HHsearch results for GI: 255764473 and protein with PDBid: 3jtm_A

>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A
Probab=96.58  E-value=0.01  Score=36.62  Aligned_cols=132  Identities=14%  Similarity=0.181  Sum_probs=77.2

Q ss_pred             HHHHCCCCCCEECCCCCCCHHH--HHHHHHHHHHH--------------------HCC-CCCCCCEEEECCCCCCCCCHH
Q ss_conf             7763012441240433320246--78765576642--------------------001-336773046104555543101
Q gi|255764473|r  114 LELTEYATVPVINALTDNTHPC--QIIADIMTFEE--------------------HRG-SVKGKLFSWSGDGNNILHSLI  170 (306)
Q Consensus       114 ~~~~~~~~vpvINa~~~~~HPt--QaL~D~~Ti~e--------------------~~g-~l~~~~i~~vGd~~~v~hS~i  170 (306)
                      .+.+....|+|.|+.+....|.  .+++=++.+.+                    ..+ .+.|+++.++|- +++.....
T Consensus       102 ~~~~~~~gI~V~n~~g~~~~~vAE~~l~~iL~~~r~~~~~~~~~~~g~~~~~~~~~~~~~L~gk~vgIiG~-G~IG~~va  180 (351)
T 3jtm_A          102 LQAAAAAGLTVAEVTGSNVVSVAEDELMRILILMRNFVPGYNQVVKGEWNVAGIAYRAYDLEGKTIGTVGA-GRIGKLLL  180 (351)
T ss_dssp             HHHHHHTTCEEEECTTTTHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCHHHHHTTCCCSTTCEEEEECC-SHHHHHHH
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEECCCCEEEEECC-CCHHHHHH
T ss_conf             44336798699989987869999999999999975215777664328632345566633115876667774-65299999


Q ss_pred             HCCCCCCEEEEEECHHCCCCCCCCHHHHHCCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCCCHHH
Q ss_conf             00123312576520000132100002432013322213664663068733222100000022013331001112336889
Q gi|255764473|r  171 EGAARFNYLLNIATPIGSEPRNEYLNWARNQGASVALFHDAVQAVKGAHCVFTDTWISMNQEFKAREEHVFQPFQVNLSL  250 (306)
Q Consensus       171 ~~~~~~g~~v~~~~P~~~~~~~~~~~~~~~~g~~i~~~~d~~eal~~aD~V~~~~~~~~~~~~~~~~~~~~~~y~i~~~~  250 (306)
                      ..+.-||+++....|....+..     .+..  .+....++++.++.+|+|..-.  .+..+         ...-++.+.
T Consensus       181 ~~l~~fgm~V~~~d~~~~~~~~-----~~~~--~~~~~~~l~ell~~sDvI~l~~--Plt~~---------T~~li~~~~  242 (351)
T 3jtm_A          181 QRLKPFGCNLLYHDRLQMAPEL-----EKET--GAKFVEDLNEMLPKCDVIVINM--PLTEK---------TRGMFNKEL  242 (351)
T ss_dssp             HHHGGGCCEEEEECSSCCCHHH-----HHHH--CCEECSCHHHHGGGCSEEEECS--CCCTT---------TTTCBSHHH
T ss_pred             HHHHHCCCEEEEECCCCCCHHH-----HHHC--CCCCCCCHHHHHHHCCEEEEEC--CCCCC---------CCCCCCHHH
T ss_conf             9998638867844587776666-----7751--9600478999985499999936--78743---------325639999


Q ss_pred             HHCCCCCCEEECCC
Q ss_conf             96289872992599
Q gi|255764473|r  251 MSMAHPDALFMHCL  264 (306)
Q Consensus       251 l~~a~~~~~vmHpl  264 (306)
                      ++.+|+++++.-.+
T Consensus       243 ~~~mk~~a~lIN~s  256 (351)
T 3jtm_A          243 IGKLKKGVLIVNNA  256 (351)
T ss_dssp             HHHSCTTEEEEECS
T ss_pred             HHHCCCCCEEEECC
T ss_conf             97379997899858