HHsearch results for GI: 255764473 and protein with PDBid: 1gdh_A

>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1
Probab=95.85  E-value=0.025  Score=34.06  Aligned_cols=134  Identities=12%  Similarity=0.081  Sum_probs=80.1

Q ss_pred             HHHHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHHH------------C----------CCCCCCCEEEECCCCCCCC
Q ss_conf             067763012441240433320246--787655766420------------0----------1336773046104555543
Q gi|255764473|r  112 RLLELTEYATVPVINALTDNTHPC--QIIADIMTFEEH------------R----------GSVKGKLFSWSGDGNNILH  167 (306)
Q Consensus       112 ~~~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e~------------~----------g~l~~~~i~~vGd~~~v~h  167 (306)
                      .-.+.+....++|-|+.+....|.  .+++=++.+.++            +          ..+.|+++.++|-+ ++..
T Consensus        81 id~~~~~~~gI~v~n~~~~~~~~vAE~~l~l~l~~~R~i~~~~~~~~~~~~~~~~~~~~~g~~l~gk~vgIiG~G-~IG~  159 (320)
T 1gdh_A           81 IDLDACKARGIKVGNAPHGVTVATAEIAMLLLLGSARRAGEGEKMIRTRSWPGWEPLELVGEKLDNKTLGIYGFG-SIGQ  159 (320)
T ss_dssp             BCHHHHHHTTCEEECCCCSCHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCCTTTTCBCCCTTCEEEEECCS-HHHH
T ss_pred             HCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCEEEEEEEC-HHHH
T ss_conf             269999977999997899671999999999999975234666554432124655433425426259889998166-6999


Q ss_pred             CHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCC
Q ss_conf             10100123312576520000132100002432013322213664663068733222100000022013331001112336
Q gi|255764473|r  168 SLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVN  247 (306)
Q Consensus       168 S~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~  247 (306)
                      .....+..||+++....|.......+       .........++++.++.+|+|..-.  ....+         ..-.+|
T Consensus       160 ~va~~l~~fg~~V~~~~~~~~~~~~~-------~~~~~~~~~~l~~ll~~~D~v~~~~--plt~~---------T~~li~  221 (320)
T 1gdh_A          160 ALAKRAQGFDMDIDYFDTHRASSSDE-------ASYQATFHDSLDSLLSVSQFFSLNA--PSTPE---------TRYFFN  221 (320)
T ss_dssp             HHHHHHHTTTCEEEEECSSCCCHHHH-------HHHTCEECSSHHHHHHHCSEEEECC--CCCTT---------TTTCBS
T ss_pred             HHHHHHHHCCCEEEEECCCCCCHHHH-------HHCCCEECCCHHHHHHCCCEEEECC--CCCHH---------HHHEEC
T ss_conf             99999874287688866877754555-------3126332377999962399899868--99826---------642118


Q ss_pred             HHHHHCCCCCCEEECCC
Q ss_conf             88996289872992599
Q gi|255764473|r  248 LSLMSMAHPDALFMHCL  264 (306)
Q Consensus       248 ~~~l~~a~~~~~vmHpl  264 (306)
                      .+.++.+|+++++.-.+
T Consensus       222 ~~~l~~mk~~a~liN~~  238 (320)
T 1gdh_A          222 KATIKSLPQGAIVVNTA  238 (320)
T ss_dssp             HHHHTTSCTTEEEEECS
T ss_pred             HHHHHHCCCCEEEEECC
T ss_conf             99994377537999757