HHsearch results for GI: 255764473 and protein with PDBid: 1ml4_A

>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1
Probab=100.00  E-value=0  Score=643.18  Aligned_cols=303  Identities=26%  Similarity=0.372  Sum_probs=286.3

Q ss_pred             CC-CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCC-CCC
Q ss_conf             98-8877178445899999999999999996652366654437987999942888357899998986347543333-210
Q gi|255764473|r    2 MT-YPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFL-SGS   79 (306)
Q Consensus         2 m~-~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~-~~~   79 (306)
                      |+ .+||||+++||++++|..||++|.++|+.++++...++|+||+++++|+|||||||+|||+|+++|||+++++ ++.
T Consensus         1 m~~~~r~~L~i~dls~~ei~~ll~~A~~lk~~~~~~~~~~~l~gk~v~llF~~pStRTR~SFe~A~~~LGg~~i~~~~~~   80 (308)
T 1ml4_A            1 MDWKGRDVISIRDFSKEDIETVLATAERLERELKEKGQLEYAKGKILATLFFEPSTRTRLSFESAMHRLGGAVIGFAEAS   80 (308)
T ss_dssp             -CCTTCCBCCGGGCCHHHHHHHHHHHHHHHHHHHHHSSCCTTTTCEEEEEESSCCSHHHHHHHHHHHHTTCEEEEESCGG
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCC
T ss_conf             98999885650018999999999999999987760688776799889998348975378999999997599278667853


Q ss_pred             CCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCC-CCHHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             000123210799999753001011121013200677630124412404333-2024678765576642001336773046
Q gi|255764473|r   80 EMQLGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTD-NTHPCQIIADIMTFEEHRGSVKGKLFSW  158 (306)
Q Consensus        80 ~ss~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~~~i~~  158 (306)
                      .|+++||||++||++++|+|+|++|+|++++..+.++++++++||||||++ ++||||+|+|+|||+|++|.++|+||+|
T Consensus        81 ~~~~~~~Es~~Dta~vls~~~D~iviR~~~~~~~~~~a~~~~vPVINAg~~~~~HPtQ~L~Dl~Ti~e~~g~l~glki~~  160 (308)
T 1ml4_A           81 TSSVKKGESLRDTIKTVEQYCDVIVIRHPKEGAARLAAEVAEVPVINAGDGSNQHPTQTLLDLYTIKKEFGRIDGLKIGL  160 (308)
T ss_dssp             GSGGGGTCCHHHHHHHHTTTCSEEEEEESSTTHHHHHHHTCSSCEEEEEETTSCCHHHHHHHHHHHHHHSSCSSSEEEEE
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCEEEEEECHHHHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             12157875099999875314855999723000589987558976775777987680789986861756338835777986


Q ss_pred             ECCC--CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHH
Q ss_conf             1045--55543101001233125765200001321000024320133222136646630687332221000000220133
Q gi|255764473|r  159 SGDG--NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR  236 (306)
Q Consensus       159 vGd~--~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~  236 (306)
                      +||.  +||+||++++++++|+++++++|+++.+++...+.++..+..+.+++|+++++.++|+||+++|++++.+...+
T Consensus       161 vGd~~~~~v~~S~~~~~~~~g~~~~~~~P~~~~~~~~~~~~~~~~~~~~~~~~d~~ea~~~aDvv~~~~~~~~~~~~~~~  240 (308)
T 1ml4_A          161 LGDLKYGRTVHSLAEALTFYDVELYLISPELLRMPRHIVEELREKGMKVVETTTLEDVIGKLDVLYVTRIQKERFPDEQE  240 (308)
T ss_dssp             ESCTTTCHHHHHHHHHGGGSCEEEEEECCGGGCCCHHHHHHHHHTTCCEEEESCTHHHHTTCSEEEECCCCGGGSSSHHH
T ss_pred             ECCCCCCHHHHHHHHHHHHCCCEEEEECCHHHCCCHHHHHHHHHCCCCEEECCCHHHHHCCCCEEECCEECCCCCCHHHH
T ss_conf             45876441288899999876983999796475487889999997198302128989963057522022002344525899


Q ss_pred             HHHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             3100111233688996289872992599987487357679679971068687755999999999962559
Q gi|255764473|r  237 EEHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFGII  306 (306)
Q Consensus       237 ~~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG~~  306 (306)
                      ..+++.+||||.++|+.++++++||||||  ||+||+++|+|+|+|++|+||+||+|+|||||+|+||+|
T Consensus       241 ~~~~~~~~~v~~~~l~~a~~~~i~mHcLP--Rg~Ei~~~v~d~~~s~v~~QaeNrl~v~~AlL~~llG~i  308 (308)
T 1ml4_A          241 YLKVKGSYQVNLKVLEKAKDELRIMHPLP--RVDEIHPEVDNTKHAIYFRQVFNGVPVRMALLALVLGVI  308 (308)
T ss_dssp             HHTTTTCCCBCTTGGGGSCTTCEEECCSC--CSSSBCGGGGGSTTBCHHHHHHTHHHHHHHHHHHHHTCC
T ss_pred             HHHHHCCCCCCHHHHHHCCCCCEEECCCC--CCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99985066579999971699989969999--976124866578745799999721999999999986769