HHsearch results for GI: 255764473 and protein with PDBid: 3d4o_A

>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE TAR; 2.10A {Bacillus halodurans}
Probab=95.49  E-value=0.027  Score=33.89  Aligned_cols=94  Identities=11%  Similarity=0.132  Sum_probs=70.4

Q ss_pred             CCCCCCCEEEECCCCCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEE
Q ss_conf             13367730461045555431010012331257652000013210000243201332221366466306873322210000
Q gi|255764473|r  149 GSVKGKLFSWSGDGNNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWIS  228 (306)
Q Consensus       149 g~l~~~~i~~vGd~~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~  228 (306)
                      ..+.|.+++++|-+ ++....+..+..+|+++.++....     .....++..|.++..+.++.+.++++|+|+...   
T Consensus       151 ~~l~g~~v~i~G~G-~~g~~~~~~~~~~g~~v~v~~r~~-----~~~~~~~~~g~~~~~~~~l~~~~~~aDvvi~~~---  221 (293)
T 3d4o_A          151 FTIHGANVAVLGLG-RVGMSVARKFAALGAKVKVGARES-----DLLARIAEMGMEPFHISKAAQELRDVDVCINTI---  221 (293)
T ss_dssp             SCSTTCEEEEECCS-HHHHHHHHHHHHTTCEEEEEESSH-----HHHHHHHHTTSEEEEGGGHHHHTTTCSEEEECC---
T ss_pred             CCCCCCEEEEECCC-HHHHHHHHHHHHCCCEEEEEECCC-----CHHHHHHHCCCEEEECCHHHHHHCCCCEEEECC---
T ss_conf             35478789998888-899999999997699799995773-----008999851883485330677757699999899---


Q ss_pred             CCCCCHHHHHHCCCCCCCCHHHHHCCCCCCEEECCC
Q ss_conf             002201333100111233688996289872992599
Q gi|255764473|r  229 MNQEFKAREEHVFQPFQVNLSLMSMAHPDALFMHCL  264 (306)
Q Consensus       229 ~~~~~~~~~~~~~~~y~i~~~~l~~a~~~~~vmHpl  264 (306)
                            +       ..-++.+.++..++++++.--.
T Consensus       222 ------p-------~~~i~~~~l~~~~~gaviiDva  244 (293)
T 3d4o_A          222 ------P-------ALVVTANVLAEMPSHTFVIDLA  244 (293)
T ss_dssp             ------S-------SCCBCHHHHHHSCTTCEEEECS
T ss_pred             ------C-------CCCCCHHHHHHCCCCCEEEEEC
T ss_conf             ------9-------8758899997289997999948