HHsearch results for GI: 255764473 and protein with PDBid: 2cuk_A

>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8}
Probab=94.55  E-value=0.15  Score=28.92  Aligned_cols=89  Identities=16%  Similarity=0.140  Sum_probs=55.9

Q ss_pred             CCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEEC
Q ss_conf             33677304610455554310100123312576520000132100002432013322213664663068733222100000
Q gi|255764473|r  150 SVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISM  229 (306)
Q Consensus       150 ~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~  229 (306)
                      .+.|+++.++|-+ ++.......+..||+++....|..-           ..+   ....++++.++.+|+|..-.  ..
T Consensus       141 ~l~gk~vgIiG~G-~IG~~~a~~l~~fg~~v~~~~~~~~-----------~~~---~~~~~l~ell~~sDiv~~~~--pl  203 (311)
T 2cuk_A          141 DLQGLTLGLVGMG-RIGQAVAKRALAFGMRVVYHARTPK-----------PLP---YPFLSLEELLKEADVVSLHT--PL  203 (311)
T ss_dssp             CCTTCEEEEECCS-HHHHHHHHHHHHTTCEEEEECSSCC-----------SSS---SCBCCHHHHHHHCSEEEECC--CC
T ss_pred             CCCCCEEEEEEEC-HHHHHHHHHHHHCCCEEEEECCCCC-----------CCC---CCCCCHHHHHHHCCEEEECC--CC
T ss_conf             2469989998078-8999999999858998999889844-----------468---76679999997699999938--89


Q ss_pred             CCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCC
Q ss_conf             02201333100111233688996289872992599
Q gi|255764473|r  230 NQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCL  264 (306)
Q Consensus       230 ~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHpl  264 (306)
                      ..+         ....++.+.++.+|+++++.-..
T Consensus       204 t~~---------t~~li~~~~l~~mk~~a~liN~~  229 (311)
T 2cuk_A          204 TPE---------THRLLNRERLFAMKRGAILLNTA  229 (311)
T ss_dssp             CTT---------TTTCBCHHHHTTSCTTCEEEECS
T ss_pred             CHH---------HCCCCCHHHHHHCCCCEEEEECC
T ss_conf             847---------62774899997419984999778