HHsearch results for GI: 255764473 and protein with PDBid: 3gd5_A

>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis; 2.10A {Gloeobacter violaceus pcc 7421}
Probab=100.00  E-value=0  Score=640.81  Aligned_cols=298  Identities=44%  Similarity=0.760  Sum_probs=279.3

Q ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             88877178445899999999999999996652366654437987999942888357899998986347543333210000
Q gi|255764473|r    3 TYPKHFADLSNISSSNLSCIIEVAKKIKNSSENIFENKPLSGKVLAMIFEKPSTRTRVSFEVAMKHLGGDTIFLSGSEMQ   82 (306)
Q Consensus         3 ~~~k~~l~~~dl~~~~i~~ll~~A~~~k~~~~~~~~~~~l~gk~i~~lF~e~StRTR~SFe~A~~~LG~~~~~~~~~~ss   82 (306)
                      .++||||+++||++++|..||++|.++|+.+    ....|+||+++++|||||||||+|||+|+++|||+++++++.+||
T Consensus        11 ~~~k~ll~i~dls~~ei~~ll~~A~~lk~~~----~~~~L~gK~v~llF~epSTRTR~SFe~A~~~LGg~vi~~~~~~ss   86 (323)
T 3gd5_A           11 RFRPDLLSLDDLDEAQLHALLTLAHQLKRGE----RVANLHGKVLGLVFLKASTRTRVSFTVAMYQLGGQVIDLSPSNTQ   86 (323)
T ss_dssp             CCCSCBSSGGGSCHHHHHHHHHHHHHHHHTS----SCCCCTTCEEEEEESSCCHHHHHHHHHHHHHTTCEEEEC------
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHCCC----CCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCCCC
T ss_conf             6688874222189999999999999987367----677789998999966897116999999999859919963542244


Q ss_pred             CCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCC
Q ss_conf             12321079999975300101112101320067763012441240433320246787655766420013367730461045
Q gi|255764473|r   83 LGRAETIGDTAKVLSRYVDAIVMRTTNHSRLLELTEYATVPVINALTDNTHPCQIIADIMTFEEHRGSVKGKLFSWSGDG  162 (306)
Q Consensus        83 ~~kgEsl~Dt~~~ls~~~D~iviR~~~~~~~~~~~~~~~vpvINa~~~~~HPtQaL~D~~Ti~e~~g~l~~~~i~~vGd~  162 (306)
                      +.||||++||++++++|+|++|+||+.++.+.++++++++||||||++++||||+|+|+|||+|++|.++|++|+|+||+
T Consensus        87 ~~kgEs~~Dt~~~ls~~~d~iv~R~~~~~~~~~~a~~s~vPVINag~~~~HPtQaLlDl~Ti~e~~g~l~gl~i~~vGd~  166 (323)
T 3gd5_A           87 VGRGEPVRDTARVLGRYVDGLAIRTFAQTELEEYAHYAGIPVINALTDHEHPCQVVADLLTIRENFGRLAGLKLAYVGDG  166 (323)
T ss_dssp             ----CCHHHHHHHHTTTCSEEEEECSSHHHHHHHHHHHCSCEEEEECSSCCHHHHHHHHHHHHHHHSCCTTCEEEEESCC
T ss_pred             CCCCCCHHHHHHHHHCCCHHHHEECCHHHHHHHHHHCCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             57763037799998522114321000056799985217977685888741689999889999998587468879997886


Q ss_pred             CCCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHH----HCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHH-H
Q ss_conf             555431010012331257652000013210000243----20133222136646630687332221000000220133-3
Q gi|255764473|r  163 NNILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWA----RNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAR-E  237 (306)
Q Consensus       163 ~~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~----~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~-~  237 (306)
                      +||+||++.+++++|+.+.+++|+++.+.+......    ...|.++.+++|+.++++++|+||+++|++++.+.... .
T Consensus       167 ~~v~~S~~~~~~~~g~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~i~~~~d~~ea~~~aDviyt~~~~~~~~~~~~~~~  246 (323)
T 3gd5_A          167 NNVAHSLLLGCAKVGMSIAVATPEGFTPDPAVSARASEIAGRTGAEVQILRDPFEAARGAHILYTDVWTSMGQEAETQHR  246 (323)
T ss_dssp             CHHHHHHHHHHHHHTCEEEEECCTTCCCCHHHHHHHHHHHHHHTCCEEEESCHHHHHTTCSEEEECCCC---------CC
T ss_pred             CCCCCCHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEECCCHHHHHCCCCEEEEEHHHHHCCCHHHHHH
T ss_conf             55345599998646980899738766887899999999876338810002789999557987663113231010334568


Q ss_pred             HHCCCCCCCCHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             1001112336889962898729925999874873576796799710686877559999999999625
Q gi|255764473|r  238 EHVFQPFQVNLSLMSMAHPDALFMHCLPAHRGEEVINEVLDGPQSVVFDEAENRLHTQKAILLWCFG  304 (306)
Q Consensus       238 ~~~~~~y~i~~~~l~~a~~~~~vmHplP~~rg~EI~~~v~d~~~s~~~~Qa~Ngl~vr~AiL~~~lG  304 (306)
                      .+++.+||||.++|++++++++||||||+|||+||+++|+|+|+|+||+||+||+|+|||||+|+||
T Consensus       247 ~~~~~~y~vt~~~l~~a~~~~i~MHplP~~Rg~EI~~~V~d~~~s~~~~Qa~Ngl~vr~AlL~~llg  313 (323)
T 3gd5_A          247 LQLFEQYQINAALLNCAAAEAIVLHCLPAHRGEEITDEVMEGPRSRIWDEAENRLHAQKAVLAALMG  313 (323)
T ss_dssp             HHHHTTCCBCHHHHHTSCTTCEEEECSCCCBTTTBCHHHHHSTTBCHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHCCCCCHHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             8764000252999953798989989899988853487886599867999997119999999999977