reactions .    Biotin synthase from Escherichia coli is a homodimer of 76 kDa, with each polypeptide chain carrying an oxygen-sensitive (4Fe-4S) cluster, probably ligated by three cysteines of a CXXXCXXC box conserved among all known BioB sequences and a fourth still not identified ligand. BioB displays a pyridoxal phosphate-dependent cysteine desulphurase activity, which allows mobilization of the sulphur atom from free cysteine .  ; GO: 0004076 biotin synthase activity, 0009102 biotin biosynthetic process.
Probab=20.29  E-value=61  Score=13.32  Aligned_cols=23  Identities=17%  Similarity=0.011  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99999999999999665236665
Q gi|255764473|r   17 SNLSCIIEVAKKIKNSSENIFEN   39 (306)
Q Consensus        17 ~~i~~ll~~A~~~k~~~~~~~~~   39 (306)
                      |++..|+-.|..+++.+..+..-
T Consensus         7 E~~l~Ll~~A~~~~r~~~~~~~v   29 (350)
T TIGR00433         7 EDLLDLLYEAFQIHRKHFNPRKV   29 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             13799999999999873374802


No 367
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems. Periplasmic binding domain of two-component sensor kinase signaling systems, some of which are fused with a C-terminal histidine kinase A domain (HisK) and/or a signal receiver domain (REC). Members of this group share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily and are predicted to be involved in sensing of environmental stimuli; their substrate specificities, however, are not known in detail.
Probab=20.25  E-value=61  Score=13.31  Aligned_cols=70  Identities=14%  Similarity=0.189  Sum_probs=40.5

Q ss_pred             HHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHH---HHHHCCCCCCEECCCCC
Q ss_conf             7899998986347-5433332100001232107999997530010111210132006---77630124412404333
Q gi|255764473|r   58 TRVSFEVAMKHLG-GDTIFLSGSEMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRL---LELTEYATVPVINALTD  130 (306)
Q Consensus        58 TR~SFe~A~~~LG-~~~~~~~~~~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~---~~~~~~~~vpvINa~~~  130 (306)
                      -.-.+|.++.++| -+++..+.... ..+-  ....-..++..+|+|++-..+...+   .+-+....+|||.-...
T Consensus        17 ~~~gie~~A~~~~g~~~~v~da~~d-~~~Q--~~~ie~li~~~vD~iiv~p~d~~~~~~~l~~a~~agIPVV~~d~~   90 (270)
T cd06308          17 MNDEIQREASNYPDVELIIADAADD-NSKQ--VADIENFIRQGVDLLIISPNEAAPLTPVVEEAYRAGIPVILLDRK   90 (270)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC-HHHH--HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCC
T ss_conf             9999999999759978999679899-9999--999999998499999996488520089999999859919994588


No 368
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional
Probab=20.18  E-value=61  Score=13.30  Aligned_cols=59  Identities=12%  Similarity=0.142  Sum_probs=34.5

Q ss_pred             HHHHHHHHHHHHHH--HCCCCCCCCEEEECCC----------------CCCCCCHHHCCCCCCEEEEEEC-HHCCCCC
Q ss_conf             24678765576642--0013367730461045----------------5554310100123312576520-0001321
Q gi|255764473|r  133 HPCQIIADIMTFEE--HRGSVKGKLFSWSGDG----------------NNILHSLIEGAARFNYLLNIAT-PIGSEPR  191 (306)
Q Consensus       133 HPtQaL~D~~Ti~e--~~g~l~~~~i~~vGd~----------------~~v~hS~i~~~~~~g~~v~~~~-P~~~~~~  191 (306)
                      .|.+.+.-+..+..  ..+.++|++|.+.+-+                +....++.+.+...|.+|++++ |..+.+|
T Consensus       235 ep~~Iv~~i~~~l~~~~~~~L~GkkVLITAGpT~E~IDPVR~IsN~SSGKmG~aiA~aa~~rGA~VtLIsGp~~l~~P  312 (476)
T PRK13982        235 EPLEIAAAAEALLRPPQPKPLAGRRVLITAGPTHEPIDPVRYIANRSSGKQGFAIAAAAAAAGAEVTLISGPVDLRDP  312 (476)
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             999999999998721455556798899966887122267455776685199999999999679979999566777789


No 369
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=20.13  E-value=48  Score=14.00  Aligned_cols=21  Identities=19%  Similarity=0.007  Sum_probs=13.1

Q ss_pred             CCHHHCCCCCCEEEEEECHHC
Q ss_conf             310100123312576520000
Q gi|255764473|r  167 HSLIEGAARFNYLLNIATPIG  187 (306)
Q Consensus       167 hS~i~~~~~~g~~v~~~~P~~  187 (306)
                      +|+..-+...|.+++-++|-.
T Consensus       170 k~lA~ela~~gIrVN~I~PG~  190 (261)
T PRK08936        170 ETLAMEYAPKGIRVNNIGPGA  190 (261)
T ss_pred             HHHHHHHHHHCEEEEEEEECC
T ss_conf             999999735395999997898


No 370
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=20.09  E-value=45  Score=14.16  Aligned_cols=20  Identities=15%  Similarity=0.061  Sum_probs=12.8

Q ss_pred             CCHHHCCCCCCEEEEEECHH
Q ss_conf             31010012331257652000
Q gi|255764473|r  167 HSLIEGAARFNYLLNIATPI  186 (306)
Q Consensus       167 hS~i~~~~~~g~~v~~~~P~  186 (306)
                      +++..-++++|..++.++|-
T Consensus       175 r~lA~ela~~gIrVN~I~PG  194 (259)
T PRK06124        175 RALAAEFGPHGITSNAIAPG  194 (259)
T ss_pred             HHHHHHHCCCCEEEEEEEEC
T ss_conf             99999965139799999758


No 371
>TIGR02025 BchH magnesium chelatase, H subunit; InterPro: IPR011771    This entry represents the H subunit of the magnesium chelatase complex responsible for magnesium insertion into the protoporphyrin IX ring in the biosynthesis of both chlorophyll and bacteriochlorophyll. In chlorophyll-utilizing species, this gene is known as ChlH, while in bacteriochlorophyll-utilizing spoecies it is called BchH. Subunit H is the largest (~140kDa) of the three subunits (the others being BchD/ChlD and BchI/ChlI), and is known to bind protoporphyrin IX. Subunit H is homologous to the CobN subunit of cobaltochelatase and by anology with that enzyme, subunit H is believed to also bind the magnesium ion which is inserted into the ring. In conjunction with the hydrolysis of ATP by subunits I and D, a conformation change is believed to happen in subunit H causing the magnesium ion insertion into the distorted protoporphyrin ring .; GO: 0016851 magnesium chelatase activity, 0015995 chlorophyll biosynthetic process.
Probab=20.09  E-value=55  Score=13.62  Aligned_cols=12  Identities=33%  Similarity=0.426  Sum_probs=4.4

Q ss_pred             CCCCHHHCCCCC
Q ss_conf             543101001233
Q gi|255764473|r  165 ILHSLIEGAARF  176 (306)
Q Consensus       165 v~hS~i~~~~~~  176 (306)
                      |++|+++++.+|
T Consensus       506 Vf~SL~~~L~~L  517 (1384)
T TIGR02025       506 VFESLYELLKRL  517 (1384)
T ss_pred             HHHHHHHHHHHH
T ss_conf             368999999998


No 372
>cd01018 ZntC Metal binding protein ZntC.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  They are comprised of two globular subdomains connected by a long alpha helix and bind their specific ligands in the cleft between these domains.  In addition, many of these proteins possess a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=20.02  E-value=51  Score=13.83  Aligned_cols=12  Identities=8%  Similarity=0.069  Sum_probs=5.9

Q ss_pred             CCCCCEEECCCC
Q ss_conf             898729925999
Q gi|255764473|r  254 AHPDALFMHCLP  265 (306)
Q Consensus       254 a~~~~~vmHplP  265 (306)
                      ++-....+.||=
T Consensus       239 tg~kv~~ldpL~  250 (266)
T cd01018         239 IGAKVVTIDPLA  250 (266)
T ss_pred             HCCCEEEECCCC
T ss_conf             099379967864


No 373
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs).
Probab=20.01  E-value=62  Score=13.28  Aligned_cols=100  Identities=13%  Similarity=0.167  Sum_probs=43.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCC------CCCCCCCCCCCCCCCHHHHH---HHHHHCCCEEEEEECCC----CH
Q ss_conf             7999942888357899998986347543------33321000012321079999---97530010111210132----00
Q gi|255764473|r   46 VLAMIFEKPSTRTRVSFEVAMKHLGGDT------IFLSGSEMQLGRAETIGDTA---KVLSRYVDAIVMRTTNH----SR  112 (306)
Q Consensus        46 ~i~~lF~e~StRTR~SFe~A~~~LG~~~------~~~~~~~ss~~kgEsl~Dt~---~~ls~~~D~iviR~~~~----~~  112 (306)
                      +|+-+|++.+----..|..|+.++..+.      ..+.+..-.+...-|++=+-   ..++..+  ..|=+|.+    ..
T Consensus         1 ~IG~iF~~~~~~~~~AF~~Av~~~N~~~~~~~~~~~L~~~i~~v~~~DsF~~~~~~C~ll~~GV--~AIfGpss~~s~~~   78 (372)
T cd06387           1 SIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGV--YAIFGFYDQMSMNT   78 (372)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHCCC--EEEECCCCHHHHHH
T ss_conf             9456606997789999999999852683235676066335676688981799999999875694--79987797778999


Q ss_pred             HHHHHCCCCCCEECCC-C--C------CCHHH--HHHHHHHHHHHH
Q ss_conf             6776301244124043-3--3------20246--787655766420
Q gi|255764473|r  113 LLELTEYATVPVINAL-T--D------NTHPC--QIIADIMTFEEH  147 (306)
Q Consensus       113 ~~~~~~~~~vpvINa~-~--~------~~HPt--QaL~D~~Ti~e~  147 (306)
                      +..+.....||.|..- .  .      .-||.  +|++|+.+-.++
T Consensus        79 vqSic~~l~IP~I~~~~p~~~~~~~~l~l~P~l~~A~~dlv~~~~W  124 (372)
T cd06387          79 LTSFCGALHTSFITPSFPTDADVQFVIQMRPALKGAILSLLAHYKW  124 (372)
T ss_pred             HHHHHCCCCCCCEECCCCCCCCCCEEEECCCCHHHHHHHHHHHCCC
T ss_conf             9997378888704614788878733685484278999999996798


Done!