HHsearch results for GI: 255764473 and protein with PDBid: 3d6n_B

>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal- binding, pyrimidine biosynthesis, zinc; HET: FLC; 2.30A {Aquifex aeolicus}
Probab=100.00  E-value=0  Score=591.04  Aligned_cols=283  Identities=25%  Similarity=0.335  Sum_probs=257.2

Q ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87717844589999999999999999665236665443798799994288835789999898634754333321000012
Q gi|255764473|r    5 PKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQLG   84 (306)
Q Consensus         5 ~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss~~   84 (306)
                      |||||++.||++++|+.||++|.++|+.+.      ...+|+++++|+|||||||+|||+|+++|||+++++++.+||++
T Consensus         1 Mr~~l~~~dls~~ei~~ll~~A~~lk~~~~------~~~~k~~~llF~kpSTRTR~SFe~A~~~LGg~~i~l~~~~~~~~   74 (291)
T 3d6n_B            1 MRSLISSLDLTREEVEEILKYAKEFKEGKE------ETIKASAVLFFSEPSTRTRLSFEKAARELGIETYLVSGSESSTV   74 (291)
T ss_dssp             CCCBCCGGGCCHHHHHHHHHHHHHHHTTCC------CCCCCEEEEEESSCCHHHHHHHHHHHHHTTCEEEEEETTTTSCC
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHCCH------HCCCCEEEEEEECCCCCHHHHHHHHHHHCCCCEEECCCCCCCCC
T ss_conf             987277022999999999999999972620------03687389998089743899999999986998896771111266


Q ss_pred             CCCCHHHHHHHHHHC-CCEEEEEEC-CCCHHHHHHCCCCCCEECCCCC-CCHHHHHHHHHHHHHHHCCCCCCCCEEEECC
Q ss_conf             321079999975300-101112101-3200677630124412404333-2024678765576642001336773046104
Q gi|255764473|r   85 RAETIGDTAKVLSRY-VDAIVMRTT-NHSRLLELTEYATVPVINALTD-NTHPCQIIADIMTFEEHRGSVKGKLFSWSGD  161 (306)
Q Consensus        85 kgEsl~Dt~~~ls~~-~D~iviR~~-~~~~~~~~~~~~~vpvINa~~~-~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd  161 (306)
                      ||||++||+++++.| +|++|+||+ ++..+.++++++++||||||+| ++||||+|+|+|||+|++|.++|++|+|+||
T Consensus        75 kgEs~~Dt~~vls~~~~d~iv~R~~~~~~~~~~~a~~~~vpVINag~~~~~HPtQaLaDl~Ti~e~~g~l~~l~i~~vGD  154 (291)
T 3d6n_B           75 KGESFFDTLKTFEGLGFDYVVFRVPFVFFPYKEIVKSLNLRLVNAGDGTHQHPSQGLIDFFTIKEHFGEVKDLRVLYVGD  154 (291)
T ss_dssp             TTCCHHHHHHHHHHTTCSEEEEEESSCCCSCHHHHHTCSSEEEEEEETTTBCHHHHHHHHHHHHHHHSCCTTCEEEEESC
T ss_pred             CCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             78748899997532464389982454420089997327977898888977683789987989999839877865999946


Q ss_pred             C--CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCH--HHH
Q ss_conf             5--555431010012331257652000013210000243201332221366466306873322210000002201--333
Q gi|255764473|r  162 G--NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFK--ARE  237 (306)
Q Consensus       162 ~--~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~--~~~  237 (306)
                      .  +||+||++.++.++|+++.+++|+++.|...       ...++.+++|+.++++++|+||+++|+++++...  ...
T Consensus       155 ~~~~~v~~S~~~~~~~~g~~~~~~~P~~~~p~~~-------~~~~i~~~~d~~~ai~~aDvv~~~~~~~~~~~~~~~~~~  227 (291)
T 3d6n_B          155 IKHSRVFRSGAPLLNMFGAKIGVCGPKTLIPRDV-------EVFKVDVFDDVDKGIDWADVVIWLRLQKERQKENYIPSE  227 (291)
T ss_dssp             CTTCHHHHHHHHHHHHTTCEEEEESCGGGSCTTG-------GGGCEEEESSHHHHHHHCSEEEECCCCTHHHHTTSSSCH
T ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCHHHCCCCH-------HHCCEEEECCHHHHHHHCCEEEECCCCCCCCHHHHHHHH
T ss_conf             8766899999999985699899989524374653-------027748977999998548999982444620105566777


Q ss_pred             HHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             100111233688996289872992599987487357679679971068687755999999999962
Q gi|255764473|r  238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCF  303 (306)
Q Consensus       238 ~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~l  303 (306)
                      ..++.+||+|.++++++   ++||||||++||.||+++|+++|+|+||+||+||+|+|||||+|++
T Consensus       228 ~~~~~~~~v~~~~~~~~---~i~mHcLPa~Rg~Ei~~~V~~~~~s~v~~QaeNrl~~~~AlL~~L~  290 (291)
T 3d6n_B          228 SSYFKQFGLTKERFEKV---KLYMHPGPVNRNVDIDHELVYTEKSLIQEQVKNGIPVRKAIYKFLW  290 (291)
T ss_dssp             HHHHHHHSBCHHHHTTC---CCEECSSCCCBTTTBCGGGSSSTTBCHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHCCCC---CEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHCCHHHHHHHHHHHH
T ss_conf             66788888889865789---9894899999888679768369855799999711999999999986