HHsearch results for GI: 255764473 and protein with PDBid: 3gg9_A

>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum}
Probab=92.79  E-value=0.17  Score=28.65  Aligned_cols=131  Identities=17%  Similarity=0.149  Sum_probs=73.2

Q ss_pred             HHHHCCCCCCEECCCCCCCHH-HHHHHHHHHHHHHC-----------------------------CCCCCCCEEEECCCC
Q ss_conf             776301244124043332024-67876557664200-----------------------------133677304610455
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHP-CQIIADIMTFEEHR-----------------------------GSVKGKLFSWSGDGN  163 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HP-tQaL~D~~Ti~e~~-----------------------------g~l~~~~i~~vGd~~  163 (306)
                      .+.++...+.|.|+.+...-. -.+++=++++.+..                             ..+.|+++.++|- +
T Consensus        91 l~~~~~~gI~v~n~~g~~~avAE~~~~lil~l~r~i~~~~~~~~~g~~~~~~~~~~~~~~~~~~g~~L~gk~vgIiG~-G  169 (352)
T 3gg9_A           91 LEACTDKGVVVLEGKGSPVAPAELTWALVMAAQRRIPQYVASLKHGAWQQSGLKSTTMPPNFGIGRVLKGQTLGIFGY-G  169 (352)
T ss_dssp             HHHHHHHTCEEECCCCCSHHHHHHHHHHHHHHHTTHHHHHHHHHTTCTTCCCCCCTTSCTTTTSBCCCTTCEEEEECC-S
T ss_pred             HHHHHHCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEECCCEEEEEEE-C
T ss_conf             999986999998789987506899999999986557787777423752224543333575555564235989999966-6


Q ss_pred             CCCCCHHHCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCC
Q ss_conf             55431010012331257652000013210000243201332221366466306873322210000002201333100111
Q gi|255764473|r  164 NILHSLIEGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQP  243 (306)
Q Consensus       164 ~v~hS~i~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~  243 (306)
                      ++.....+.+.-||+++....|....+..      ..  ..+....++++.++.+|+|..-.  ....+         ..
T Consensus       170 ~IG~~va~~l~~fg~~v~~~d~~~~~~~~------~~--~~~~~~~~l~~ll~~sDiv~~~~--Plt~~---------T~  230 (352)
T 3gg9_A          170 KIGQLVAGYGRAFGMNVLVWGRENSKERA------RA--DGFAVAESKDALFEQSDVLSVHL--RLNDE---------TR  230 (352)
T ss_dssp             HHHHHHHHHHHHTTCEEEEECSHHHHHHH------HH--TTCEECSSHHHHHHHCSEEEECC--CCSTT---------TT
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHH------HH--HCCCCCCCHHHCCCCCCEECCCC--CCCHH---------HH
T ss_conf             89999999975279777631688315555------43--01210134111234454111346--78766---------63


Q ss_pred             CCCCHHHHHCCCCCCEEECCC
Q ss_conf             233688996289872992599
Q gi|255764473|r  244 FQVNLSLMSMAHPDALFMHCL  264 (306)
Q Consensus       244 y~i~~~~l~~a~~~~~vmHpl  264 (306)
                      -.+|.+.++.+|+++++--..
T Consensus       231 ~li~~~~~~~mk~ga~lIN~s  251 (352)
T 3gg9_A          231 SIITVADLTRMKPTALFVNTS  251 (352)
T ss_dssp             TCBCHHHHTTSCTTCEEEECS
T ss_pred             HHHHHHHHHHCCCCEEEEEEC
T ss_conf             576799986318851799714