HHsearch results for GI: 255764473 and protein with PDBid: 2w2k_A

>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B
Probab=93.09  E-value=0.31  Score=26.93  Aligned_cols=132  Identities=11%  Similarity=0.139  Sum_probs=72.8

Q ss_pred             HHHHCCCCCCEECCCCCCCHHHH--HHHHHHHHHHH--------------------------CCCCCCCCEEEECCCCCC
Q ss_conf             77630124412404333202467--87655766420--------------------------013367730461045555
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHPCQ--IIADIMTFEEH--------------------------RGSVKGKLFSWSGDGNNI  165 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HPtQ--aL~D~~Ti~e~--------------------------~g~l~~~~i~~vGd~~~v  165 (306)
                      .+.++.-.|+|.|+-+....++=  +|+=++.+.+.                          -..+.|+++.++|-++ +
T Consensus        96 ~~~~~~~gI~v~n~~~~~~~~VAE~~l~liL~~~R~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~l~g~tvGIiG~G~-I  174 (348)
T 2w2k_A           96 LDALNERGVAFANSRGAGDTATSDLALYLILSVFRLASYSERAARTGDPETFNRVHLEIGKSAHNPRGHVLGAVGLGA-I  174 (348)
T ss_dssp             HHHHHHTTCEEECCTTTTHHHHHHHHHHHHHHHHHTHHHHHHHHTTCCHHHHHHHHHHHHTTCCCSTTCEEEEECCSH-H
T ss_pred             HHHHHHCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCCHHHHCCCCCCCCCCCCEEEEECCCC-C
T ss_conf             999986993899789878347999999999985311156666644166432320100035443345466899978666-3


Q ss_pred             CCCHHHCCCC-CCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCC
Q ss_conf             4310100123-312576520000132100002432013322213664663068733222100000022013331001112
Q gi|255764473|r  166 LHSLIEGAAR-FNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPF  244 (306)
Q Consensus       166 ~hS~i~~~~~-~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y  244 (306)
                      .......+.. +|+++....+....+..+     ..  .......++++.++.+|+|..-.  ....+         ...
T Consensus       175 G~~~a~~~~~~~g~~v~~~~~~~~~~~~~-----~~--~~~~~~~~l~~ll~~sDiv~l~~--plt~~---------T~~  236 (348)
T 2w2k_A          175 QKEIARKAVHGLGMKLVYYDVAPADAETE-----KA--LGAERVDSLEELARRSDCVSVSV--PYMKL---------THH  236 (348)
T ss_dssp             HHHHHHHHHHTTCCEEEEECSSCCCHHHH-----HH--HTCEECSSHHHHHHHCSEEEECC--CCSGG---------GTT
T ss_pred             CHHHHHHHHHCCCEEEEEECCCCCCCHHH-----HC--CCCEEECCHHHHHHHCCEEEEEC--CCCCC---------HHH
T ss_conf             16767767742660799964741000124-----30--37455267999963177555506--78522---------055


Q ss_pred             CCCHHHHHCCCCCCEEECCC
Q ss_conf             33688996289872992599
Q gi|255764473|r  245 QVNLSLMSMAHPDALFMHCL  264 (306)
Q Consensus       245 ~i~~~~l~~a~~~~~vmHpl  264 (306)
                      -++.+.++.+|+++++--..
T Consensus       237 li~~~~l~~mk~ga~lIN~a  256 (348)
T 2w2k_A          237 LIDEAFFAAMKPGSRIVNTA  256 (348)
T ss_dssp             CBCHHHHHHSCTTEEEEECS
T ss_pred             HHHHHHHHHHCCCCEEEEEC
T ss_conf             77776865403685689713